3K8UA

Crystal structure of the peptidase domain of streptococcus coma, a bi-functional abc transporter involved in quorum sensing pathway
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
HYKLVPQIDTRDCGPAVLASVAKHYGSNYSIAYLRELSKTNKQGTTALGIVEAAKKLGFETRSIKADMTLFDYNDLTYPFIVHVIKGKRLQHYYVVYGSQNNQLIIGDPDPSVKVTRMSKERFQSEWTGLAIFLAPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the peptidase domain of Streptococcus ComA, a bifunctional ATP-binding cassette transporter involved in the quorum-sensing pathway
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords Putative ABC transporter, ATP-binding protein ComA
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03412 Peptidase_C39 Peptidase C39 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3k8uA01
1AYUA 2ARYA 1KHPA 2DC7A 4BS6A 1GMYA 1JQPA 2G7YA 1AU0A 3RVXA 1KHQA 1XKGA 4YYUA 1PCIA 1ZIVA 4FIPA 1PPDA 2IBIA 3RVWA 3P5XA 3LXSA 2VHSA 4YVAA 1MDWA 1CTEA 1PPNA 1Q6KA 1YALA 3CBJA 2B1MA 3D6SA 5CVNB 2GFOA 3IV2A 5JA7A 1Y4HA 4W5CA 1CQDA 2NQGA 2XU1A 2DC6A 1YK8A 4BQVA 3N4CA 1TL9A 1MHWA 1GECE 4CZWA 2OP3A 4N79A 4BS5A 3H8CA 3P5VA 1PBHA 3DF0A 3PNRA 4QRXA 1CSBB 1TLOA 2PNSA 2FT2A 2FO5A 2DJGB 1GLOA 3F5VA 3S3QA 3IEJA 4N8WA 1KFXL 1KXRA 3P5UA 2R9OA 1BP4A 1K3BB 3E1ZB 2O6XA 2VHFA 1PE6A 2P86A 4XUIA 3H7DA 4CDEB 4KLBA 2BDZA 1U5IA 1EWPA 1VSNA 2XU3A 2YJ8A 4YYWA 1FH0A 5F02A 1A6RA 7PCKA 4PP1A 2R9FA 1F2CA 4PI3A 4CDCB 2YJCA 1ATKA 2P7UA 2E03A 3KX1A 4X6HA 1F29A 3BC3A 4MZOA 1SNKA 1U9XA 3BOWA 4I04A 3P5WA 1U9QX 3ZUAA 4AXMA 5A24A 3KW9A 2AUZA 1PPOA 3N3KA 3USVA 4BPVA 1DF0A 5PADA 1Y08A 2IPPB 2FQ9A 1CPJA 2PREA 1YVBA 1GCBA 2DCDA 1QOLA 2ACTA 2PADA 4X6IA 2E01A 1O0EA 3MHSA 4OEMA 4FK5A 4Q8GA 3AI8A 3OF9A 1YT7A 2DCAA 2R9MA 3H6SA 1S4VA 1CB5A 1PIPA 3ERVA 3H89A 2NQAA 3RVVA 4AXLA 1EWMA 1VJVA 3OVXA 2NQDB 1SP4B 1BY8A 4P6EA 1U9VA 3O1GA 2GHUA 4G54A 2BDLA 3OF8A 3MTNA 3LFYA 3U8EA 2Y5BA 4YV8A 4ZUXU 4MSXA 1AYWA 3PBHA 2G6DA 4CDFB 4W5BA 5EF4A 4YYRA 1HUCB 2R9CA 3WXFA 4WA6A 3IMAA 2JQFR 3OVZA 1STFE 4K7CA 1NLJA 1CVZA 4N4ZA 4FJCA 1EF7A 2HH5A 1CS8A 1AU4A 3WXGA 2JQGR 2YJ9A 3HWNA 4BSQA 1IWDA 3V6EA 1NB5A 4X6JA 2NQIA 1NB3A 2F1GA 2YJ2A 5CVOB 1PXVA 3KWZA 3IUTA 4MZSA 1MS6A 3V6CA 4QRVA 2DJFB 4I07A 2FRAA 4QH6A 2DC9A 4RY2A 4DMYA 3KKUA 1ICFA 2E02A 2OZ2A 3B79A 4PADA 2G8JA 2R6NA 1X9YA 1NL6A 1BGOA 2HD5A 3F75A 1YK7A 2DCBA 3WXEA 3HHAA 2DZYA 3BPFA 3GCBA 1U9WA 1AYVA 1QXPA 4QBBA 2B1NA 1TU6A 2WBFX 5EGWA 2CIOA 1AU2A 2ATOA 3N3GA 1PADA 2AUXA 4YYVA 4HWYA 1EWOA 3PDFA 2F7DA 1POPA 2DC8A 3OISA 2E00A 6PADA 1AIMA 2FYEA 3O0UA 