3K8UA

Crystal structure of the peptidase domain of streptococcus coma, a bi-functional abc transporter involved in quorum sensing pathway
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
HYKLVPQIDTRDCGPAVLASVAKHYGSNYSIAYLRELSKTNKQGTTALGIVEAAKKLGFETRSIKADMTLFDYNDLTYPFIVHVIKGKRLQHYYVVYGSQNNQLIIGDPDPSVKVTRMSKERFQSEWTGLAIFLAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ABC transporter, ATP-binding protein ComA
publication title Crystal structure of the peptidase domain of Streptococcus ComA, a bifunctional ATP-binding cassette transporter involved in the quorum-sensing pathway
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03412 Peptidase_C39 Peptidase C39 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3k8uA01
4BPVA 1FH0A 4W5BA 2NQAA 1Y08A 5JA7A 1DF0A 2PNSA 5K16A 3IV2A 4BSQA 2G6DA 3IMAA 4PP1A 1STFE 3PW3A 1ITOA 4KLBA 3OF8A 4X6IA 2AUZA 1EF7A 1PBHA 2AUXA 4N8WA 2DC9A 2E03A 5CVOB 1CSBB 2IBIA 1PIPA 4YYSA 2H7JA 2R9CA 1M6DA 1EWPA 2XU5A 2OP3A 3I06A 3PNRA 1ICFA 4AXLA 2FQ9A 9PAPA 3CH2X 1IWDA 1PCIA 2NQGA 3WXGA 3H8BA 1PPOA 1KFXL 1CV8A 2F7DA 2R6NA 1U9XA 1MIRA 4CZWA 2GHUA 2B1MA 2IPPB 3ERVA 3BC3A 2Y6EA 1CQDA 4Q8HA 3AI8A 4W4UA 4WA6A 3QSDA 4BQVA 4QRGA 1TL9A 1MEMA 4BS6A 1TU6A 6PADA 3H8CA 4XR7A 1Q6KA 3RVWA 1ZIVA 2DCDA 2DC6A 3B79A 1U5IA 1SP4B 1YT7A 2G8EA 1HUCB 4MZSA 4PADA 4DMYA 4QRXA 3LFYA 3MTNA 1NLJA 1VJVA 2YJ2A 7PCKA 4I07A 3MHHA 2O6XA 2PADA 5CVMA 2Y5BA 4YYVA 1QXPA 1F2CA 3S3RA 5JH3A 2GFOA 3KSEA 2ARYA 1A6RA 1AYVA 1YK7A 2R9FA 1GECE 3MORA 2ATOA 1QMYA 4YYRA 2FTDA 2DJGB 2YJCA 4DMXA 5EGWA 2G7YA 4OELA 1F2BA 4K7CA 2OULA 1JQPA 3BPFA 3KFQA 4Q8GA 1GLOA 1CB5A 1MDWA 2YJ8A 3OVZA 4QH6A 4OEMA 3MHSA 1BQIA 2DCAA 3H89A 2BDLA 1NB3A 1F29A 3WXEA 1NB5A 1AECA 1POPA 3KW9A 3KWZA 3TNXA 3H7DA 2CIOA 1PADA 1YK8A 5F02A 4YYUA 1VSNA 2CB5A 1CTEA 1KXRA 3IOQA 1PPPA 2AU1A 2PREA 2YJ9A 3P5VA 3BOWA 1BY8A 1X9YA 3O0UA 3H6SA 2R9NA 2NQIA 1PE6A 4BS5A 5EF4A 1AYWA 1AU2A 4P6EA 1NQCA 2DC7A 3WXFA 1TLOA 1KHQA 8PCHA 2E01A 3K24A 1CS8A 4YVAA 1U9QX 2BDZA 2FT2A 4MSXA 3ZUAA 2AS8A 4HWYA 1ATKA 4FIPA 4CDEB 5CHVA 3K9MA 3LXSA 4YV8A 3BCNA 1PXVA 1KFUL 2R9OA 2FYEA 1AYUA 4ZUXU 1Y4HA 1CPJA 3IUTA 2DZYA 3OVXA 4P6GA 2NQDB 1MEGA 2C0YA 4FJCA 4N4ZA 2DCBA 3M99A 2DZZA 1PPNA 4CDFB 5CHTA 1BGOA 1NPZA 2DJFB 4N79A 3CH3X 1AIMA 3CBKA 2JQGR 2R9MA 2P0RA 1QDQA 2XU3A 4G54A 4RY2A 3E1ZB 5PADA 3P5WA 1KHPA 3RVVA 4CDDB 4PP2E 3OF9A 4W5CA 5CVNB 3P5XA 2ACTA 4YYQA 1QOLA 4FK5A 2XU1A 1U9VA 1THEA 1XKGA 1YVBA 3DF0A 3PBHA 3F5VA 2HD5A 3N3GA 2F1GA 3PDFA 1PPDA 2HHNA 1K3BB 2XU4A 