3K8UA

Crystal structure of the peptidase domain of streptococcus coma, a bi-functional abc transporter involved in quorum sensing pathway
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
b'HYKLVPQIDTRDCGPAVLASVAKHYGSNYSIAYLRELSKTNKQGTTALGIVEAAKKLGFETRSIKADMTLFDYNDLTYPFIVHVIKGKRLQHYYVVYGSQNNQLIIGDPDPSVKVTRMSKERFQSEWTGLAIFLAPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ABC transporter, ATP-binding protein ComA
publication title Crystal structure of the peptidase domain of Streptococcus ComA, a bifunctional ATP-binding cassette transporter involved in the quorum-sensing pathway
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03412 Peptidase_C39 Peptidase C39 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3k8uA01
2R6NA 2FYEA 3K9MA 2AYNA 1YK8A 1KHQA 1BP4A 2WBFX 2FTDA 1AYWA 1X9YA 3KKUA 2CIOA 1Q6KA 1M6DA 2DC9A 2HXZA 2B1NA 4BQVA 4YYSA 3KWBX 3HD3A 1VJVA 1Y08A 3MTNA 5JA7A 2P7UA 5EF4A 2AVWA 7PCKA 1NPZA 5A24A 3PW3A 3V6CA 1AU2A 2B1MA 1TL9A 2R9CA 3PBHA 3F75A 2DCBA 1IWDA 1GMYA 1AECA 3QT4A 2YJCA 2G6DA 3P5WA 3MHHA 1Y4HA 2GHUA 2FRQA 1NQCA 4ZUXU 1GCBA 1ITOA 2P0RA 3USVA 4YV8A 1K3BB 3H89A 3LFYA 4QRGA 1ZIVA 3I06A 4BS6A 5CHTA 1PADA 3P5VA 2AUXA 2DZYA 3WXFA 3BC3A 4FK5A 3RVVA 4OEMA 2DCCA 1QXPA 2PREA 1QMYA 3IUTA 1CVZA 2E00A 4MZOA 1PCIA 4RY2A 3RVWA 4PADA 2FRAA 5J94A 1EWMA 1NL6A 2AYOA 4HWYA 3BWKA 4QBBA 1F29A 2G8EA 1O0EA 3S3QA 3E1ZB 2AU1A 2PNSA 3O0UA 1KXRA 4YYQA 2DCDA 3OISA 4X6JA 3GCBA 1MS6A 3WXGA 1AU3A 3QSDA 2HD5A 5PADA 1EWLA 2FQ9A 4OELA 1YVBA 1THEA 1F2BA 3LXSA 2JQGR 4Q8HA 4WA6A 2H7JA 2DC6A 1FH0A 2DJGB 4X6IA 5CVMA 3DF0A 3IMAA 4CDEB 3TNXA 1KHPA 3OF9A 2XU4A 1STFE 3CH3X 2Y6EA 2BDZA 2F1GA 4K7CA 1ME3A 3K8UA 3BCNA 1CS8A 2E01A 4P6EA 1MDWA 1U9WA 3RVXA 3HWNA 1KFXL 1A6RA 5F02A 1CB5A 4PI3A 1EWOA 3AI8A 3IEJA 2ACTA 4W4UA 1NB5A 1SP4B 5FPWA 1NB3A 3IHPA 3F5VA 1YK7A 4X6HA 4FIPA 1PIPA 4N4ZA 1AYUA 2AIMA 4DMYA 2XU5A 2IPPB 1GLOA 3H7DA 2DZZA 2G7YA 3OVXA 3I3TA 4CDDB 2XU1A 3BPMA 4G54A 1AU4A 3N4CA 5K16A 3U8EA 8PCHA 2R9FA 5CVOB 2G8JA 3N3KA 3MORA 4DMXA 3B79A 2ATOA 1AIMA 1CV8A 4PP2E 2DC7A 3QJ3A 4Q8GA 3WXEA 4QRVA 1MEMA 6PADA 2O6XA 2FO5A 4CZWA 1AU0A 2XU3A 3V6EA 2E02A 3BOWA 4MSXA 1ICFA 3D6SA 5EGWA 1AYVA 4I04A 3IOQA 5CVNB 4XR7A 4BSQA 2R9OA 2ARYA 2AS8A 2NQIA 2P86A 4YYUA 5CHVA 2OULA 4N79A 9PAPA 1PE6A 4MZSA 2AUZA 1MEGA 3ZUAA 1PPNA 2YJ8A 3CBKA 1MHWA 1YT7A 2F7DA 3C9EA 3CBJA 1BY8A 1PPOA 3HHAA 3H8BA 1ZCMA 1F2CA 3MHSA 4XUIA 2R9MA 1POPA 4W5CA 1S4VA 3KX1A 4I05A 2HH5A 3PDFA 3OVZA 1BQIA 4BS5A 1EF7A 1SNKA 3S3RA 1MIRA 1U9QX 1VSNA 