3CH2X 1ITOA 2XU4A 3BWKA 1DEUA 3PW3A 5CHVA 2CB5A 3IHPA 2AS8A 3KWBX 3HHIA 2HHNA 2HXZA 3QT4A 3TNXA 1ME4A 1NPZA 2AU1A 3KFQA 3QSDA 8PCHA 3MHHA 3K9MA 4QRGA 3HD3A 2AYNA 1AU3A 1PPPA 5J94A 5CVMA 5JH3A 1ZCMA 3KSEA 3MORA 4XR7A 1EWLA 4OELA 1MEMA 2Y6EA 1KFUL 5CHTA 4I05A 1MIRA 2G8EA 5FPWA 1THEA 2DZZA 2YJBA 3CH3X 1BQIA 4Q8HA 2FRQA 2PBHA 9PAPA 2AVWA 3C9EA 1QMYA 3K8UA 2P0RA 3BPMA 3K24A 1CJLA 4YYQA 4PP2E 1MEGA 3H8BA 2R9NA 1NQCA 3QJ3A 1M6DA 2XU5A 5K16A 2OULA 1F2BA 1AECA 2C0YA 3IOQA 1ME3A 3CBKA 4CDDB 3S3RA 3I06A 3I3TA 1F2AA 4YYSA 2FUDA 1CV8A 2AIMA 2AYOA 1QDQA 3BCNA 3M99A 3NHEA 4P6GA 2H7JA 2DCCA 4DMXA 2FTDA 4W4UA
chains in the Genus database with same CATH superfamily
1AYUA 2ARYA 1KHPA 2DC7A 4BS6A 1GMYA 1JQPA 2G7YA 1AU0A 3RVXA 1KHQA 4OVZB 1XKGA 3TMPA 4YYUA 1PCIA 1ZIVA 4FIPA 3RNVA 1PPDA 2IBIA 4BOPA 3RVWA 4D8IA 4M0WA 3P5XA 3LXSA 2VHSA 4YVAA 4D8BA 1MDWA 1CTEA 1PPNA 1Q6KA 1YALA 3CBJA 2B1MA 3D6SA 1YZBA 5CVNB 2GFOA 3IV2A 5JA7A 1Y4HA 4W5CA 1CQDA 2NQGA 2AGAA 2XU1A 5E6JA 2DC6A 4IP3A 1YK8A 4BQVA 3N4CA 4OW0A 1TL9A 4HXDB 4BOZA 1MHWA 1GECE 3PT2A 4CZWA 2OP3A 4N79A 4BS5A 3H8CA 3P5VA 1PBHA 3DF0A 3PNRA 4QRXA 1CSBB 1TLOA 3PRMA 3BB7A 2PNSA 2FT2A 2FO5A 2DJGB 1GLOA 3F5VA 3S3QA 3IEJA 4N8WA 1KFXL 1KXRA 3P5UA 3MJ5A 2R9OA 1BP4A 1K3BB 4XZXA 3E1ZB 2O6XA 2VHFA 1PE6A 2P86A 4XUIA 3H7DA 3PHXA 4KLBA 4CDEB 2BDZA 1U5IA 3E9SA 1DKIA 1EWPA 1VSNA 4D8EA 2BTWB 2XU3A 2YJ8A 4YYWA 4OVZA 1FH0A 5F02A 1A6RA 7PCKA 4PP1A 2R9FA 1F2CA 4PI3A 4CDCB 2YJCA 1ATKA 2P7UA 2E03A 3KX1A 4X6HA 1F29A 3BC3A 4MZOA 1SNKA 1U9XA 3BOWA 4I04A 3P5WA 3PSEA 3ZUAA 4AXMA 3O65A 2J7QA 5A24A 3KW9A 2AUZA 1PPOA 3N3KA 3USVA 4BPVA 1DF0A 5PADA 1Y08A 2IPPB 2FQ9A 1CPJA 2PREA 1YVBA 1GCBA 2DCDA 2JRIA 1QOLA 2ACTA 2PADA 4X6IA 2E01A 2BU3A 3C0RA 1O0EA 3MHSA 4OEMA 4FK5A 3B21A 4Q8GA 3AI8A 3OF9A 1YT7A 2DCAA 2R9MA 3H6SA 4RF0A 1S4VA 1CB5A 3PHUA 3OQCA 1PIPA 3ERVA 3H89A 2NQAA 3RVVA 4AXLA 5KO3A 1EWMA 1VJVA 3OVXA 2NQDB 1SP4B 1BY8A 4P6EA 1U9VA 3O1GA 2GHUA 4G54A 2BDLA 3OF8A 3MTNA 3LFYA 3U8EA 2Y5BA 4YV8A 3BBAA 4ZUXU 4MSXA 1AYWA 4P16A 3PBHA 2G6DA 4CDFB 4W5BA 5EF4A 4YYRA 1HUCB 2R9CA 3WXFA 4RKXA 4WA6A 2UZJA 3IMAA 2JQFR 3OVZA 1STFE 4K7CA 4ZTBA 1NLJA 1CVZA 4N4ZA 4FJCA 1EF7A 2HH5A 1CS8A 1AU4A 3WXGA 2JQGR 2YJ9A 3HWNA 4W4UA 3PHWA 4BSQA 1IWDA 3V6EA 1NB5A 4X6JA 2NQIA 1NB3A 2F1GA 2YJ2A 5CVOB 1PXVA 3KWZA 3IUTA 4MZSA 1MS6A 3V6CA 4QRVA 4I07A 2DJFB 2FRAA 4QH6A 2DC9A 4GUAA 4MI7A 4RY2A 4DMYA 3KKUA 1ICFA 4BOSA 2E02A 2OZ2A 3B79A 4PADA 3ZNHA 2G8JA 2R6NA 1X9YA 1NL6A 4R3DA 1BGOA 2HD5A 5EZSA 3F75A 1YK7A 2DCBA 3WXEA 3HHAA 2DZYA 