3USVA 2G8JA 4X6HA 4QRVA 4CDCB 1DEUA 2DC8A 3BWKA 2E00A 2AIMA 3HWNA 2DCCA 3O1GA 1S4VA 1ZCMA 2E02A 2AYOA 3U8EA 2AVWA 3V6EA 1MHWA 1AU3A 2FUDA 3RVXA 3F75A 1F2AA 2FRQA 3KKUA 1O0EA 3HHAA 4AXMA 1EWOA 1EWMA 3D6SA 3KWBX 3HD3A 3C9EA 5FPWA 1NL6A 1BP4A 1U9WA 5J94A 4XUIA 3P5UA 3I3TA 2OZ2A 2B1NA 1GCBA 3HHIA 2WBFX 4QBBA 4X6JA 2YJBA 4PI3A 4MZOA 1GMYA 3QJ3A 2JQFR 1CJLA 1ME4A 3S3QA 2VHFA 3OISA 1AU0A 3GCBA 3IHPA 4YYWA 1EWLA 3K8UA 2HH5A 1YALA 3IEJA 4I05A 3KX1A 1CVZA 3BPMA 2FO5A 2FRAA 3QT4A 1SNKA 3CBJA 1MS6A 5A24A 4I04A 2AYNA 2HXZA 3V6CA 3N3KA 3NHEA 2P86A 2VHSA 2P7UA 2PBHA 1AU4A 1ME3A 3N4CA
chains in the Genus database with same CATH superfamily
4BPVA 1FH0A 4W5BA 2NQAA 1Y08A 5EZQA 5JA7A 1DF0A 2PNSA 5K16A 3IV2A 4BSQA 2G6DA 3IMAA 4PP1A 1STFE 3PW3A 3PT2A 1ITOA 4KLBA 3OF8A 4BOSA 4X6IA 2AUZA 1EF7A 1PBHA 2AUXA 3BY4A 4N8WA 2DC9A 3RNVA 3O65A 4OW0A 2E03A 4M0WA 5CVOB 1CSBB 2IBIA 1PIPA 1PVJA 4YYSA 2H7JA 2R9CA 1UKFA 1M6DA 1EWPA 2XU5A 2OP3A 3I06A 3PNRA 1ICFA 4AXLA 2FQ9A 9PAPA 2DOSA 3CH2X 1IWDA 1PCIA 3IFUA 1YZBA 2NQGA 3WXGA 3H8BA 1PPOA 2BTWA 1KFXL 1CV8A 2F7DA 2R6NA 1U9XA 4R3DA 1MIRA 4CZWA 2GHUA 2B1MA 2IPPB 3ERVA 3BC3A 2Y6EA 1CQDA 4Q8HA 2HWKA 3AI8A 4W4UA 4WA6A 3QSDA 4BQVA 4QRGA 3TMPA 1TL9A 1MEMA 3MP2A 4RF1A 4A5UA 2UZJA 4BS6A 1TU6A 6PADA 3H8CA 4XR7A 1Q6KA 3RVWA 1ZIVA 2DCDA 2DC6A 3ZNHA 3B79A 3PRMA 4XZXA 1U5IA 1SP4B 1YT7A 2G8EA 1HUCB 4MZSA 2AGAA 4PADA 4DMYA 4QRXA 3LFYA 3MTNA 3PRPA 1NLJA 1VJVA 4D8BA 2YJ2A 7PCKA 4I07A 3MHHA 2O6XA 2PADA 5CVMA 2Y5BA 2JRIA 4YYVA 1QXPA 1F2CA 3S3RA 5JH3A 2GFOA 3KSEA 2ARYA 1A6RA 1AYVA 4HXDB 1YK7A 2R9FA 1GECE 3PHUA 3MORA 2ATOA 1QMYA 4YYRA 2FTDA 2DJGB 2YJCA 4DMXA 5EGWA 2G7YA 4OELA 1F2BA 4REZA 4K7CA 2OULA 1JQPA 3BPFA 3KFQA 4Q8GA 1GLOA 1CB5A 4IUMA 4BOZA 1MDWA 2YJ8A 3OVZA 4QH6A 5KO3A 3MJ5A 4OEMA 3MHSA 1BQIA 2DCAA 3H89A 2BDLA 1NB3A 1F29A 4PT5A 3WXEA 1NB5A 1AECA 1POPA 3KW9A 3KWZA 3TNXA 3H7DA 2CIOA 4BOQA 1PADA 1YK8A 5F02A 4YYUA 1VSNA 3PSEA 2CB5A 1CTEA 1KXRA 3IOQA 1PPPA 2AU1A 2PREA 4ZTBA 4WURA 2YJ9A 3P5VA 3BOWA 5JZEA 1BY8A 1X9YA 3O0UA 3H6SA 2R9NA 2NQIA 1PE6A 4BS5A 5EF4A 3PHWA 1AYWA 1AU2A 4P6EA 1NQCA 2DC7A 3WXFA 1TLOA 1KHQA 8PCHA 2E01A 3K24A 1CS8A 4YVAA 1U9QX 3BBAA 2BDZA 2FT2A 4MSXA 4GUAA 3ZUAA 2AS8A 3C0RA 4HWYA 1ATKA 4FIPA 4CDEB 5CHVA 3K9MA 3LXSA 4YV8A 3BCNA 1PXVA 1KFUL 2R9OA 2FYEA 2BU3A 1AYUA 4ZUXU 1Y4HA 1CPJA 3IUTA 2DZYA 3OVXA 4P6GA 2NQDB 1MEGA 5EZSA 2J7QA 2C0YA 4FJCA 4N4ZA 3W30A 2DCBA 4D8EA 3M99A 2DZZA 1PPNA 4CDFB 5CHTA 1BGOA 1NPZA 2DJFB 4N79A 4IP3A 3CH3X 1AIMA 3CBKA 2JQGR 2JTCA 2BTWB 2R9MA 2P0RA 