4BQVA

Mouse cathepsin s with covalent ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bqvA00
1SP4B 3I3TA 2FUDA 1CQDA 4WA6A 1DEUA 4MZSA 4FIPA 1YT7A 1U9XA 3MORA 1KXRA 3BPMA 2G7YA 1AYVA 2CB5A 4KLBA 4YV8A 3P5XA 3IV2A 2NQIA 1AYUA 4YYUA 1NLJA 1CB5A 3KWBX 1MDWA 2AUZA 2FTDA 2G6DA 1TLOA 2BDZA 1AECA 2HH5A 2DJFB 3CH3X 1F2BA 3C9EA 3D6SA 3HWNA 3P5WA 3P5UA 4BS6A 4PP1A 1CVZA 8PCHA 2G8JA 2DZYA 2XU5A 1A6RA 3OVXA 4CZWA 1F2CA 1STFE 2FRAA 2IPPB 4BQVA 4RY2A 1Y08A 4X6JA 3H89A 2OZ2A 1GMYA 5CVNB 4AXLA 2ACTA 4G54A 2AS8A 4YYQA 1F2AA 3N4CA 3BWKA 3LXSA 1CSBB 1NB3A 3S3QA 3E1ZB 1S4VA 2YJBA 3KX1A 3IMAA 3KW9A 3HHIA 1KFXL 2P0RA 2E03A 1FH0A 1MIRA 2NQAA 1ICFA 3GCBA 3BCNA 3NHEA 3KKUA 6PADA 5CVMA 2DJGB 2DCDA 3K9MA 4I07A 1PPPA 1U5IA 3HHAA 3PBHA 1PXVA 1BP4A 4MSXA 5JA7A 2HXZA 2FYEA 2OULA 1MEMA 4FK5A 3IHPA 3OF9A 4ZUXU 1PPDA 3K8UA 2R9FA 1AIMA 3WXGA 1MEGA 1EWPA 1NL6A 1IWDA 1YK7A 4XR7A 4X6HA 2DCBA 2R9MA 4BPVA 2P86A 5FPWA 2PNSA 3AI8A 4QRGA 1BQIA 1Y4HA 4YVAA 2AU1A 2E01A 3KWZA 4W5BA 1K3BB 4YYWA 2NQGA 1PADA 1AU3A 2R9CA 1PCIA 4N4ZA 1YK8A 4X6IA 4CDEB 1AYWA 2XU3A 1NQCA 4XUIA 2HHNA 3MHSA 3CBKA 4FJCA 2FQ9A 5EF4A 3P5VA 3RVXA 4DMYA 2PADA 2F7DA 2O6XA 1M6DA 2OP3A 2IBIA 3BOWA 1EWLA 4DMXA 4Q8GA 3PW3A 2WBFX 4BS5A 5J94A 3WXEA 1VSNA 2Y6EA 4YYVA 3O1GA 5CVOB 3PNRA 3CBJA 5JH3A 4AXMA 1KFUL 3BC3A 5PADA 3V6EA 1DF0A 4QBBA 2R9NA 1X9YA 2YJCA 2XU1A 2DCAA 3DF0A 4QRVA 1CTEA 2Y5BA 3U8EA 2XU4A 4I05A 1YVBA 3IEJA 3WXFA 2PREA 1KHPA 2DCCA 1AU0A 2P7UA 1CS8A 1EWOA 1GECE 1AU2A 3PDFA 2E02A 3LFYA 1U9QX 2AVWA 1TL9A 2DC8A 1PE6A 1PPOA 4BSQA 4W4UA 1YALA 3BPFA 2DC6A 1VJVA 1TU6A 3B79A 3HD3A 1JQPA 2AYOA 1HUCB 4CDCB 2R9OA 2F1GA 1QDQA 5F02A 4CDDB 3V6CA 1QMYA 3ZUAA 4YYRA 1CV8A 1CPJA 1Q6KA 1ITOA 2DZZA 2R6NA 3QJ3A 2VHFA 2CIOA 4OELA 3ERVA 4N8WA 1SNKA 1PPNA 1EF7A 1QOLA 5K16A 1ME4A 2PBHA 3H8BA 2AUXA 2FRQA 