2BTWA 3BPFA 3MTVA 3GCBA 4BOQA 1U9WA 1AYVA 1QXPA 4QBBA 2B1NA 1TU6A 2WBFX 3BY4A 5EGWA 2CIOA 1AU2A 2ATOA 3N3GA 1PADA 2AUXA 3PRPA 4YYVA 4HWYA 1EWOA 3PDFA 2F7DA 1POPA 2DC8A 3OISA 2E00A 6PADA 4IUMA 1AIMA 2FYEA 3O0UA 3CH2X 3MP2A 1ITOA 4MM3B 2XU4A 3BWKA 1DEUA 3PW3A 5CHVA 2CB5A 3IHPA 3IFUA 2AS8A 3TRKA 3W30A 3KWBX 3HHIA 1UKFA 2HHNA 2HXZA 4RNAA 3QT4A 3TNXA 1ME4A 1NPZA 2AU1A 3KFQA 3QSDA 2HWKA 8PCHA 1PVJA 3MHHA 3K9MA 4QRGA 3HD3A 2AYNA 1AU3A 1PPPA 5J94A 4REZA 5CVMA 5JH3A 1ZCMA 2J7QC 3KSEA 3MORA 4XR7A 4WURA 1EWLA 5JZEA 4OELA 1MEMA 2Y6EA 1KFUL 2Z84A 5CHTA 4I05A 1MIRA 2G8EA 5FPWA 1THEA 2DZZA 2YJBA 3CH3X 1BQIA 4Q8HA 2FRQA 2PBHA 9PAPA 2JTCA 2AVWA 3C9EA 1QMYA 3K8UA 4RF1A 4BOUA 2P0RA 3BPMA 3K24A 3W31A 1CJLA 4YYQA 4PP2E 1MEGA 3H8BA 3QJ3A 1NQCA 2R9NA 4A5UA 1M6DA 2XU5A 5K16A 2OULA 5EZQA 1F2BA 1AECA 2C0YA 3IOQA 1ME3A 3CBKA 4CDDB 4PT5A 3S3RA 3I06A 3I3TA 1F2AA 4YYSA 2FUDA 1CV8A 2AIMA 2AYOA 2FE8A 1QDQA 3BCNA 3M99A 3NHEA 4P6GA 2DOSA 2H7JA 2DCCA 4DMXA 2FTDA 1U9QX
chains in the Genus database with same CATH topology
1AYUA 2ARYA 1KHPA 2DC7A 4BS6A 1GMYA 1JQPA 2G7YA 1AU0A 3RVXA 1KHQA 1XKGA 4NV7A 4YYUA 1PCIA 1ZIVA 1W4TA 4FIPA 1PPDA 2IBIA 1W6FA 3RVWA 3P5XA 3LXSA 2VHSA 4YVAA 1MDWA 1CTEA 1PPNA 1Q6KA 1YALA 3CBJA 2B1MA 3D6SA 5CVNB 2GFOA 3IV2A 5JA7A 1Y4HA 4W5CA 4GUZA 1CQDA 2NQGA 2XU1A 2DC6A 1YK8A 4BQVA 3N4CA 1TL9A 2VFCA 1MHWA 1GECE 3D9WA 4CZWA 2OP3A 4N79A 4BS5A 3H8CA 3P5VA 1PBHA 3DF0A 3PNRA 4QRXA 1GX3A 1CSBB 1TLOA 2PNSA 2FT2A 2FO5A 2DJGB 1GLOA 3F5VA 3S3QA 3IEJA 4N8WA 1KFXL 1KXRA 3P5UA 2R9OA 1BP4A 1K3BB 3E1ZB 2O6XA 2VHFA 4XUIA 1PE6A 2P86A 3H7DA 4CDEB 4KLBA 2BDZA 1U5IA 1EWPA 1VSNA 2XU3A 2YJ8A 4YYWA 1FH0A 5F02A 1A6RA 7PCKA 4PP1A 2R9FA 1F2CA 4PI3A 4CDCB 2YJCA 1ATKA 2P7UA 2E03A 3KX1A 4X6HA 1F29A 3BC3A 4MZOA 1SNKA 1U9XA 3BOWA 4I04A 3P5WA 1U9QX 3ZUAA 4AXMA 5A24A 3KW9A 2AUZA 1PPOA 3N3KA 3USVA 4BPVA 1DF0A 5PADA 1Y08A 2IPPB 2FQ9A 1CPJA 2PREA 1YVBA 1GCBA 2DCDA 1QOLA 2ACTA 2PADA 4X6IA 2E01A 1O0EA 3MHSA 4OEMA 4FK5A 4Q8GA 3AI8A 3OF9A 1YT7A 2DCAA 2R9MA 3H6SA 4B55A 1S4VA 1CB5A 1PIPA 3ERVA 3H89A 2NQAA 3RVVA 4AXLA 1W5RA 1EWMA 1VJVA 3OVXA 2NQDB 1SP4B 1BY8A 4P6EA 1U9VA 3O1GA 2GHUA 4G54A 2BDLA 3OF8A 3MTNA 3LFYA 3U8EA 2Y5BA 4YV8A 4ZUXU 4MSXA 1AYWA 3PBHA 2G6DA 4CDFB 4W5BA 5EF4A 4YYRA 1HUCB 2R9CA 3WXFA 4WA6A 3IMAA 2JQFR 3OVZA 1STFE 4K7CA 1NLJA 1CVZA 4N4ZA 4FJCA 1EF7A 2HH5A 1CS8A 1AU4A 3WXGA 2JQGR 2YJ9A 3HWNA 4BSQA 1IWDA 3V6EA 1NB5A 4X6JA 2NQIA 1NB3A 2F1GA 2YJ2A 5CVOB 1PXVA 3KWZA 3IUTA 4BGFA 4MZSA 1MS6A 2BSZA 3V6CA 4QRVA 2DJFB 4I07A 2FRAA 4QH6A 