1QDQA 2XU3A 4G54A 4RY2A 3E1ZB 5PADA 3PHXA 4OVZA 3P5WA 1KHPA 3RVVA 4CDDB 4PP2E 3OF9A 4W5CA 5CVNB 3B21A 4BOPA 3P5XA 2ACTA 4P16A 4YYQA 1QOLA 4RKXA 2J7QC 4FK5A 2XU1A 1U9VA 1THEA 1XKGA 4MI7A 1YVBA 3DF0A 3PBHA 3F5VA 2HD5A 3N3GA 2F1GA 3PDFA 4D8IA 1PPDA 2HHNA 1K3BB 2XU4A 3USVA 2G8JA 4X6HA 4QRVA 4CDCB 1DEUA 2DC8A 3BWKA 2E00A 2AIMA 3HWNA 2DCCA 3O1GA 1S4VA 2FE8A 1ZCMA 2E02A 4MM3B 2AYOA 3U8EA 2AVWA 3V6EA 1MHWA 1AU3A 2FUDA 3RVXA 3F75A 1F2AA 2FRQA 3KKUA 1O0EA 3HHAA 4AXMA 1EWOA 1EWMA 3D6SA 3KWBX 3HD3A 3C9EA 5FPWA 1NL6A 1BP4A 1U9WA 3W31A 5J94A 4XUIA 3E9SA 4RF0A 2Z84A 3P5UA 4OVZB 3OQCA 3I3TA 2OZ2A 2B1NA 1GCBA 3HHIA 2WBFX 4QBBA 4X6JA 2YJBA 5E6JA 4MZOA 4PI3A 1GMYA 3QJ3A 2JQFR 1DKIA 1CJLA 1ME4A 3S3QA 2VHFA 3OISA 1AU0A 3GCBA 3IHPA 4YYWA 1EWLA 3K8UA 2HH5A 1YALA 3IEJA 4I05A 3TRKA 3KX1A 1CVZA 3BPMA 2FO5A 3MTVA 2FRAA 3QT4A 1SNKA 3CBJA 1MS6A 5A24A 4RNAA 4I04A 2AYNA 2HXZA 3V6CA 4BOUA 3N3KA 3BB7A 3NHEA 2P86A 2VHSA 2P7UA 2PBHA 1AU4A 1ME3A 3N4CA
chains in the Genus database with same CATH topology
4BPVA 1FH0A 4W5BA 2NQAA 1Y08A 5JA7A 1DF0A 2PNSA 5K16A 3IV2A 4BSQA 2G6DA 3IMAA 4PP1A 1STFE 3PW3A 1ITOA 4KLBA 3OF8A 4X6IA 2AUZA 1EF7A 1PBHA 2AUXA 4N8WA 2DC9A 2E03A 5CVOB 1CSBB 2IBIA 1PIPA 4YYSA 2H7JA 2R9CA 2VFBA 1M6DA 1EWPA 2XU5A 2OP3A 3I06A 3PNRA 1ICFA 4AXLA 2FQ9A 9PAPA 3CH2X 1IWDA 1PCIA 2NQGA 3WXGA 3H8BA 1PPOA 1GX3A 1KFXL 1CV8A 2F7DA 2R6NA 1U9XA 1MIRA 4CZWA 2GHUA 2B1MA 2IPPB 3ERVA 3BC3A 2Y6EA 1CQDA 4NV7A 4Q8HA 3AI8A 4W4UA 4WA6A 3QSDA 4BQVA 4QRGA 1TL9A 1MEMA 4BS6A 1TU6A 6PADA 3H8CA 4XR7A 1Q6KA 3RVWA 1ZIVA 2DCDA 2DC6A 3B79A 1U5IA 1SP4B 1YT7A 2G8EA 1HUCB 4MZSA 4PADA 4DMYA 4QRXA 3LFYA 3MTNA 1NLJA 1VJVA 2YJ2A 7PCKA 4I07A 3MHHA 2O6XA 2PADA 5CVMA 2Y5BA 4YYVA 1QXPA 1F2CA 3S3RA 5JH3A 2GFOA 3KSEA 2ARYA 1E2TA 1A6RA 1AYVA 1YK7A 2R9FA 1GECE 3MORA 2ATOA 1QMYA 4YYRA 2FTDA 2DJGB 2YJCA 4DMXA 5EGWA 2G7YA 4OELA 1F2BA 4K7CA 2OULA 1JQPA 3BPFA 3KFQA 4Q8GA 1GLOA 1CB5A 3LTWA 1MDWA 2YJ8A 3OVZA 4QH6A 4OEMA 3MHSA 1BQIA 2DCAA 3H89A 2BDLA 1NB3A 1W6FA 1F29A 3WXEA 1NB5A 1AECA 1POPA 3KW9A 3KWZA 4C5PA 3TNXA 3H7DA 2CIOA 1PADA 1YK8A 5F02A 4YYUA 1VSNA 2CB5A 1CTEA 1KXRA 3IOQA 1PPPA 2AU1A 2PREA 2YJ9A 3P5VA 3BOWA 1BY8A 1X9YA 3O0UA 3H6SA 2R9NA 2NQIA 1PE6A 4BS5A 5EF4A 1AYWA 1AU2A 4P6EA 1NQCA 2DC7A 3WXFA 1TLOA 1KHQA 8PCHA 2E01A 3K24A 1CS8A 4YVAA 1U9QX 2BDZA 2FT2A 4MSXA 3ZUAA 2AS8A 4HWYA 1ATKA 4FIPA 4CDEB 5CHVA 3K9MA 3LXSA 4YV8A 3BCNA 1PXVA 1KFUL 2R9OA 2FYEA 1AYUA 4ZUXU 1Y4HA 1CPJA 3IUTA 2DZYA 3OVXA 4P6GA 2NQDB 1MEGA 4BGFA 2C0YA 4FJCA 4N4ZA 2DCBA 3M99A 2DZZA 