4I04A 2B1NA 4YYSA 2YJ8A 3N3GA 2ARYA 1MHWA 2NQDB 1BY8A 4W5CA 3K24A 3M99A 1GCBA 3OISA 4PI3A 3S3RA 5EGWA 2FO5A 4P6GA 2HD5A 5CHTA 1XKGA 3H6SA 1EWMA 2FT2A 3QSDA 1QXPA 3RVWA 2B1MA 1NPZA 3USVA 9PAPA 4PADA 2JQGR 4N79A 3CH2X 2DC7A 3OVZA 3RVVA 4Q8HA 1PBHA 1POPA 2AYNA 1KHQA 1ZIVA 2YJ9A 3N3KA 4K7CA 2G8EA 2DC9A 1CJLA 1THEA 2AIMA 4CDFB 3MTNA 2E00A 2GHUA 2BDLA 4P6EA 3KSEA 2VHSA 1F29A 2H7JA 1O0EA 2YJ2A 3KFQA 3H7DA 1AU4A 3F75A 1BGOA 5A24A 4HWYA 1MS6A 1ATKA 4QRXA 2C0YA 3OF8A 4PP2E 1GLOA 4MZOA 3QT4A 3IOQA 2ATOA 4QH6A 3O0UA 2GFOA 1PIPA 3H8CA 4OEMA 5CHVA 3IUTA 3TNXA 3MHHA 1U9VA 3I06A 2JQFR 1ME3A 1ZCMA 1U9WA 1NB5A 3F5VA 7PCKA
chains in the Genus database with same CATH superfamily
1SP4B 3I3TA 2FUDA 1CQDA 4WA6A 1DEUA 4MZSA 4FIPA 1YT7A 2BTWA 1U9XA 4OW0A 3MORA 1KXRA 3BPMA 2G7YA 1AYVA 2CB5A 4KLBA 4YV8A 3P5XA 3IV2A 3MJ5A 2NQIA 1AYUA 5EZSA 4YYUA 2BTWB 1NLJA 1CB5A 3KWBX 1MDWA 2AUZA 2FTDA 2G6DA 1TLOA 2BDZA 1AECA 2HH5A 2DJFB 3CH3X 4D8BA 1F2BA 3C9EA 3D6SA 3HWNA 3P5WA 3P5UA 4BS6A 4PP1A 1CVZA 8PCHA 2G8JA 2DZYA 1DKIA 2XU5A 3TMPA 1A6RA 3OVXA 4CZWA 1F2CA 1STFE 2FRAA 2IPPB 4BQVA 1YZBA 2JRIA 1Y08A 4RY2A 4X6JA 3H89A 2OZ2A 1GMYA 5CVNB 4AXLA 2ACTA 4G54A 2AS8A 4YYQA 1F2AA 3N4CA 3BWKA 3LXSA 1CSBB 1NB3A 3S3QA 3E1ZB 1S4VA 4A5UA 2YJBA 3KX1A 3IMAA 3KW9A 3HHIA 4IUMA 1KFXL 2P0RA 2E03A 1FH0A 4XZXA 1MIRA 2BU3A 2NQAA 4D8IA 3BY4A 2HWKA 4OVZA 1ICFA 3GCBA 3BCNA 3NHEA 3KKUA 2AGAA 6PADA 5CVMA 2DJGB 2DCDA 3K9MA 4I07A 1PPPA 1U5IA 3HHAA 3PBHA 1PXVA 1BP4A 4MSXA 5JA7A 3W30A 2HXZA 2FYEA 2OULA 1MEMA 4M0WA 4BOPA 5JZEA 4FK5A 3IHPA 3OF9A 4ZUXU 1PPDA 3K8UA 2R9FA 1AIMA 3WXGA 1MEGA 1EWPA 1NL6A 1IWDA 4D8EA 1YK7A 4XR7A 4X6HA 2DCBA 3BBAA 2R9MA 4BPVA 2P86A 4RF1A 5FPWA 2PNSA 3AI8A 4QRGA 1BQIA 1Y4HA 4YVAA 2AU1A 2E01A 3KWZA 4W5BA 1K3BB 4MI7A 2FE8A 4YYWA 2J7QA 2NQGA 1PADA 1AU3A 2R9CA 1PCIA 