2DC9A 4RY2A 4DMYA 3KKUA 1ICFA 2E02A 2OZ2A 3B79A 4PADA 2G8JA 2R6NA 1X9YA 1NL6A 1BGOA 2HD5A 3F75A 1YK7A 2DCBA 3WXEA 3HHAA 2DZYA 3BPFA 3GCBA 1U9WA 1AYVA 1QXPA 4QBBA 2B1NA 1TU6A 2WBFX 5EGWA 2CIOA 1AU2A 2ATOA 3N3GA 1PADA 2AUXA 4YYVA 4HWYA 1EWOA 3PDFA 4C5PA 2F7DA 1POPA 2DC8A 3OISA 2E00A 6PADA 1AIMA 2FYEA 3O0UA 3CH2X 1ITOA 2XU4A 3BWKA 1DEUA 3PW3A 5CHVA 2CB5A 3IHPA 2AS8A 3KWBX 4NV8A 3HHIA 2HHNA 2HXZA 3QT4A 3TNXA 1ME4A 1NPZA 2AU1A 3KFQA 3QSDA 8PCHA 3MHHA 3K9MA 4QRGA 3HD3A 2AYNA 1AU3A 1PPPA 5J94A 5CVMA 5JH3A 1E2TA 1ZCMA 3KSEA 3MORA 4XR7A 3LTWA 1EWLA 4OELA 1MEMA 2Y6EA 1KFUL 5CHTA 4I05A 1MIRA 2G8EA 5FPWA 1THEA 2DZZA 2YJBA 3CH3X 1BQIA 4Q8HA 2FRQA 2PBHA 9PAPA 2AVWA 3C9EA 1QMYA 3K8UA 2P0RA 3BPMA 3K24A 1CJLA 4YYQA 4PP2E 1MEGA 3H8BA 2R9NA 1NQCA 3QJ3A 1M6DA 2XU5A 5K16A 2OULA 1F2BA 1AECA 2C0YA 3IOQA 1ME3A 3CBKA 4CDDB 3S3RA 3I06A 3I3TA 1F2AA 4YYSA 2FUDA 1CV8A 2AIMA 2AYOA 1QDQA 3BCNA 2VFBA 3M99A 3NHEA 4P6GA 2H7JA 2DCCA 4DMXA 2FTDA 4W4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYU A;  2ARY A;  1KHP A;  2DC7 A;  4BS6 A;  1GMY A;  1JQP A;  2G7Y A;  1AU0 A;  3RVX A;  1KHQ A;  1XKG A;  4YYU A;  1PCI A;  1ZIV A;  4FIP A;  1PPD A;  2IBI A;  3RVW A;  3P5X A;  3LXS A;  2VHS A;  4YVA A;  1MDW A;  1CTE A;  1PPN A;  1Q6K A;  1YAL A;  3CBJ A;  2B1M A;  3D6S A;  5CVN B;  2GFO A;  3IV2 A;  5JA7 A;  1Y4H A;  4W5C A;  1CQD A;  2NQG A;  2XU1 A;  2DC6 A;  1YK8 A;  4BQV A;  3N4C A;  1TL9 A;  1MHW A;  1GEC E;  4CZW A;  2OP3 A;  4N79 A;  4BS5 A;  3H8C A;  3P5V A;  1PBH A;  3DF0 A;  3PNR A;  4QRX A;  1CSB B;  1TLO A;  2PNS A;  2FT2 A;  2FO5 A;  2DJG B;  1GLO A;  3F5V A;  3S3Q A;  3IEJ A;  4N8W A;  1KFX L;  1KXR A;  3P5U A;  2R9O A;  1BP4 A;  1K3B B;  3E1Z B;  2O6X A;  2VHF A;  1PE6 A;  2P86 A;  4XUI A;  3H7D A;  4CDE B;  4KLB A;  2BDZ A;  1U5I A;  1EWP A;  1VSN A;  2XU3 A;  2YJ8 A;  4YYW A;  1FH0 A;  5F02 A;  1A6R A;  7PCK A;  4PP1 A;  2R9F A;  1F2C A;  4PI3 A;  4CDC B;  2YJC A;  1ATK A;  2P7U A;  2E03 A;  3KX1 A;  4X6H A;  1F29 A;  3BC3 A;  4MZO A;  1SNK A;  1U9X A;  3BOW A;  4I04 A;  3P5W A;  1U9Q X;  3ZUA A;  4AXM A;  5A24 A;  3KW9 A;  2AUZ A;  1PPO A;  3N3K A;  3USV A;  4BPV A;  1DF0 A;  5PAD A;  1Y08 A;  2IPP B;  2FQ9 A;  1CPJ A;  2PRE A;  1YVB A;  1GCB A;  2DCD A;  1QOL A;  2ACT A;  2PAD A;  4X6I A;  2E01 A;  1O0E A;  3MHS A;  4OEM A;  4FK5 A;  4Q8G A;  3AI8 A;  3OF9 A;  1YT7 A;  2DCA A;  2R9M A;  3H6S A;  1S4V A;  1CB5 A;  1PIP A;  3ERV A;  3H89 A;  2NQA A;  3RVV A;  4AXL A;  1EWM A;  1VJV A;  3OVX A;  2NQD B;  