1PPNA 4CDFB 5CHTA 1BGOA 1NPZA 2DJFB 4N79A 3CH3X 1AIMA 3CBKA 2JQGR 2R9MA 2P0RA 1QDQA 2XU3A 4G54A 4RY2A 3E1ZB 5PADA 3P5WA 1KHPA 3RVVA 4CDDB 4PP2E 3OF9A 4W5CA 5CVNB 3P5XA 2ACTA 4YYQA 1QOLA 4FK5A 2XU1A 3D9WA 1U9VA 1THEA 1XKGA 1YVBA 3DF0A 3PBHA 3F5VA 2HD5A 3N3GA 2F1GA 3PDFA 1PPDA 2HHNA 1K3BB 2XU4A 3USVA 2G8JA 4X6HA 4QRVA 4CDCB 1DEUA 2DC8A 3BWKA 2E00A 2AIMA 3HWNA 2DCCA 3O1GA 1S4VA 1ZCMA 2E02A 2AYOA 3U8EA 2AVWA 3V6EA 1MHWA 1AU3A 2FUDA 3RVXA 3F75A 1F2AA 2FRQA 3KKUA 1O0EA 3HHAA 4AXMA 2BSZA 1EWOA 1EWMA 3D6SA 3KWBX 3HD3A 3C9EA 5FPWA 4B55A 1NL6A 1BP4A 1U9WA 5J94A 1W4TA 4XUIA 3P5UA 3I3TA 2OZ2A 2B1NA 1GCBA 3HHIA 2WBFX 4QBBA 4X6JA 2YJBA 4MZOA 4PI3A 1GMYA 3QJ3A 2JQFR 1CJLA 1ME4A 3S3QA 4GUZA 2VHFA 3OISA 1AU0A 3GCBA 3IHPA 4YYWA 1EWLA 3K8UA 2HH5A 1YALA 3IEJA 4I05A 3KX1A 1CVZA 3BPMA 1W5RA 2FO5A 2FRAA 3QT4A 1SNKA 3CBJA 1MS6A 2VFCA 5A24A 4I04A 2AYNA 2HXZA 3V6CA 3N3KA 4NV8A 3NHEA 2P86A 2VHSA 2P7UA 2PBHA 1AU4A 1ME3A 3N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPV A;  1FH0 A;  4W5B A;  2NQA A;  1Y08 A;  5JA7 A;  1DF0 A;  2PNS A;  5K16 A;  3IV2 A;  4BSQ A;  2G6D A;  3IMA A;  4PP1 A;  1STF E;  3PW3 A;  1ITO A;  4KLB A;  3OF8 A;  4X6I A;  2AUZ A;  1EF7 A;  1PBH A;  2AUX A;  4N8W A;  2DC9 A;  2E03 A;  5CVO B;  1CSB B;  2IBI A;  1PIP A;  4YYS A;  2H7J A;  2R9C A;  1M6D A;  1EWP A;  2XU5 A;  2OP3 A;  3I06 A;  3PNR A;  1ICF A;  4AXL A;  2FQ9 A;  9PAP A;  3CH2 X;  1IWD A;  1PCI A;  2NQG A;  3WXG A;  3H8B A;  1PPO A;  1KFX L;  1CV8 A;  2F7D A;  2R6N A;  1U9X A;  1MIR A;  4CZW A;  2GHU A;  2B1M A;  2IPP B;  3ERV A;  3BC3 A;  2Y6E A;  1CQD A;  4Q8H A;  3AI8 A;  4W4U A;  4WA6 A;  3QSD A;  4BQV A;  4QRG A;  1TL9 A;  1MEM A;  4BS6 A;  1TU6 A;  6PAD A;  3H8C A;  4XR7 A;  1Q6K A;  3RVW A;  1ZIV A;  2DCD A;  2DC6 A;  3B79 A;  1U5I A;  1SP4 B;  1YT7 A;  2G8E A;  1HUC B;  4MZS A;  4PAD A;  4DMY A;  4QRX A;  3LFY A;  3MTN A;  1NLJ A;  1VJV A;  2YJ2 A;  7PCK A;  4I07 A;  3MHH A;  2O6X A;  2PAD A;  5CVM A;  2Y5B A;  4YYV A;  1QXP A;  1F2C A;  3S3R A;  5JH3 A;  2GFO A;  3KSE A;  2ARY A;  1A6R A;  1AYV A;  1YK7 A;  2R9F A;  1GEC E;  3MOR A;  2ATO A;  1QMY A;  4YYR A;  2FTD A;  2DJG B;  2YJC A;  4DMX A;  5EGW A;  2G7Y A;  4OEL A;  1F2B A;  4K7C A;  2OUL A;  1JQP A;  3BPF A;  3KFQ A;  4Q8G A;  1GLO A;  1CB5 A;  1MDW A;  2YJ8 A;  3OVZ A;  4QH6 A;  4OEM A;  3MHS A;  1BQI A;  2DCA A;  3H89 A;  2BDL A;  1NB3 A;  1F29 A;  3WXE A;  1NB5 A;  1AEC A;  1POP A;  3KW9 A;  3KWZ A;  3TNX A;  3H7D A;  2CIO A;  1PAD A;  1YK8 A;  5F02 