4N4ZA 3MTVA 1YK8A 4X6IA 4WURA 4CDEB 1AYWA 2XU3A 1NQCA 4XUIA 2HHNA 3MHSA 3CBKA 4FJCA 3E9SA 2FQ9A 5EF4A 3P5VA 3RVXA 4REZA 4DMYA 2PADA 2F7DA 2O6XA 4ZTBA 1M6DA 3MP2A 2OP3A 2IBIA 3BOWA 5KO3A 1EWLA 4RF0A 4DMXA 2DOSA 4Q8GA 3PW3A 2WBFX 4BS5A 5J94A 3WXEA 1VSNA 2Y6EA 4YYVA 3O1GA 5CVOB 2JTCA 4BOQA 3PNRA 3CBJA 4BOSA 5JH3A 4AXMA 1KFUL 3BC3A 5PADA 3TRKA 3V6EA 1DF0A 4QBBA 2R9NA 1X9YA 2YJCA 2XU1A 2DCAA 3DF0A 4QRVA 1CTEA 2Y5BA 3U8EA 2XU4A 4I05A 4PT5A 1YVBA 3IEJA 3IFUA 2PREA 1KHPA 3WXFA 2DCCA 1PVJA 1AU0A 2P7UA 3OQCA 1CS8A 1EWOA 1GECE 1AU2A 3PHUA 3PDFA 2E02A 3LFYA 3PSEA 1U9QX 2AVWA 1TL9A 3PRMA 2DC8A 1PE6A 4OVZB 1PPOA 4BSQA 4W4UA 1YALA 3BPFA 2DC6A 1UKFA 1VJVA 1TU6A 3B79A 3HD3A 4R3DA 1JQPA 2AYOA 1HUCB 4CDCB 2J7QC 2R9OA 2F1GA 1QDQA 5F02A 4CDDB 3V6CA 3BB7A 1QMYA 3ZUAA 3O65A 4YYRA 1CV8A 4RKXA 1CPJA 1Q6KA 1ITOA 2DZZA 2R6NA 3QJ3A 2VHFA 2CIOA 4OELA 3ERVA 4N8WA 4BOUA 1SNKA 1PPNA 1EF7A 1QOLA 5K16A 1ME4A 2PBHA 4P16A 3H8BA 2AUXA 2FRQA 4I04A 2B1NA 4YYSA 2YJ8A 3N3GA 2ARYA 1MHWA 2NQDB 1BY8A 3PRPA 4MM3B 4W5CA 3K24A 3M99A 1GCBA 3OISA 4PI3A 3S3RA 5EGWA 2FO5A 4P6GA 2HD5A 5CHTA 1XKGA 4GUAA 3H6SA 1EWMA 4RNAA 2FT2A 3PT2A 3QSDA 1QXPA 3RVWA 2B1MA 1NPZA 3USVA 9PAPA 4PADA 2JQGR 4N79A 3CH2X 2DC7A 3OVZA 3RVVA 4Q8HA 2UZJA 1PBHA 3PHWA 1POPA 2AYNA 4HXDB 1KHQA 1ZIVA 2YJ9A 3N3KA 4K7CA 4IP3A 2G8EA 5E6JA 2DC9A 1CJLA 1THEA 2AIMA 2Z84A 4CDFB 3MTNA 2E00A 2GHUA 5EZQA 2BDLA 4P6EA 3KSEA 2VHSA 3B21A 1F29A 2H7JA 1O0EA 2YJ2A 3KFQA 3H7DA 3RNVA 1AU4A 3F75A 1BGOA 5A24A 4HWYA 1MS6A 1ATKA 4BOZA 4QRXA 3W31A 2C0YA 3OF8A 4PP2E 3ZNHA 1GLOA 4MZOA 3QT4A 3IOQA 2ATOA 4QH6A 3C0RA 3O0UA 2GFOA 1PIPA 3PHXA 3H8CA 4OEMA 5CHVA 3IUTA 3TNXA 3MHHA 1U9VA 3I06A 2JQFR 1ME3A 1ZCMA 1U9WA 1NB5A 3F5VA 7PCKA
chains in the Genus database with same CATH topology