1SP4 B;  1BY8 A;  4P6E A;  1U9V A;  3O1G A;  2GHU A;  4G54 A;  2BDL A;  3OF8 A;  3MTN A;  3LFY A;  3U8E A;  2Y5B A;  4YV8 A;  4ZUX U;  4MSX A;  1AYW A;  3PBH A;  2G6D A;  4CDF B;  4W5B A;  5EF4 A;  4YYR A;  1HUC B;  2R9C A;  3WXF A;  4WA6 A;  3IMA A;  2JQF R;  3OVZ A;  1STF E;  4K7C A;  1NLJ A;  1CVZ A;  4N4Z A;  4FJC A;  1EF7 A;  2HH5 A;  1CS8 A;  1AU4 A;  3WXG A;  2JQG R;  2YJ9 A;  3HWN A;  4BSQ A;  1IWD A;  3V6E A;  1NB5 A;  4X6J A;  2NQI A;  1NB3 A;  2F1G A;  2YJ2 A;  5CVO B;  1PXV A;  3KWZ A;  3IUT A;  4MZS A;  1MS6 A;  3V6C A;  4QRV A;  2DJF B;  4I07 A;  2FRA A;  4QH6 A;  2DC9 A;  4RY2 A;  4DMY A;  3KKU A;  1ICF A;  2E02 A;  2OZ2 A;  3B79 A;  4PAD A;  2G8J A;  2R6N A;  1X9Y A;  1NL6 A;  1BGO A;  2HD5 A;  3F75 A;  1YK7 A;  2DCB A;  3WXE A;  3HHA A;  2DZY A;  3BPF A;  3GCB A;  1U9W A;  1AYV A;  1QXP A;  4QBB A;  2B1N A;  1TU6 A;  2WBF X;  5EGW A;  2CIO A;  1AU2 A;  2ATO A;  3N3G A;  1PAD A;  2AUX A;  4YYV A;  4HWY A;  1EWO A;  3PDF A;  2F7D A;  1POP A;  2DC8 A;  3OIS A;  2E00 A;  6PAD A;  1AIM A;  2FYE A;  3O0U A;  3CH2 X;  1ITO A;  2XU4 A;  3BWK A;  1DEU A;  3PW3 A;  5CHV A;  2CB5 A;  3IHP A;  2AS8 A;  3KWB X;  3HHI A;  2HHN A;  2HXZ A;  3QT4 A;  3TNX A;  1ME4 A;  1NPZ A;  2AU1 A;  3KFQ A;  3QSD A;  8PCH A;  3MHH A;  3K9M A;  4QRG A;  3HD3 A;  2AYN A;  1AU3 A;  1PPP A;  5J94 A;  5CVM A;  5JH3 A;  1ZCM A;  3KSE A;  3MOR A;  4XR7 A;  1EWL A;  4OEL A;  1MEM A;  2Y6E A;  1KFU L;  5CHT A;  4I05 A;  1MIR A;  2G8E A;  5FPW A;  1THE A;  2DZZ A;  2YJB A;  3CH3 X;  1BQI A;  4Q8H A;  2FRQ A;  2PBH A;  9PAP A;  2AVW A;  3C9E A;  1QMY A;  3K8U A;  2P0R A;  3BPM A;  3K24 A;  1CJL A;  4YYQ A;  4PP2 E;  1MEG A;  3H8B A;  2R9N A;  1NQC A;  3QJ3 A;  1M6D A;  2XU5 A;  5K16 A;  2OUL A;  1F2B A;  1AEC A;  2C0Y A;  3IOQ A;  1ME3 A;  3CBK A;  4CDD B;  3S3R A;  3I06 A;  3I3T A;  1F2A A;  4YYS A;  2FUD A;  1CV8 A;  2AIM A;  2AYO A;  1QDQ A;  3BCN A;  3M99 A;  3NHE A;  4P6G A;  2H7J A;  2DCC A;  4DMX A;  2FTD A;  4W4U A; 
#chains in the Genus database with same CATH topology
 1AYU A;  2ARY A;  1KHP A;  2DC7 A;  4BS6 A;  1GMY A;  1JQP A;  2G7Y A;  1AU0 A;  3RVX A;  1KHQ A;  4OVZ B;  1XKG A;  3TMP A;  4YYU A;  1PCI A;  1ZIV A;  4FIP A;  3RNV A;  1PPD A;  2IBI A;  4BOP A;  3RVW A;  4D8I A;  4M0W A;  3P5X A;  3LXS A;  2VHS A;  4YVA A;  4D8B A;  1MDW A;  1CTE A;  1PPN A;  1Q6K A;  1YAL A;  3CBJ A;  2B1M A;  3D6S A;  1YZB A;  5CVN B;  2GFO A;  3IV2 A;  5JA7 A;  1Y4H A;  4W5C A;  1CQD A;  2NQG A;  2AGA A;  