A;  4YYU A;  1VSN A;  2CB5 A;  1CTE A;  1KXR A;  3IOQ A;  1PPP A;  2AU1 A;  2PRE A;  2YJ9 A;  3P5V A;  3BOW A;  1BY8 A;  1X9Y A;  3O0U A;  3H6S A;  2R9N A;  2NQI A;  1PE6 A;  4BS5 A;  5EF4 A;  1AYW A;  1AU2 A;  4P6E A;  1NQC A;  2DC7 A;  3WXF A;  1TLO A;  1KHQ A;  8PCH A;  2E01 A;  3K24 A;  1CS8 A;  4YVA A;  1U9Q X;  2BDZ A;  2FT2 A;  4MSX A;  3ZUA A;  2AS8 A;  4HWY A;  1ATK A;  4FIP A;  4CDE B;  5CHV A;  3K9M A;  3LXS A;  4YV8 A;  3BCN A;  1PXV A;  1KFU L;  2R9O A;  2FYE A;  1AYU A;  4ZUX U;  1Y4H A;  1CPJ A;  3IUT A;  2DZY A;  3OVX A;  4P6G A;  2NQD B;  1MEG A;  2C0Y A;  4FJC A;  4N4Z A;  2DCB A;  3M99 A;  2DZZ A;  1PPN A;  4CDF B;  5CHT A;  1BGO A;  1NPZ A;  2DJF B;  4N79 A;  3CH3 X;  1AIM A;  3CBK A;  2JQG R;  2R9M A;  2P0R A;  1QDQ A;  2XU3 A;  4G54 A;  4RY2 A;  3E1Z B;  5PAD A;  3P5W A;  1KHP A;  3RVV A;  4CDD B;  4PP2 E;  3OF9 A;  4W5C A;  5CVN B;  3P5X A;  2ACT A;  4YYQ A;  1QOL A;  4FK5 A;  2XU1 A;  1U9V A;  1THE A;  1XKG A;  1YVB A;  3DF0 A;  3PBH A;  3F5V A;  2HD5 A;  3N3G A;  2F1G A;  3PDF A;  1PPD A;  2HHN A;  1K3B B;  2XU4 A;  3USV A;  2G8J A;  4X6H A;  4QRV A;  4CDC B;  1DEU A;  2DC8 A;  3BWK A;  2E00 A;  2AIM A;  3HWN A;  2DCC A;  3O1G A;  1S4V A;  1ZCM A;  2E02 A;  2AYO A;  3U8E A;  2AVW A;  3V6E A;  1MHW A;  1AU3 A;  2FUD A;  3RVX A;  3F75 A;  1F2A A;  2FRQ A;  3KKU A;  1O0E A;  3HHA A;  4AXM A;  1EWO A;  1EWM A;  3D6S A;  3KWB X;  3HD3 A;  3C9E A;  5FPW A;  1NL6 A;  1BP4 A;  1U9W A;  5J94 A;  4XUI A;  3P5U A;  3I3T A;  2OZ2 A;  2B1N A;  1GCB A;  3HHI A;  2WBF X;  4QBB A;  4X6J A;  2YJB A;  4PI3 A;  4MZO A;  1GMY A;  3QJ3 A;  2JQF R;  1CJL A;  1ME4 A;  3S3Q A;  2VHF A;  3OIS A;  1AU0 A;  3GCB A;  3IHP A;  4YYW A;  1EWL A;  3K8U A;  2HH5 A;  1YAL A;  3IEJ A;  4I05 A;  3KX1 A;  1CVZ A;  3BPM A;  2FO5 A;  2FRA A;  3QT4 A;  1SNK A;  3CBJ A;  1MS6 A;  5A24 A;  4I04 A;  2AYN A;  2HXZ A;  3V6C A;  3N3K A;  3NHE A;  2P86 A;  2VHS A;  2P7U A;  2PBH A;  1AU4 A;  1ME3 A;  3N4C A; 
#chains in the Genus database with same CATH topology
 4BPV A;  1FH0 A;  4W5B A;  2NQA A;  1Y08 A;  5EZQ A;  5JA7 A;  1DF0 A;  2PNS A;  5K16 A;  3IV2 A;  4BSQ A;  2G6D A;  3IMA A;  4PP1 A;  1STF E;  3PW3 A;  3PT2 A;  1ITO A;  4KLB A;  3OF8 A;  4BOS A;  4X6I A;  2AUZ A;  1EF7 A;  1PBH A;  2AUX A;  3BY4 A;  4N8W A;  2DC9 A;  3RNV A;  3O65 A;  4OW0 A;  2E03 A;  4M0W A;  5CVO B;  1CSB B;  2IBI A;  1PIP A;  1PVJ A;  4YYS A;  2H7J A;  2R9C A;  1UKF A;  1M6D A;  1EWP A;  2XU5 A;  2OP3 A;  3I06 A;  3PNR