2BDLA 4AXMA 2GFOA 2IBIA 3CH2X 4BPVA 2CB5A 3M99A 1NLJA 2YJBA 1U5IA 1PPPA 4I07A 3K24A 1BGOA 4AXLA 1PXVA 4YVAA 4PP1A 3PNRA 2NQGA 1GECE 1F2AA 4CDCB 2YJ9A 2Y5BA 1DF0A 4N8WA 3KFQA 5JH3A 2DJFB 1ATKA 1KFUL 1CQDA 2JQFR 1U9XA 1U9VA 3ERVA 1CJLA 1CPJA 1HUCB 1TLOA 1XKGA 2DCAA 3P5XA 1EWPA 3P5UA 4FJCA 2PADA 1CTEA 1DEUA 2NQAA 4QH6A 2OP3A 2FUDA 3KWZA 3O1GA 1CSBB 2NQDB 2E03A 4QRXA 2HHNA 3OF8A 4KLBA 2PBHA 2VHSA 3H6SA 1ME4A 4W5BA 3N3GA 2DC8A 3HHIA 1JQPA 3H8CA 3KSEA 2OZ2A 2YJ2A 2R9NA 1QDQA 2C0YA 3IV2A 4YYRA 4P6GA 1PPDA 1PBHA 2VHFA 3NHEA 4CDFB 4YYVA 2FT2A 3BPFA 1QOLA 3KW9A 1TU6A 4YYWA 1YALA
chains in the Genus database with same CATH superfamily
2R6NA 2FYEA 3K9MA 2AYNA 1YK8A 4R3DA 4REZA 1KHQA 1BP4A 2WBFX 3MJ5A 2FTDA 1AYWA 1X9YA 3KKUA 2CIOA 1Q6KA 1M6DA 2DC9A 2HXZA 2B1NA 4BQVA 4YYSA 3KWBX 3HD3A 1VJVA 1Y08A 3MTNA 5JA7A 2P7UA 5EF4A 2AVWA 7PCKA 1NPZA 5A24A 3PW3A 3V6CA 1AU2A 2B1MA 1TL9A 2R9CA 3PBHA 3F75A 2DCBA 1IWDA 1GMYA 1AECA 5JZEA 3QT4A 2YJCA 2G6DA 3P5WA 3MHHA 1Y4HA 2GHUA 2FRQA 3RNVA 4PT5A 1NQCA 4ZUXU 1GCBA 5EZSA 1ITOA 2P0RA 3USVA 4YV8A 1K3BB 3H89A 3LFYA 4QRGA 1ZIVA 3I06A 4BS6A 5CHTA 1PADA 2AGAA 3P5VA 2AUXA 2DZYA 4D8BA 2DOSA 3WXFA 3BC3A 4FK5A 5KO3A 3RVVA 4OEMA 2DCCA 1QXPA 2PREA 1QMYA 3IUTA 4D8IA 1CVZA 2E00A 4MZOA 1PCIA 4RY2A 3RVWA 4PADA 2FRAA 5J94A 1EWMA 1NL6A 2AYOA 4HWYA 3BWKA 4QBBA 1F29A 2G8EA 1O0EA 3S3QA 2BU3A 3E1ZB 4RF0A 2AU1A 2PNSA 3O0UA 1KXRA 3B21A 4IP3A 4YYQA 2DCDA 3OISA 4X6JA 3GCBA 1MS6A 3WXGA 1AU3A 3QSDA 2HD5A 5PADA 4IUMA 1EWLA 2FQ9A 4OELA 3BB7A 1YVBA 1THEA 1F2BA 4BOZA 3LXSA 2JQGR 4Q8HA 4WA6A 2H7JA 2DC6A 1FH0A 2DJGB 4X6IA 5CVMA 3DF0A 3IMAA 4CDEB 3PRMA 3PHXA 3TNXA 1KHPA 3OF9A 2XU4A 1STFE 3CH3X 2Y6EA 2BDZA 2F1GA 4K7CA 1ME3A 3K8UA 3BCNA 1CS8A 2E01A 2UZJA 4P6EA 4OW0A 1MDWA 1U9WA 2JTCA 3RVXA 4GUAA 3TMPA 3HWNA 1UKFA 1KFXL 1A6RA 5F02A 1CB5A 4PI3A 1EWOA 4BOQA 3AI8A 3IEJA 4HXDB 2ACTA 4W4UA 3MP2A 1NB5A 1SP4B 5FPWA 1NB3A 3IHPA 4OVZA 3F5VA 1YK7A 4X6HA 4FIPA 1PIPA 4N4ZA 1AYUA 4P16A 2AIMA 4DMYA 4BOSA 2XU5A 2IPPB 5EZQA 1GLOA 3H7DA 4RF1A 2DZZA 4D8EA 2G7YA 3OVXA 3I3TA 4CDDB 2XU1A 3BPMA 4G54A 1AU4A 3N4CA 5K16A 3U8EA 8PCHA 2R9FA 5CVOB 2G8JA 3N3KA 3MORA 4DMXA 3B79A 2ATOA 1AIMA 1CV8A 4PP2E 2DC7A 3QJ3A 4Q8GA 3WXEA 4QRVA 1MEMA 6PADA 4WURA 2O6XA 2FO5A 4CZWA 1AU0A 2XU3A 3V6EA 2E02A 3BOWA 4MSXA 1ICFA 3D6SA 5EGWA 1AYVA 4I04A 3IOQA 5CVNB 4XR7A 4BSQA 2R9OA 2Z84A 2ARYA 2AS8A 2NQIA 2P86A 4YYUA 5CHVA 2OULA 4N79A 9PAPA 1PE6A 4MZSA 2AUZA 1MEGA 5E6JA 1PPNA 2YJ8A 3CBKA 1MHWA 3ZUAA 3PRPA 1YT7A 2F7DA 3C9EA 3CBJA 3BBAA 1BY8A 1PPOA 