2XU1 A;  5E6J A;  2DC6 A;  4IP3 A;  1YK8 A;  4BQV A;  3N4C A;  4OW0 A;  1TL9 A;  4HXD B;  4BOZ A;  1MHW A;  1GEC E;  3PT2 A;  4CZW A;  2OP3 A;  4N79 A;  4BS5 A;  3H8C A;  3P5V A;  1PBH A;  3DF0 A;  3PNR A;  4QRX A;  1CSB B;  1TLO A;  3PRM A;  3BB7 A;  2PNS A;  2FT2 A;  2FO5 A;  2DJG B;  1GLO A;  3F5V A;  3S3Q A;  3IEJ A;  4N8W A;  1KFX L;  1KXR A;  3P5U A;  3MJ5 A;  2R9O A;  1BP4 A;  1K3B B;  4XZX A;  3E1Z B;  2O6X A;  2VHF A;  1PE6 A;  2P86 A;  4XUI A;  3H7D A;  3PHX A;  4KLB A;  4CDE B;  2BDZ A;  1U5I A;  3E9S A;  1DKI A;  1EWP A;  1VSN A;  4D8E A;  2BTW B;  2XU3 A;  2YJ8 A;  4YYW A;  4OVZ A;  1FH0 A;  5F02 A;  1A6R A;  7PCK A;  4PP1 A;  2R9F A;  1F2C A;  4PI3 A;  4CDC B;  2YJC A;  1ATK A;  2P7U A;  2E03 A;  3KX1 A;  4X6H A;  1F29 A;  3BC3 A;  4MZO A;  1SNK A;  1U9X A;  3BOW A;  4I04 A;  3P5W A;  3PSE A;  3ZUA A;  4AXM A;  3O65 A;  2J7Q A;  5A24 A;  3KW9 A;  2AUZ A;  1PPO A;  3N3K A;  3USV A;  4BPV A;  1DF0 A;  5PAD A;  1Y08 A;  2IPP B;  2FQ9 A;  1CPJ A;  2PRE A;  1YVB A;  1GCB A;  2DCD A;  2JRI A;  1QOL A;  2ACT A;  2PAD A;  4X6I A;  2E01 A;  2BU3 A;  3C0R A;  1O0E A;  3MHS A;  4OEM A;  4FK5 A;  3B21 A;  4Q8G A;  3AI8 A;  3OF9 A;  1YT7 A;  2DCA A;  2R9M A;  3H6S A;  4RF0 A;  1S4V A;  1CB5 A;  3PHU A;  3OQC A;  1PIP A;  3ERV A;  3H89 A;  2NQA A;  3RVV A;  4AXL A;  5KO3 A;  1EWM A;  1VJV A;  3OVX A;  2NQD B;  1SP4 B;  1BY8 A;  4P6E A;  1U9V A;  3O1G A;  2GHU A;  4G54 A;  2BDL A;  3OF8 A;  3MTN A;  3LFY A;  3U8E A;  2Y5B A;  4YV8 A;  3BBA A;  4ZUX U;  4MSX A;  1AYW A;  4P16 A;  3PBH A;  2G6D A;  4CDF B;  4W5B A;  5EF4 A;  4YYR A;  1HUC B;  2R9C A;  3WXF A;  4RKX A;  4WA6 A;  2UZJ A;  3IMA A;  2JQF R;  3OVZ A;  1STF E;  4K7C A;  4ZTB A;  1NLJ A;  1CVZ A;  4N4Z A;  4FJC A;  1EF7 A;  2HH5 A;  1CS8 A;  1AU4 A;  3WXG A;  2JQG R;  2YJ9 A;  3HWN A;  4W4U A;  3PHW A;  4BSQ A;  1IWD A;  3V6E A;  1NB5 A;  4X6J A;  2NQI A;  1NB3 A;  2F1G A;  2YJ2 A;  5CVO B;  1PXV A;  3KWZ A;  3IUT A;  4MZS A;  1MS6 A;  3V6C A;  4QRV A;  4I07 A;  2DJF B;  2FRA A;  4QH6 A;  2DC9 A;  4GUA A;  4MI7 A;  4RY2 A;  4DMY A;  3KKU A;  1ICF A;  4BOS A;  2E02 A;  2OZ2 A;  3B79 A;  4PAD A;  3ZNH A;  2G8J A;  2R6N A;  1X9Y A;  1NL6 A;  4R3D A;  1BGO A;  2HD5 A;  5EZS A;  3F75 A;  1YK7 A;  2DCB A;  3WXE A;  3HHA A;  2DZY A;  2BTW A;  3BPF A;  3MTV A;  3GCB A;  4BOQ A;  1U9W A;  1AYV A;  1QXP A;  4QBB A;  2B1N A;  1TU6 A;  2WBF X;  3BY4 A;  5EGW A;  2CIO A;  1AU2 A;  2ATO A;  3N3G A;  1PAD A;  2AUX A;  3PRP A;  4YYV A;  4HWY