A;  1ICF A;  4AXL A;  2FQ9 A;  9PAP A;  2DOS A;  3CH2 X;  1IWD A;  1PCI A;  3IFU A;  1YZB A;  2NQG A;  3WXG A;  3H8B A;  1PPO A;  2BTW A;  1KFX L;  1CV8 A;  2F7D A;  2R6N A;  1U9X A;  4R3D A;  1MIR A;  4CZW A;  2GHU A;  2B1M A;  2IPP B;  3ERV A;  3BC3 A;  2Y6E A;  1CQD A;  4Q8H A;  2HWK A;  3AI8 A;  4W4U A;  4WA6 A;  3QSD A;  4BQV A;  4QRG A;  3TMP A;  1TL9 A;  1MEM A;  3MP2 A;  4RF1 A;  4A5U A;  2UZJ A;  4BS6 A;  1TU6 A;  6PAD A;  3H8C A;  4XR7 A;  1Q6K A;  3RVW A;  1ZIV A;  2DCD A;  2DC6 A;  3ZNH A;  3B79 A;  3PRM A;  4XZX A;  1U5I A;  1SP4 B;  1YT7 A;  2G8E A;  1HUC B;  4MZS A;  2AGA A;  4PAD A;  4DMY A;  4QRX A;  3LFY A;  3MTN A;  3PRP A;  1NLJ A;  1VJV A;  4D8B A;  2YJ2 A;  7PCK A;  4I07 A;  3MHH A;  2O6X A;  2PAD A;  5CVM A;  2Y5B A;  2JRI A;  4YYV A;  1QXP A;  1F2C A;  3S3R A;  5JH3 A;  2GFO A;  3KSE A;  2ARY A;  1A6R A;  1AYV A;  4HXD B;  1YK7 A;  2R9F A;  1GEC E;  3PHU A;  3MOR A;  2ATO A;  1QMY A;  4YYR A;  2FTD A;  2DJG B;  2YJC A;  4DMX A;  5EGW A;  2G7Y A;  4OEL A;  1F2B A;  4REZ A;  4K7C A;  2OUL A;  1JQP A;  3BPF A;  3KFQ A;  4Q8G A;  1GLO A;  1CB5 A;  4IUM A;  4BOZ A;  1MDW A;  2YJ8 A;  3OVZ A;  4QH6 A;  5KO3 A;  3MJ5 A;  4OEM A;  3MHS A;  1BQI A;  2DCA A;  3H89 A;  2BDL A;  1NB3 A;  1F29 A;  4PT5 A;  3WXE A;  1NB5 A;  1AEC A;  1POP A;  3KW9 A;  3KWZ A;  3TNX A;  3H7D A;  2CIO A;  4BOQ A;  1PAD A;  1YK8 A;  5F02 A;  4YYU A;  1VSN A;  3PSE A;  2CB5 A;  1CTE A;  1KXR A;  3IOQ A;  1PPP A;  2AU1 A;  2PRE A;  4ZTB A;  4WUR A;  2YJ9 A;  3P5V A;  3BOW A;  5JZE A;  1BY8 A;  1X9Y A;  3O0U A;  3H6S A;  2R9N A;  2NQI A;  1PE6 A;  4BS5 A;  5EF4 A;  3PHW A;  1AYW A;  1AU2 A;  4P6E A;  1NQC A;  2DC7 A;  3WXF A;  1TLO A;  1KHQ A;  8PCH A;  2E01 A;  3K24 A;  1CS8 A;  4YVA A;  1U9Q X;  3BBA A;  2BDZ A;  2FT2 A;  4MSX A;  4GUA A;  3ZUA A;  2AS8 A;  3C0R A;  4HWY A;  1ATK A;  4FIP A;  4CDE B;  5CHV A;  3K9M A;  3LXS A;  4YV8 A;  3BCN A;  1PXV A;  1KFU L;  2R9O A;  2FYE A;  2BU3 A;  1AYU A;  4ZUX U;  1Y4H A;  1CPJ A;  3IUT A;  2DZY A;  3OVX A;  4P6G A;  2NQD B;  1MEG A;  5EZS A;  2J7Q A;  2C0Y A;  4FJC A;  4N4Z A;  3W30 A;  2DCB A;  4D8E A;  3M99 A;  2DZZ A;  1PPN A;  4CDF B;  5CHT A;  1BGO A;  1NPZ A;  2DJF B;  4N79 A;  4IP3 A;  3CH3 X;  1AIM A;  3CBK A;  2JQG R;  2JTC A;  2BTW B;  2R9M A;  2P0R A;  1QDQ A;  2XU3 A;  4G54 A;  4RY2 A;  3E1Z B;  5PAD A;  3PHX A;  4OVZ A;  3P5W A;  1KHP A;  3RVV A;  4CDD B;  4PP2 E;  3OF9 A;  4W5C A;  5CVN B;  3B21 A;  4BOP A;  3P5X A;  2ACT A;  4P16 