3HHAA 3H8BA 4OVZB 1ZCMA 1F2CA 3MHSA 4XUIA 2R9MA 1POPA 4W5CA 1S4VA 3KX1A 4I05A 2HH5A 3PDFA 3OVZA 1BQIA 4BS5A 1EF7A 1SNKA 3S3RA 1MIRA 1U9QX 1VSNA 2BDLA 4AXMA 2BTWA 2GFOA 2IBIA 3CH2X 4BPVA 2CB5A 3M99A 1NLJA 2YJBA 3MTVA 2HWKA 1U5IA 1PPPA 2JRIA 4I07A 3K24A 1BGOA 4AXLA 2J7QC 1PXVA 4YVAA 4PP1A 3PNRA 2NQGA 1GECE 3OQCA 1F2AA 4CDCB 2YJ9A 3W30A 2Y5BA 3PT2A 1DF0A 3PHUA 4N8WA 3KFQA 5JH3A 4RKXA 3TRKA 1DKIA 1ATKA 1KFUL 1YZBA 2DJFB 1CQDA 4ZTBA 2JQFR 1U9XA 1U9VA 3ERVA 1CJLA 2FE8A 1CPJA 4M0WA 1HUCB 1TLOA 1XKGA 4A5UA 2DCAA 3P5XA 1EWPA 3P5UA 4MM3B 4BOPA 4FJCA 2PADA 1CTEA 1DEUA 2NQAA 3BY4A 4BOUA 3W31A 4RNAA 1PVJA 3ZNHA 4QH6A 2OP3A 3E9SA 2FUDA 3PSEA 3KWZA 3O1GA 1CSBB 2NQDB 2E03A 4MI7A 3PHWA 4QRXA 2HHNA 3OF8A 4KLBA 2PBHA 2VHSA 3H6SA 1ME4A 4W5BA 3N3GA 3O65A 2BTWB 2DC8A 3HHIA 1JQPA 3H8CA 3IFUA 3KSEA 2OZ2A 2YJ2A 4XZXA 2R9NA 1QDQA 2C0YA 3IV2A 4YYRA 4P6GA 1PPDA 1PBHA 2VHFA 3NHEA 4CDFB 4YYVA 2FT2A 3BPFA 1QOLA 3KW9A 3C0RA 1TU6A 2J7QA 4YYWA 1YALA
chains in the Genus database with same CATH topology
2R6NA 2FYEA 3K9MA 2AYNA 1YK8A 1KHQA 1BP4A 2WBFX 2FTDA 1AYWA 1X9YA 3KKUA 2CIOA 1Q6KA 1M6DA 2DC9A 4NV7A 2HXZA 2B1NA 4BQVA 2BSZA 4YYSA 3KWBX 3HD3A 1VJVA 1Y08A 3MTNA 5JA7A 2P7UA 5EF4A 2AVWA 7PCKA 1NPZA 5A24A 3PW3A 3V6CA 1AU2A 2B1MA 1TL9A 2R9CA 3PBHA 3F75A 2DCBA 1IWDA 1GMYA 1AECA 3QT4A 2YJCA 2G6DA 3P5WA 3MHHA 1Y4HA 2GHUA 2FRQA 1NQCA 4ZUXU 1GCBA 1ITOA 2P0RA 3USVA 4YV8A 1K3BB 3H89A 3LFYA 4QRGA 1ZIVA 3I06A 4BS6A 5CHTA 1PADA 3P5VA 2AUXA 2DZYA 3WXFA 3BC3A 4FK5A 3RVVA 4OEMA 2DCCA 1QXPA 2PREA 1QMYA 3IUTA 1CVZA 2E00A 4MZOA 1PCIA 4RY2A 3RVWA 4PADA 2FRAA 5J94A 1EWMA 1NL6A 2AYOA 4HWYA 3BWKA 4QBBA 1F29A 2G8EA 1O0EA 3S3QA 3E1ZB 2AU1A 2PNSA 3O0UA 1KXRA 4YYQA 2DCDA 3OISA 1W5RA 4X6JA 3GCBA 1MS6A 3WXGA 1AU3A 3QSDA 2HD5A 5PADA 1EWLA 2FQ9A 4OELA 1YVBA 1THEA 1F2BA 2VFCA 3LXSA 1GX3A 2JQGR 4Q8HA 4WA6A 2H7JA 2DC6A 2VFBA 1FH0A 2DJGB 4X6IA 5CVMA 3DF0A 3IMAA 4CDEB 3TNXA 1KHPA 3OF9A 2XU4A 1STFE 3CH3X 2Y6EA 2BDZA 2F1GA 4K7CA 1ME3A 3K8UA 3BCNA 1CS8A 2E01A 4P6EA 1MDWA 1U9WA 1E2TA 4NV8A 3RVXA 3HWNA 1KFXL 1A6RA 5F02A 1CB5A 4PI3A 1EWOA 3AI8A 4GUZA 3IEJA 2ACTA 4W4UA 1NB5A 1SP4B 5FPWA 1NB3A 3IHPA 3F5VA 1YK7A 4X6HA 4FIPA 1PIPA 4N4ZA 1AYUA 2AIMA 4DMYA 2XU5A 2IPPB 1GLOA 3H7DA 2DZZA 2G7YA 3OVXA 3I3TA 4CDDB 2XU1A 3BPMA 4G54A 1AU4A 3N4CA 5K16A 3U8EA 8PCHA 2R9FA 5CVOB 1W6FA 2G8JA 3N3KA 3MORA 4DMXA 3B79A 2ATOA 1AIMA 1CV8A 4PP2E 2DC7A 3QJ3A 4Q8GA 3WXEA 4QRVA 1MEMA 6PADA 2O6XA 2FO5A 4CZWA 1AU0A 2XU3A 3V6EA 2E02A 3BOWA 4C5PA 4MSXA 1ICFA 3D6SA 5EGWA 1AYVA 4I04A 3IOQA 