A;  1EWO A;  3PDF A;  2F7D A;  1POP A;  2DC8 A;  3OIS A;  2E00 A;  6PAD A;  4IUM A;  1AIM A;  2FYE A;  3O0U A;  3CH2 X;  3MP2 A;  1ITO A;  4MM3 B;  2XU4 A;  3BWK A;  1DEU A;  3PW3 A;  5CHV A;  2CB5 A;  3IHP A;  3IFU A;  2AS8 A;  3TRK A;  3W30 A;  3KWB X;  3HHI A;  1UKF A;  2HHN A;  2HXZ A;  4RNA A;  3QT4 A;  3TNX A;  1ME4 A;  1NPZ A;  2AU1 A;  3KFQ A;  3QSD A;  2HWK A;  8PCH A;  1PVJ A;  3MHH A;  3K9M A;  4QRG A;  3HD3 A;  2AYN A;  1AU3 A;  1PPP A;  5J94 A;  4REZ A;  5CVM A;  5JH3 A;  1ZCM A;  2J7Q C;  3KSE A;  3MOR A;  4XR7 A;  4WUR A;  1EWL A;  5JZE A;  4OEL A;  1MEM A;  2Y6E A;  1KFU L;  2Z84 A;  5CHT A;  4I05 A;  1MIR A;  2G8E A;  5FPW A;  1THE A;  2DZZ A;  2YJB A;  3CH3 X;  1BQI A;  4Q8H A;  2FRQ A;  2PBH A;  9PAP A;  2JTC A;  2AVW A;  3C9E A;  1QMY A;  3K8U A;  4RF1 A;  4BOU A;  2P0R A;  3BPM A;  3K24 A;  3W31 A;  1CJL A;  4YYQ A;  4PP2 E;  1MEG A;  3H8B A;  3QJ3 A;  1NQC A;  2R9N A;  4A5U A;  1M6D A;  2XU5 A;  5K16 A;  2OUL A;  5EZQ A;  1F2B A;  1AEC A;  2C0Y A;  3IOQ A;  1ME3 A;  3CBK A;  4CDD B;  4PT5 A;  3S3R A;  3I06 A;  3I3T A;  1F2A A;  4YYS A;  2FUD A;  1CV8 A;  2AIM A;  2AYO A;  2FE8 A;  1QDQ A;  3BCN A;  3M99 A;  3NHE A;  4P6G A;  2DOS A;  2H7J A;  2DCC A;  4DMX A;  2FTD A;  1U9Q X; 
#chains in the Genus database with same CATH homology
 1AYU A;  2ARY A;  1KHP A;  2DC7 A;  4BS6 A;  1GMY A;  1JQP A;  2G7Y A;  1AU0 A;  3RVX A;  1KHQ A;  1XKG A;  4NV7 A;  4YYU A;  1PCI A;  1ZIV A;  1W4T A;  4FIP A;  1PPD A;  2IBI A;  1W6F A;  3RVW A;  3P5X A;  3LXS A;  2VHS A;  4YVA A;  1MDW A;  1CTE A;  1PPN A;  1Q6K A;  1YAL A;  3CBJ A;  2B1M A;  3D6S A;  5CVN B;  2GFO A;  3IV2 A;  5JA7 A;  1Y4H A;  4W5C A;  4GUZ A;  1CQD A;  2NQG A;  2XU1 A;  2DC6 A;  1YK8 A;  4BQV A;  3N4C A;  1TL9 A;  2VFC A;  1MHW A;  1GEC E;  3D9W A;  4CZW A;  2OP3 A;  4N79 A;  4BS5 A;  3H8C A;  3P5V A;  1PBH A;  3DF0 A;  3PNR A;  4QRX A;  1GX3 A;  1CSB B;  1TLO A;  2PNS A;  2FT2 A;  2FO5 A;  2DJG B;  1GLO A;  3F5V A;  3S3Q A;  3IEJ A;  4N8W A;  1KFX L;  1KXR A;  3P5U A;  2R9O A;  1BP4 A;  1K3B B;  3E1Z B;  2O6X A;  2VHF A;  4XUI A;  1PE6 A;  2P86 A;  3H7D A;  4CDE B;  4KLB A;  2BDZ A;  1U5I A;  1EWP A;  1VSN A;  2XU3 A;  2YJ8 A;  4YYW A;  1FH0 A;  5F02 A;  1A6R A;  7PCK A;  4PP1 A;  2R9F A;  1F2C A;  4PI3 A;  4CDC B;  2YJC A;  1ATK A;  2P7U A;  2E03 A;  3KX1 A;  4X6H A;  1F29 A;  3BC3 A;  4MZO A;  1SNK A;  1U9X A;  3BOW A;  4I04 A;  3P5W A;  1U9Q X;  3ZUA A;  4AXM A;  5A24 A;  3KW9 A;  2AUZ A;  1PPO A;  3N3K A;  