4NV7A 1SP4B 3I3TA 2FUDA 1CQDA 4WA6A 1DEUA 4MZSA 4FIPA 1YT7A 1U9XA 3MORA 1KXRA 3BPMA 2G7YA 1AYVA 2CB5A 4KLBA 4YV8A 3P5XA 3IV2A 2NQIA 1AYUA 4YYUA 1NLJA 1CB5A 1GX3A 3KWBX 1MDWA 2AUZA 2FTDA 2G6DA 1TLOA 2BDZA 1AECA 2HH5A 2DJFB 4BGFA 3CH3X 1F2BA 3C9EA 3D6SA 3HWNA 3P5WA 3P5UA 4BS6A 4PP1A 1CVZA 8PCHA 2G8JA 2VFBA 2DZYA 2XU5A 1A6RA 3OVXA 4CZWA 1F2CA 1STFE 2FRAA 2IPPB 4BQVA 4RY2A 1Y08A 4X6JA 3H89A 2OZ2A 1GMYA 5CVNB 4AXLA 2ACTA 4G54A 2AS8A 4YYQA 1F2AA 3N4CA 3BWKA 3LXSA 1CSBB 1NB3A 3S3QA 3E1ZB 1S4VA 2YJBA 3KX1A 3IMAA 3KW9A 3HHIA 1KFXL 2P0RA 2E03A 1FH0A 1MIRA 2NQAA 1ICFA 3GCBA 3BCNA 3NHEA 3KKUA 6PADA 5CVMA 2DJGB 2DCDA 3K9MA 4I07A 1PPPA 1U5IA 3HHAA 3PBHA 4GUZA 1PXVA 1BP4A 4MSXA 5JA7A 2HXZA 2FYEA 2OULA 1MEMA 4FK5A 3IHPA 3OF9A 4ZUXU 1PPDA 3K8UA 2R9FA 1AIMA 3WXGA 1NL6A 1EWPA 1MEGA 1IWDA 1YK7A 4XR7A 4X6HA 2DCBA 2R9MA 4BPVA 2P86A 5FPWA 2PNSA 3AI8A 4QRGA 1BQIA 1Y4HA 4YVAA 2AU1A 2E01A 3KWZA 4W5BA 1W5RA 1K3BB 4YYWA 2NQGA 1PADA 1AU3A 2R9CA 1PCIA 4N4ZA 1E2TA 1YK8A 4X6IA 4CDEB 1AYWA 2XU3A 1NQCA 4XUIA 2HHNA 3MHSA 3CBKA 4FJCA 2FQ9A 5EF4A 3P5VA 3RVXA 4DMYA 2PADA 2F7DA 2O6XA 1M6DA 2OP3A 2IBIA 3BOWA 1EWLA 4DMXA 4Q8GA 3PW3A 2WBFX 4BS5A 5J94A 3WXEA 1VSNA 2Y6EA 4YYVA 3O1GA 5CVOB 3PNRA 3CBJA 5JH3A 4AXMA 1KFUL 3BC3A 5PADA 3V6EA 1DF0A 4QBBA 4NV8A 2R9NA 1X9YA 2YJCA 2XU1A 2DCAA 3DF0A 4QRVA 1CTEA 2Y5BA 3U8EA 2XU4A 4I05A 2VFCA 1YVBA 3IEJA 3WXFA 2PREA 1KHPA 2DCCA 1AU0A 2P7UA 1CS8A 1EWOA 1GECE 1AU2A 3PDFA 2E02A 3LFYA 1U9QX 2AVWA 2BSZA 1TL9A 2DC8A 1PE6A 1PPOA 4BSQA 4W4UA 1YALA 3BPFA 2DC6A 1VJVA 1TU6A 3B79A 3HD3A 1JQPA 2AYOA 1HUCB 4CDCB 2R9OA 2F1GA 1QDQA 5F02A 4CDDB 3V6CA 1QMYA 3ZUAA 4YYRA 1CV8A 1CPJA 1Q6KA 1ITOA 2DZZA 2R6NA 3QJ3A 2VHFA 4B55A 2CIOA 4OELA 3ERVA 4N8WA 1SNKA 1PPNA 1EF7A 1QOLA 5K16A 1ME4A 2PBHA 3H8BA 2AUXA 1W4TA 2FRQA 4I04A 2B1NA 4YYSA 2YJ8A 3N3GA 2ARYA 1MHWA 2NQDB 1BY8A 4W5CA 1W6FA 3K24A 