5CVNB 4XR7A 4BSQA 2R9OA 2ARYA 2AS8A 2NQIA 2P86A 4YYUA 5CHVA 2OULA 4N79A 9PAPA 1PE6A 4MZSA 2AUZA 1MEGA 3ZUAA 1PPNA 2YJ8A 3CBKA 1MHWA 1YT7A 2F7DA 3C9EA 3CBJA 1BY8A 1PPOA 3HHAA 3H8BA 1ZCMA 1F2CA 3MHSA 4XUIA 2R9MA 1POPA 4W5CA 1S4VA 3KX1A 4I05A 2HH5A 3PDFA 3OVZA 1BQIA 4BS5A 1EF7A 1SNKA 3S3RA 1MIRA 1U9QX 1VSNA 2BDLA 4AXMA 2GFOA 2IBIA 3CH2X 4BPVA 2CB5A 3M99A 1NLJA 2YJBA 4BGFA 1U5IA 1PPPA 4I07A 3K24A 1BGOA 4AXLA 1PXVA 4YVAA 4PP1A 3PNRA 2NQGA 1GECE 1F2AA 4CDCB 2YJ9A 2Y5BA 1DF0A 4N8WA 3KFQA 5JH3A 2DJFB 1ATKA 1KFUL 1CQDA 2JQFR 1U9XA 1U9VA 3ERVA 1CJLA 1CPJA 1HUCB 1TLOA 1XKGA 2DCAA 3P5XA 1EWPA 3P5UA 4B55A 4FJCA 3LTWA 2PADA 1CTEA 1DEUA 2NQAA 4QH6A 3D9WA 2OP3A 2FUDA 3KWZA 3O1GA 1CSBB 2NQDB 2E03A 4QRXA 2HHNA 3OF8A 4KLBA 2PBHA 2VHSA 3H6SA 1ME4A 4W5BA 3N3GA 2DC8A 3HHIA 1JQPA 3H8CA 3KSEA 2OZ2A 2YJ2A 2R9NA 1QDQA 2C0YA 3IV2A 4YYRA 4P6GA 1PPDA 1PBHA 2VHFA 3NHEA 4CDFB 4YYVA 2FT2A 3BPFA 1QOLA 3KW9A 1TU6A 1W4TA 4YYWA 1YALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6N A;  2FYE A;  3K9M A;  2AYN A;  1YK8 A;  1KHQ A;  1BP4 A;  2WBF X;  2FTD A;  1AYW A;  1X9Y A;  3KKU A;  2CIO A;  1Q6K A;  1M6D A;  2DC9 A;  2HXZ A;  2B1N A;  4BQV A;  4YYS A;  3KWB X;  3HD3 A;  1VJV A;  1Y08 A;  3MTN A;  5JA7 A;  2P7U A;  5EF4 A;  2AVW A;  7PCK A;  1NPZ A;  5A24 A;  3PW3 A;  3V6C A;  1AU2 A;  2B1M A;  1TL9 A;  2R9C A;  3PBH A;  3F75 A;  2DCB A;  1IWD A;  1GMY A;  1AEC A;  3QT4 A;  2YJC A;  2G6D A;  3P5W A;  3MHH A;  1Y4H A;  2GHU A;  2FRQ A;  1NQC A;  4ZUX U;  1GCB A;  1ITO A;  2P0R A;  3USV A;  4YV8 A;  1K3B B;  3H89 A;  3LFY A;  4QRG A;  1ZIV A;  3I06 A;  4BS6 A;  5CHT A;  1PAD A;  3P5V A;  2AUX A;  2DZY A;  3WXF A;  3BC3 A;  4FK5 A;  3RVV A;  4OEM A;  2DCC A;  1QXP A;  2PRE A;  1QMY A;  3IUT A;  1CVZ A;  2E00 A;  4MZO A;  1PCI A;  4RY2 A;  3RVW A;  4PAD A;  2FRA A;  5J94 A;  1EWM A;  1NL6 A;  2AYO A;  4HWY A;  3BWK A;  4QBB A;  1F29 A;  2G8E A;  1O0E A;  3S3Q A;  3E1Z B;  2AU1 A;  2PNS A;  3O0U A;  1KXR A;  4YYQ A;  2DCD A;  3OIS A;  4X6J A;  3GCB A;  1MS6 A;  3WXG A;  1AU3 A;  3QSD A;  2HD5 A;  5PAD A;  1EWL A;  2FQ9 A;  4OEL A;  1YVB A;  1THE A;  1F2B A;  3LXS A;  2JQG R;  4Q8H A;  4WA6 A;  2H7J A;  2DC6 A;  1FH0 A;  2DJG B;  4X6I A;  5CVM A;  3DF0 A;  3IMA A;  4CDE B;  3TNX A;  1KHP A;  3OF9 A;  2XU4 A;  1STF E;  3CH3 X;  2Y6E A;  2BDZ A;  2F1G A;  4K7C A;  1ME3 A;  3K8U A;  3BCN A;  1CS8 A;  2E01 A;  4P6E A;  1MDW A;  1U9W A;  3RVX A;  3HWN A;  1KFX L;  1A6R A;  5F02 A;  1CB5 A;  4PI3 A;  1EWO A;  3AI8 A;  