3USV A;  4BPV A;  1DF0 A;  5PAD A;  1Y08 A;  2IPP B;  2FQ9 A;  1CPJ A;  2PRE A;  1YVB A;  1GCB A;  2DCD A;  1QOL A;  2ACT A;  2PAD A;  4X6I A;  2E01 A;  1O0E A;  3MHS A;  4OEM A;  4FK5 A;  4Q8G A;  3AI8 A;  3OF9 A;  1YT7 A;  2DCA A;  2R9M A;  3H6S A;  4B55 A;  1S4V A;  1CB5 A;  1PIP A;  3ERV A;  3H89 A;  2NQA A;  3RVV A;  4AXL A;  1W5R A;  1EWM A;  1VJV A;  3OVX A;  2NQD B;  1SP4 B;  1BY8 A;  4P6E A;  1U9V A;  3O1G A;  2GHU A;  4G54 A;  2BDL A;  3OF8 A;  3MTN A;  3LFY A;  3U8E A;  2Y5B A;  4YV8 A;  4ZUX U;  4MSX A;  1AYW A;  3PBH A;  2G6D A;  4CDF B;  4W5B A;  5EF4 A;  4YYR A;  1HUC B;  2R9C A;  3WXF A;  4WA6 A;  3IMA A;  2JQF R;  3OVZ A;  1STF E;  4K7C A;  1NLJ A;  1CVZ A;  4N4Z A;  4FJC A;  1EF7 A;  2HH5 A;  1CS8 A;  1AU4 A;  3WXG A;  2JQG R;  2YJ9 A;  3HWN A;  4BSQ A;  1IWD A;  3V6E A;  1NB5 A;  4X6J A;  2NQI A;  1NB3 A;  2F1G A;  2YJ2 A;  5CVO B;  1PXV A;  3KWZ A;  3IUT A;  4BGF A;  4MZS A;  1MS6 A;  2BSZ A;  3V6C A;  4QRV A;  2DJF B;  4I07 A;  2FRA A;  4QH6 A;  2DC9 A;  4RY2 A;  4DMY A;  3KKU A;  1ICF A;  2E02 A;  2OZ2 A;  3B79 A;  4PAD A;  2G8J A;  2R6N A;  1X9Y A;  1NL6 A;  1BGO A;  2HD5 A;  3F75 A;  1YK7 A;  2DCB A;  3WXE A;  3HHA A;  2DZY A;  3BPF A;  3GCB A;  1U9W A;  1AYV A;  1QXP A;  4QBB A;  2B1N A;  1TU6 A;  2WBF X;  5EGW A;  2CIO A;  1AU2 A;  2ATO A;  3N3G A;  1PAD A;  2AUX A;  4YYV A;  4HWY A;  1EWO A;  3PDF A;  4C5P A;  2F7D A;  1POP A;  2DC8 A;  3OIS A;  2E00 A;  6PAD A;  1AIM A;  2FYE A;  3O0U A;  3CH2 X;  1ITO A;  2XU4 A;  3BWK A;  1DEU A;  3PW3 A;  5CHV A;  2CB5 A;  3IHP A;  2AS8 A;  3KWB X;  4NV8 A;  3HHI A;  2HHN A;  2HXZ A;  3QT4 A;  3TNX A;  1ME4 A;  1NPZ A;  2AU1 A;  3KFQ A;  3QSD A;  8PCH A;  3MHH A;  3K9M A;  4QRG A;  3HD3 A;  2AYN A;  1AU3 A;  1PPP A;  5J94 A;  5CVM A;  5JH3 A;  1E2T A;  1ZCM A;  3KSE A;  3MOR A;  4XR7 A;  3LTW A;  1EWL A;  4OEL A;  1MEM A;  2Y6E A;  1KFU L;  5CHT A;  4I05 A;  1MIR A;  2G8E A;  5FPW A;  1THE A;  2DZZ A;  2YJB A;  3CH3 X;  1BQI A;  4Q8H A;  2FRQ A;  2PBH A;  9PAP A;  2AVW A;  3C9E A;  1QMY A;  3K8U A;  2P0R A;  3BPM A;  3K24 A;  1CJL A;  4YYQ A;  4PP2 E;  1MEG A;  3H8B A;  2R9N A;  1NQC A;  3QJ3 A;  1M6D A;  2XU5 A;  5K16 A;  2OUL A;  1F2B A;  1AEC A;  2C0Y A;  3IOQ A;  1ME3 A;  3CBK A;  4CDD B;  3S3R A;  3I06 A;  3I3T A;  1F2A A;  4YYS A;  2FUD A;  1CV8 A;  2AIM A;  2AYO A;  1QDQ A;  3BCN A;  2VFB A;  3M99 A;  3NHE A;  4P6G A;  2H7J A;  2DCC A;  4DMX A;  2FTD A;  4W4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...