A;  4YYQ A;  1QOL A;  4RKX A;  2J7Q C;  4FK5 A;  2XU1 A;  1U9V A;  1THE A;  1XKG A;  4MI7 A;  1YVB A;  3DF0 A;  3PBH A;  3F5V A;  2HD5 A;  3N3G A;  2F1G A;  3PDF A;  4D8I A;  1PPD A;  2HHN A;  1K3B B;  2XU4 A;  3USV A;  2G8J A;  4X6H A;  4QRV A;  4CDC B;  1DEU A;  2DC8 A;  3BWK A;  2E00 A;  2AIM A;  3HWN A;  2DCC A;  3O1G A;  1S4V A;  2FE8 A;  1ZCM A;  2E02 A;  4MM3 B;  2AYO A;  3U8E A;  2AVW A;  3V6E A;  1MHW A;  1AU3 A;  2FUD A;  3RVX A;  3F75 A;  1F2A A;  2FRQ A;  3KKU A;  1O0E A;  3HHA A;  4AXM A;  1EWO A;  1EWM A;  3D6S A;  3KWB X;  3HD3 A;  3C9E A;  5FPW A;  1NL6 A;  1BP4 A;  1U9W A;  3W31 A;  5J94 A;  4XUI A;  3E9S A;  4RF0 A;  2Z84 A;  3P5U A;  4OVZ B;  3OQC A;  3I3T A;  2OZ2 A;  2B1N A;  1GCB A;  3HHI A;  2WBF X;  4QBB A;  4X6J A;  2YJB A;  5E6J A;  4MZO A;  4PI3 A;  1GMY A;  3QJ3 A;  2JQF R;  1DKI A;  1CJL A;  1ME4 A;  3S3Q A;  2VHF A;  3OIS A;  1AU0 A;  3GCB A;  3IHP A;  4YYW A;  1EWL A;  3K8U A;  2HH5 A;  1YAL A;  3IEJ A;  4I05 A;  3TRK A;  3KX1 A;  1CVZ A;  3BPM A;  2FO5 A;  3MTV A;  2FRA A;  3QT4 A;  1SNK A;  3CBJ A;  1MS6 A;  5A24 A;  4RNA A;  4I04 A;  2AYN A;  2HXZ A;  3V6C A;  4BOU A;  3N3K A;  3BB7 A;  3NHE A;  2P86 A;  2VHS A;  2P7U A;  2PBH A;  1AU4 A;  1ME3 A;  3N4C A; 
#chains in the Genus database with same CATH homology
 4BPV A;  1FH0 A;  4W5B A;  2NQA A;  1Y08 A;  5JA7 A;  1DF0 A;  2PNS A;  5K16 A;  3IV2 A;  4BSQ A;  2G6D A;  3IMA A;  4PP1 A;  1STF E;  3PW3 A;  1ITO A;  4KLB A;  3OF8 A;  4X6I A;  2AUZ A;  1EF7 A;  1PBH A;  2AUX A;  4N8W A;  2DC9 A;  2E03 A;  5CVO B;  1CSB B;  2IBI A;  1PIP A;  4YYS A;  2H7J A;  2R9C A;  2VFB A;  1M6D A;  1EWP A;  2XU5 A;  2OP3 A;  3I06 A;  3PNR A;  1ICF A;  4AXL A;  2FQ9 A;  9PAP A;  3CH2 X;  1IWD A;  1PCI A;  2NQG A;  3WXG A;  3H8B A;  1PPO A;  1GX3 A;  1KFX L;  1CV8 A;  2F7D A;  2R6N A;  1U9X A;  1MIR A;  4CZW A;  2GHU A;  2B1M A;  2IPP B;  3ERV A;  3BC3 A;  2Y6E A;  1CQD A;  4NV7 A;  4Q8H A;  3AI8 A;  4W4U A;  4WA6 A;  3QSD A;  4BQV A;  4QRG A;  1TL9 A;  1MEM A;  4BS6 A;  1TU6 A;  6PAD A;  3H8C A;  4XR7 A;  1Q6K A;  3RVW A;  1ZIV A;  2DCD A;  2DC6 A;  3B79 A;  1U5I A;  1SP4 B;  1YT7 A;  2G8E A;  1HUC B;  4MZS A;  4PAD A;  4DMY A;  4QRX A;  3LFY A;  3MTN A;  1NLJ A;  1VJV A;  2YJ2 A;  7PCK A;  4I07 A;  3MHH A;  2O6X A;  2PAD A;  5CVM A;  2Y5B A;  4YYV A;  1QXP A;  1F2C A;  3S3R A;  5JH3 A;  2GFO A;  3KSE A;  2ARY A;  1E2T A;  1A6R A;  1AYV A;  1YK7 A;  2R9F A;  1GEC E;  3MOR A;  2ATO A;  1QMY A;  4YYR A;  2FTD A;  2DJG