3IEJ A;  2ACT A;  4W4U A;  1NB5 A;  1SP4 B;  5FPW A;  1NB3 A;  3IHP A;  3F5V A;  1YK7 A;  4X6H A;  4FIP A;  1PIP A;  4N4Z A;  1AYU A;  2AIM A;  4DMY A;  2XU5 A;  2IPP B;  1GLO A;  3H7D A;  2DZZ A;  2G7Y A;  3OVX A;  3I3T A;  4CDD B;  2XU1 A;  3BPM A;  4G54 A;  1AU4 A;  3N4C A;  5K16 A;  3U8E A;  8PCH A;  2R9F A;  5CVO B;  2G8J A;  3N3K A;  3MOR A;  4DMX A;  3B79 A;  2ATO A;  1AIM A;  1CV8 A;  4PP2 E;  2DC7 A;  3QJ3 A;  4Q8G A;  3WXE A;  4QRV A;  1MEM A;  6PAD A;  2O6X A;  2FO5 A;  4CZW A;  1AU0 A;  2XU3 A;  3V6E A;  2E02 A;  3BOW A;  4MSX A;  1ICF A;  3D6S A;  5EGW A;  1AYV A;  4I04 A;  3IOQ A;  5CVN B;  4XR7 A;  4BSQ A;  2R9O A;  2ARY A;  2AS8 A;  2NQI A;  2P86 A;  4YYU A;  5CHV A;  2OUL A;  4N79 A;  9PAP A;  1PE6 A;  4MZS A;  2AUZ A;  1MEG A;  3ZUA A;  1PPN A;  2YJ8 A;  3CBK A;  1MHW A;  1YT7 A;  2F7D A;  3C9E A;  3CBJ A;  1BY8 A;  1PPO A;  3HHA A;  3H8B A;  1ZCM A;  1F2C A;  3MHS A;  4XUI A;  2R9M A;  1POP A;  4W5C A;  1S4V A;  3KX1 A;  4I05 A;  2HH5 A;  3PDF A;  3OVZ A;  1BQI A;  4BS5 A;  1EF7 A;  1SNK A;  3S3R A;  1MIR A;  1U9Q X;  1VSN A;  2BDL A;  4AXM A;  2GFO A;  2IBI A;  3CH2 X;  4BPV A;  2CB5 A;  3M99 A;  1NLJ A;  2YJB A;  1U5I A;  1PPP A;  4I07 A;  3K24 A;  1BGO A;  4AXL A;  1PXV A;  4YVA A;  4PP1 A;  3PNR A;  2NQG A;  1GEC E;  1F2A A;  4CDC B;  2YJ9 A;  2Y5B A;  1DF0 A;  4N8W A;  3KFQ A;  5JH3 A;  2DJF B;  1ATK A;  1KFU L;  1CQD A;  2JQF R;  1U9X A;  1U9V A;  3ERV A;  1CJL A;  1CPJ A;  1HUC B;  1TLO A;  1XKG A;  2DCA A;  3P5X A;  1EWP A;  3P5U A;  4FJC A;  2PAD A;  1CTE A;  1DEU A;  2NQA A;  4QH6 A;  2OP3 A;  2FUD A;  3KWZ A;  3O1G A;  1CSB B;  2NQD B;  2E03 A;  4QRX A;  2HHN A;  3OF8 A;  4KLB A;  2PBH A;  2VHS A;  3H6S A;  1ME4 A;  4W5B A;  3N3G A;  2DC8 A;  3HHI A;  1JQP A;  3H8C A;  3KSE A;  2OZ2 A;  2YJ2 A;  2R9N A;  1QDQ A;  2C0Y A;  3IV2 A;  4YYR A;  4P6G A;  1PPD A;  1PBH A;  2VHF A;  3NHE A;  4CDF B;  4YYV A;  2FT2 A;  3BPF A;  1QOL A;  3KW9 A;  1TU6 A;  4YYW A;  1YAL A; 
#chains in the Genus database with same CATH topology
 2R6N A;  2FYE A;  3K9M A;  2AYN A;  1YK8 A;  4R3D A;  4REZ A;  1KHQ A;  1BP4 A;  2WBF X;  3MJ5 A;  2FTD A;  1AYW A;  1X9Y A;  3KKU A;  2CIO A;  1Q6K A;  1M6D A;  2DC9 A;  2HXZ A;  2B1N A;  4BQV A;  4YYS A;  3KWB X;  3HD3 A;  1VJV A;  1Y08 A;  3MTN A;  5JA7 A;  2P7U A;  5EF4 A;  2AVW A;  7PCK A;  1NPZ A;  5A24 A;  3PW3 A;  3V6C A;  1AU2 A;  2B1M A;  1TL9 A;  2R9C A;  3PBH A;  3F75 A;  2DCB A;  1IWD A;  1GMY A;  1AEC A;  5JZE A;  3QT4 A;  2YJC