3M99A 1GCBA 3OISA 4PI3A 3S3RA 5EGWA 2FO5A 4P6GA 2HD5A 5CHTA 1XKGA 3H6SA 1EWMA 2FT2A 3QSDA 1QXPA 3RVWA 2B1MA 1NPZA 3USVA 9PAPA 4PADA 2JQGR 4N79A 3CH2X 2DC7A 3OVZA 3RVVA 4Q8HA 1PBHA 1POPA 2AYNA 1KHQA 1ZIVA 2YJ9A 3N3KA 4K7CA 2G8EA 2DC9A 1CJLA 1THEA 2AIMA 4CDFB 3MTNA 2E00A 2GHUA 2BDLA 4P6EA 3KSEA 2VHSA 4C5PA 1F29A 2H7JA 1O0EA 2YJ2A 3KFQA 3H7DA 1AU4A 3F75A 1BGOA 5A24A 4HWYA 1MS6A 1ATKA 3D9WA 3LTWA 4QRXA 2C0YA 3OF8A 4PP2E 1GLOA 4MZOA 3QT4A 3IOQA 2ATOA 4QH6A 3O0UA 2GFOA 1PIPA 3H8CA 4OEMA 5CHVA 3IUTA 3TNXA 3MHHA 1U9VA 3I06A 2JQFR 1ME3A 1ZCMA 1U9WA 1NB5A 3F5VA 7PCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SP4 B;  3I3T A;  2FUD A;  1CQD A;  4WA6 A;  1DEU A;  4MZS A;  4FIP A;  1YT7 A;  1U9X A;  3MOR A;  1KXR A;  3BPM A;  2G7Y A;  1AYV A;  2CB5 A;  4KLB A;  4YV8 A;  3P5X A;  3IV2 A;  2NQI A;  1AYU A;  4YYU A;  1NLJ A;  1CB5 A;  3KWB X;  1MDW A;  2AUZ A;  2FTD A;  2G6D A;  1TLO A;  2BDZ A;  1AEC A;  2HH5 A;  2DJF B;  3CH3 X;  1F2B A;  3C9E A;  3D6S A;  3HWN A;  3P5W A;  3P5U A;  4BS6 A;  4PP1 A;  1CVZ A;  8PCH A;  2G8J A;  2DZY A;  2XU5 A;  1A6R A;  3OVX A;  4CZW A;  1F2C A;  1STF E;  2FRA A;  2IPP B;  4BQV A;  4RY2 A;  1Y08 A;  4X6J A;  3H89 A;  2OZ2 A;  1GMY A;  5CVN B;  4AXL A;  2ACT A;  4G54 A;  2AS8 A;  4YYQ A;  1F2A A;  3N4C A;  3BWK A;  3LXS A;  1CSB B;  1NB3 A;  3S3Q A;  3E1Z B;  1S4V A;  2YJB A;  3KX1 A;  3IMA A;  3KW9 A;  3HHI A;  1KFX L;  2P0R A;  2E03 A;  1FH0 A;  1MIR A;  2NQA A;  1ICF A;  3GCB A;  3BCN A;  3NHE A;  3KKU A;  6PAD A;  5CVM A;  2DJG B;  2DCD A;  3K9M A;  4I07 A;  1PPP A;  1U5I A;  3HHA A;  3PBH A;  1PXV A;  1BP4 A;  4MSX A;  5JA7 A;  2HXZ A;  2FYE A;  2OUL A;  1MEM A;  4FK5 A;  3IHP A;  3OF9 A;  4ZUX U;  1PPD A;  3K8U A;  2R9F A;  1AIM A;  3WXG A;  1MEG A;  1EWP A;  1NL6 A;  1IWD A;  1YK7 