B;  2YJC A;  4DMX A;  5EGW A;  2G7Y A;  4OEL A;  1F2B A;  4K7C A;  2OUL A;  1JQP A;  3BPF A;  3KFQ A;  4Q8G A;  1GLO A;  1CB5 A;  3LTW A;  1MDW A;  2YJ8 A;  3OVZ A;  4QH6 A;  4OEM A;  3MHS A;  1BQI A;  2DCA A;  3H89 A;  2BDL A;  1NB3 A;  1W6F A;  1F29 A;  3WXE A;  1NB5 A;  1AEC A;  1POP A;  3KW9 A;  3KWZ A;  4C5P A;  3TNX A;  3H7D A;  2CIO A;  1PAD A;  1YK8 A;  5F02 A;  4YYU A;  1VSN A;  2CB5 A;  1CTE A;  1KXR A;  3IOQ A;  1PPP A;  2AU1 A;  2PRE A;  2YJ9 A;  3P5V A;  3BOW A;  1BY8 A;  1X9Y A;  3O0U A;  3H6S A;  2R9N A;  2NQI A;  1PE6 A;  4BS5 A;  5EF4 A;  1AYW A;  1AU2 A;  4P6E A;  1NQC A;  2DC7 A;  3WXF A;  1TLO A;  1KHQ A;  8PCH A;  2E01 A;  3K24 A;  1CS8 A;  4YVA A;  1U9Q X;  2BDZ A;  2FT2 A;  4MSX A;  3ZUA A;  2AS8 A;  4HWY A;  1ATK A;  4FIP A;  4CDE B;  5CHV A;  3K9M A;  3LXS A;  4YV8 A;  3BCN A;  1PXV A;  1KFU L;  2R9O A;  2FYE A;  1AYU A;  4ZUX U;  1Y4H A;  1CPJ A;  3IUT A;  2DZY A;  3OVX A;  4P6G A;  2NQD B;  1MEG A;  4BGF A;  2C0Y A;  4FJC A;  4N4Z A;  2DCB A;  3M99 A;  2DZZ A;  1PPN A;  4CDF B;  5CHT A;  1BGO A;  1NPZ A;  2DJF B;  4N79 A;  3CH3 X;  1AIM A;  3CBK A;  2JQG R;  2R9M A;  2P0R A;  1QDQ A;  2XU3 A;  4G54 A;  4RY2 A;  3E1Z B;  5PAD A;  3P5W A;  1KHP A;  3RVV A;  4CDD B;  4PP2 E;  3OF9 A;  4W5C A;  5CVN B;  3P5X A;  2ACT A;  4YYQ A;  1QOL A;  4FK5 A;  2XU1 A;  3D9W A;  1U9V A;  1THE A;  1XKG A;  1YVB A;  3DF0 A;  3PBH A;  3F5V A;  2HD5 A;  3N3G A;  2F1G A;  3PDF A;  1PPD A;  2HHN A;  1K3B B;  2XU4 A;  3USV A;  2G8J A;  4X6H A;  4QRV A;  4CDC B;  1DEU A;  2DC8 A;  3BWK A;  2E00 A;  2AIM A;  3HWN A;  2DCC A;  3O1G A;  1S4V A;  1ZCM A;  2E02 A;  2AYO A;  3U8E A;  2AVW A;  3V6E A;  1MHW A;  1AU3 A;  2FUD A;  3RVX A;  3F75 A;  1F2A A;  2FRQ A;  3KKU A;  1O0E A;  3HHA A;  4AXM A;  2BSZ A;  1EWO A;  1EWM A;  3D6S A;  3KWB X;  3HD3 A;  3C9E A;  5FPW A;  4B55 A;  1NL6 A;  1BP4 A;  1U9W A;  5J94 A;  1W4T A;  4XUI A;  3P5U A;  3I3T A;  2OZ2 A;  2B1N A;  1GCB A;  3HHI A;  2WBF X;  4QBB A;  4X6J A;  2YJB A;  4MZO A;  4PI3 A;  1GMY A;  3QJ3 A;  2JQF R;  1CJL A;  1ME4 A;  3S3Q A;  4GUZ A;  2VHF A;  3OIS A;  1AU0 A;  3GCB A;  3IHP A;  4YYW A;  1EWL A;  3K8U A;  2HH5 A;  1YAL A;  3IEJ A;  4I05 A;  3KX1 A;  1CVZ A;  3BPM A;  1W5R A;  2FO5 A;  2FRA A;  3QT4 A;  1SNK A;  3CBJ A;  1MS6 A;  2VFC A;  5A24 A;  4I04 A;  2AYN A;  2HXZ A;  3V6C A;  3N3K A;  4NV8 A;  3NHE A;  2P86 A;  2VHS A;  2P7U A;  2PBH A;  1AU4 A;  1ME3 A;  3N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...