A;  2G6D A;  3P5W A;  3MHH A;  1Y4H A;  2GHU A;  2FRQ A;  3RNV A;  4PT5 A;  1NQC A;  4ZUX U;  1GCB A;  5EZS A;  1ITO A;  2P0R A;  3USV A;  4YV8 A;  1K3B B;  3H89 A;  3LFY A;  4QRG A;  1ZIV A;  3I06 A;  4BS6 A;  5CHT A;  1PAD A;  2AGA A;  3P5V A;  2AUX A;  2DZY A;  4D8B A;  2DOS A;  3WXF A;  3BC3 A;  4FK5 A;  5KO3 A;  3RVV A;  4OEM A;  2DCC A;  1QXP A;  2PRE A;  1QMY A;  3IUT A;  4D8I A;  1CVZ A;  2E00 A;  4MZO A;  1PCI A;  4RY2 A;  3RVW A;  4PAD A;  2FRA A;  5J94 A;  1EWM A;  1NL6 A;  2AYO A;  4HWY A;  3BWK A;  4QBB A;  1F29 A;  2G8E A;  1O0E A;  3S3Q A;  2BU3 A;  3E1Z B;  4RF0 A;  2AU1 A;  2PNS A;  3O0U A;  1KXR A;  3B21 A;  4IP3 A;  4YYQ A;  2DCD A;  3OIS A;  4X6J A;  3GCB A;  1MS6 A;  3WXG A;  1AU3 A;  3QSD A;  2HD5 A;  5PAD A;  4IUM A;  1EWL A;  2FQ9 A;  4OEL A;  3BB7 A;  1YVB A;  1THE A;  1F2B A;  4BOZ A;  3LXS A;  2JQG R;  4Q8H A;  4WA6 A;  2H7J A;  2DC6 A;  1FH0 A;  2DJG B;  4X6I A;  5CVM A;  3DF0 A;  3IMA A;  4CDE B;  3PRM A;  3PHX A;  3TNX A;  1KHP A;  3OF9 A;  2XU4 A;  1STF E;  3CH3 X;  2Y6E A;  2BDZ A;  2F1G A;  4K7C A;  1ME3 A;  3K8U A;  3BCN A;  1CS8 A;  2E01 A;  2UZJ A;  4P6E A;  4OW0 A;  1MDW A;  1U9W A;  2JTC A;  3RVX A;  4GUA A;  3TMP A;  3HWN A;  1UKF A;  1KFX L;  1A6R A;  5F02 A;  1CB5 A;  4PI3 A;  1EWO A;  4BOQ A;  3AI8 A;  3IEJ A;  4HXD B;  2ACT A;  4W4U A;  3MP2 A;  1NB5 A;  1SP4 B;  5FPW A;  1NB3 A;  3IHP A;  4OVZ A;  3F5V A;  1YK7 A;  4X6H A;  4FIP A;  1PIP A;  4N4Z A;  1AYU A;  4P16 A;  2AIM A;  4DMY A;  4BOS A;  2XU5 A;  2IPP B;  5EZQ A;  1GLO A;  3H7D A;  4RF1 A;  2DZZ A;  4D8E A;  2G7Y A;  3OVX A;  3I3T A;  4CDD B;  2XU1 A;  3BPM A;  4G54 A;  1AU4 A;  3N4C A;  5K16 A;  3U8E A;  8PCH A;  2R9F A;  5CVO B;  2G8J A;  3N3K A;  3MOR A;  4DMX A;  3B79 A;  2ATO A;  1AIM A;  1CV8 A;  4PP2 E;  2DC7 A;  3QJ3 A;  4Q8G A;  3WXE A;  4QRV A;  1MEM A;  6PAD A;  4WUR A;  2O6X A;  2FO5 A;  4CZW A;  1AU0 A;  2XU3 A;  3V6E A;  2E02 A;  3BOW A;  4MSX A;  1ICF A;  3D6S A;  5EGW A;  1AYV A;  4I04 A;  3IOQ A;  5CVN B;  4XR7 A;  4BSQ A;  2R9O A;  2Z84 A;  2ARY A;  2AS8 A;  2NQI A;  2P86 A;  4YYU A;  5CHV A;  2OUL A;  4N79 A;  9PAP A;  1PE6 A;  4MZS A;  2AUZ A;  1MEG A;  5E6J A;  1PPN A;  2YJ8 A;  3CBK A;  1MHW A;  3ZUA A;  3PRP A;  1YT7 A;  2F7D A;  3C9E A;  3CBJ A;  3BBA A;  1BY8 A;  1PPO A;  3HHA A;  3H8B A;  4OVZ B;  1ZCM A;  1F2C A;  3MHS A;  4XUI A;  2R9M A;  1POP A;  4W5C A;  1S4V A;  3KX1 A;  4I05 A;  2HH5 A;  3PDF A;  3OVZ A;  1BQI A;  4BS5 A;  1EF7 A;  1SNK A;  3S3R A;  1MIR A;  1U9Q X;  1VSN A;  2BDL A;  4AXM A;  2BTW A;  2GFO A;  2IBI A;  3CH2 X;  4BPV A;  2CB5 A;  3M99 A;  1NLJ A;  2YJB A;  3MTV A;  2HWK A;  1U5I A;  1PPP A;  2JRI A;  4I07 A;  3K24 A;  1BGO A;  4AXL A;  2J7Q C;  1PXV A;  4YVA A;  4PP1 A;  3PNR A;  2NQG A;  1GEC E;  3OQC A;  1F2A A;  4CDC B;  2YJ9 A;  3W30 A;  2Y5B A;  3PT2 A;  1DF0 A;  3PHU A;  4N8W A;  3KFQ A;  5JH3 A;  4RKX A;  3TRK A;  1DKI A;  1ATK A;  1KFU L;  1YZB A;  2DJF B;  1CQD A;  4ZTB A;  2JQF R;  1U9X A;  1U9V A;  3ERV A;  1CJL A;  2FE8 A;  1CPJ A;  4M0W A;  1HUC B;  1TLO A;  1XKG A;  4A5U A;  2DCA A;  3P5X A;  1EWP A;  3P5U A;  4MM3 B;  4BOP A;  4FJC A;  2PAD A;  1CTE A;  1DEU A;  2NQA A;  3BY4 A;  4BOU A;  3W31 A;  4RNA A;  1PVJ A;  3ZNH A;  4QH6 A;  2OP3 A;  3E9S A;  2FUD A;  3PSE A;  3KWZ A;  3O1G A;  1CSB B;  2NQD B;  2E03 A;  4MI7 A;  3PHW A;  4QRX A;  2HHN A;  3OF8 A;  4KLB A;  2PBH A;  2VHS A;  3H6S A;  1ME4 A;  4W5B A;  3N3G A;  3O65 A;  2BTW B;  2DC8 A;  3HHI A;  1JQP A;  3H8C A;  3IFU A;  3KSE A;  2OZ2 A;  2YJ2 A;  4XZX A;  2R9N A;  1QDQ A;  2C0Y A;  3IV2 A;  4YYR A;  4P6G A;  1PPD A;  1PBH A;  2VHF A;  3NHE A;  4CDF B;  4YYV A;  2FT2 A;  3BPF A;  1QOL A;  3KW9 A;  3C0R A;  1TU6 A;  2J7Q A;  4YYW A;  1YAL A; 
#chains in the Genus database with same CATH homology
 2R6N A;  2FYE A;  3K9M A;  2AYN A;  1YK8 A;  1KHQ A;  1BP4 A;  2WBF X;  2FTD A;  1AYW A;  1X9Y A;  3KKU A;  2CIO A;  1Q6K A;  1M6D A;  2DC9 A;  4NV7 A;  2HXZ A;  2B1N A;  4BQV A;  2BSZ A;  4YYS A;  3KWB X;  3HD3 A;  1VJV A;  1Y08 A;  3MTN A;  5JA7 A;  2P7U A;  5EF4 A;  2AVW A;  7PCK A;  1NPZ A;  5A24 A;  3PW3 A;  3V6C A;  1AU2 A;  2B1M A;  1TL9 A;  2R9C A;  3PBH A;  3F75 A;  2DCB A;  1IWD A;  1GMY A;  1AEC A;  3QT4 A;  2YJC A;  2G6D A;  3P5W A;  3MHH A;  1Y4H A;  2GHU A;  2FRQ A;  1NQC A;  4ZUX U;  1GCB A;  1ITO A;  2P0R A;  3USV A;  4YV8 A;  1K3B B;  3H89 A;  3LFY A;  4QRG A;  1ZIV A;  3I06 A;  4BS6 A;  5CHT A;  1PAD A;  3P5V A;  2AUX A;  2DZY A;  3WXF A;  3BC3 A;  4FK5 A;  3RVV A;  4OEM A;  2DCC A;  1QXP A;  2PRE A;  1QMY A;  3IUT A;  1CVZ A;  2E00 A;  4MZO A;  1PCI A;  4RY2 A;  3RVW A;  4PAD A;  2FRA A;  5J94 A;  1EWM A;  1NL6 A;  2AYO A;  4HWY A;  3BWK A;  4QBB A;  1F29 A;  2G8E A;  1O0E A;  3S3Q A;  3E1Z B;  2AU1 A;  2PNS A;  3O0U A;  1KXR A;  4YYQ A;  2DCD A;  3OIS A;  1W5R A;  4X6J A;  3GCB A;  1MS6 A;  3WXG A;  1AU3 A;  3QSD A;  2HD5 A;  5PAD A;  1EWL A;  2FQ9 A;  4OEL A;  1YVB A;  1THE A;  1F2B A;  2VFC A;  3LXS A;  1GX3 A;  2JQG R;  4Q8H A;  4WA6 A;  2H7J A;  2DC6 A;  2VFB A;  1FH0 A;  2DJG B;  4X6I A;  5CVM A;  3DF0 A;  3IMA A;  4CDE B;  3TNX A;  1KHP A;  3OF9 A;  2XU4 A;  1STF E;  3CH3 X;  2Y6E A;  2BDZ A;  2F1G A;  4K7C A;  1ME3 A;  3K8U A;  3BCN A;  1CS8 A;  2E01 A;  4P6E A;  1MDW A;  1U9W A;  1E2T A;  4NV8 A;  3RVX A;  3HWN A;  1KFX L;  1A6R A;  5F02 A;  1CB5 A;  4PI3 A;  1EWO A;  3AI8 A;  4GUZ A;  3IEJ A;  2ACT A;  4W4U A;  1NB5 A;  1SP4 B;  5FPW A;  1NB3 A;  3IHP A;  3F5V A;  1YK7 A;  4X6H A;  4FIP A;  1PIP A;  4N4Z A;  1AYU A;  2AIM A;  4DMY A;  2XU5 A;  2IPP B;  1GLO A;  3H7D A;  2DZZ A;  2G7Y A;  3OVX A;  3I3T A;  4CDD B;  2XU1 A;  3BPM A;  4G54 A;  1AU4 A;  3N4C A;  5K16 A;  3U8E A;  8PCH A;  2R9F A;  5CVO B;  1W6F A;  2G8J A;  3N3K A;  3MOR A;  4DMX A;  3B79 A;  2ATO A;  1AIM A;  1CV8 A;  4PP2 E;  2DC7 A;  3QJ3 A;  4Q8G A;  3WXE A;  4QRV A;  1MEM A;  6PAD A;  2O6X A;  2FO5 A;  4CZW A;  1AU0 A;  2XU3 A;  3V6E A;  2E02 A;  3BOW A;  4C5P A;  4MSX A;  1ICF A;  3D6S A;  5EGW A;  1AYV A;  4I04 A;  3IOQ A;  5CVN B;  4XR7 A;  4BSQ A;  2R9O A;  2ARY A;  2AS8 A;  2NQI A;  2P86 A;  4YYU A;  5CHV A;  2OUL A;  4N79 A;  9PAP A;  1PE6 A;  4MZS A;  2AUZ A;  1MEG A;  3ZUA A;  1PPN A;  2YJ8 A;  3CBK A;  1MHW A;  1YT7 A;  2F7D A;  3C9E A;  3CBJ A;  1BY8 A;  1PPO A;  3HHA A;  3H8B A;  1ZCM A;  1F2C A;  3MHS A;  4XUI A;  2R9M A;  1POP A;  4W5C A;  1S4V A;  3KX1 A;  4I05 A;  2HH5 A;  3PDF A;  3OVZ A;  1BQI A;  4BS5 A;  1EF7 A;  1SNK A;  3S3R A;  1MIR A;  1U9Q X;  1VSN A;  2BDL A;  4AXM A;  2GFO A;  2IBI A;  3CH2 X;  4BPV A;  2CB5 A;  3M99 A;  1NLJ A;  2YJB A;  4BGF A;  1U5I A;  1PPP A;  4I07 A;  3K24 A;  1BGO A;  4AXL A;  1PXV A;  4YVA A;  4PP1 A;  3PNR A;  2NQG A;  1GEC E;  1F2A A;  4CDC B;  2YJ9 A;  2Y5B A;  1DF0 A;  4N8W A;  3KFQ A;  5JH3 A;  2DJF B;  1ATK A;  1KFU L;  1CQD A;  2JQF R;  1U9X A;  1U9V A;  3ERV A;  1CJL A;  1CPJ A;  1HUC B;  1TLO A;  1XKG A;  2DCA A;  3P5X A;  1EWP A;  3P5U A;  4B55 A;  4FJC A;  3LTW A;  2PAD A;  1CTE A;  1DEU A;  2NQA A;  4QH6 A;  3D9W A;  2OP3 A;  2FUD A;  3KWZ A;  3O1G A;  1CSB B;  2NQD B;  2E03 A;  4QRX A;  2HHN A;  3OF8 A;  4KLB A;  2PBH A;  2VHS A;  3H6S A;  1ME4 A;  4W5B A;  3N3G A;  2DC8 A;  3HHI A;  1JQP A;  3H8C A;  3KSE A;  2OZ2 A;  2YJ2 A;  2R9N A;  1QDQ A;  2C0Y A;  3IV2 A;  4YYR A;  4P6G A;  1PPD A;  1PBH A;  2VHF A;  3NHE A;  4CDF B;  4YYV A;  2FT2 A;  3BPF A;  1QOL A;  3KW9 A;  1TU6 A;  1W4T A;  4YYW A;  1YAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...