A;  4XR7 A;  4X6H A;  2DCB A;  2R9M A;  4BPV A;  2P86 A;  5FPW A;  2PNS A;  3AI8 A;  4QRG A;  1BQI A;  1Y4H A;  4YVA A;  2AU1 A;  2E01 A;  3KWZ A;  4W5B A;  1K3B B;  4YYW A;  2NQG A;  1PAD A;  1AU3 A;  2R9C A;  1PCI A;  4N4Z A;  1YK8 A;  4X6I A;  4CDE B;  1AYW A;  2XU3 A;  1NQC A;  4XUI A;  2HHN A;  3MHS A;  3CBK A;  4FJC A;  2FQ9 A;  5EF4 A;  3P5V A;  3RVX A;  4DMY A;  2PAD A;  2F7D A;  2O6X A;  1M6D A;  2OP3 A;  2IBI A;  3BOW A;  1EWL A;  4DMX A;  4Q8G A;  3PW3 A;  2WBF X;  4BS5 A;  5J94 A;  3WXE A;  1VSN A;  2Y6E A;  4YYV A;  3O1G A;  5CVO B;  3PNR A;  3CBJ A;  5JH3 A;  4AXM A;  1KFU L;  3BC3 A;  5PAD A;  3V6E A;  1DF0 A;  4QBB A;  2R9N A;  1X9Y A;  2YJC A;  2XU1 A;  2DCA A;  3DF0 A;  4QRV A;  1CTE A;  2Y5B A;  3U8E A;  2XU4 A;  4I05 A;  1YVB A;  3IEJ A;  3WXF A;  2PRE A;  1KHP A;  2DCC A;  1AU0 A;  2P7U A;  1CS8 A;  1EWO A;  1GEC E;  1AU2 A;  3PDF A;  2E02 A;  3LFY A;  1U9Q X;  2AVW A;  1TL9 A;  2DC8 A;  1PE6 A;  1PPO A;  4BSQ A;  4W4U A;  1YAL A;  3BPF A;  2DC6 A;  1VJV A;  1TU6 A;  3B79 A;  3HD3 A;  1JQP A;  2AYO A;  1HUC B;  4CDC B;  2R9O A;  2F1G A;  1QDQ A;  5F02 A;  4CDD B;  3V6C A;  1QMY A;  3ZUA A;  4YYR A;  1CV8 A;  1CPJ A;  1Q6K A;  1ITO A;  2DZZ A;  2R6N A;  3QJ3 A;  2VHF A;  2CIO A;  4OEL A;  3ERV A;  4N8W A;  1SNK A;  1PPN A;  1EF7 A;  1QOL A;  5K16 A;  1ME4 A;  2PBH A;  3H8B A;  2AUX A;  2FRQ A;  4I04 A;  2B1N A;  4YYS A;  2YJ8 A;  3N3G A;  2ARY A;  1MHW A;  2NQD B;  1BY8 A;  4W5C A;  3K24 A;  3M99 A;  1GCB A;  3OIS A;  4PI3 A;  3S3R A;  5EGW A;  2FO5 A;  4P6G A;  2HD5 A;  5CHT A;  1XKG A;  3H6S A;  1EWM A;  2FT2 A;  3QSD A;  1QXP A;  3RVW A;  2B1M A;  1NPZ A;  3USV A;  9PAP A;  4PAD A;  2JQG R;  4N79 A;  3CH2 X;  2DC7 A;  3OVZ A;  3RVV A;  4Q8H A;  1PBH A;  1POP A;  2AYN A;  1KHQ A;  1ZIV A;  2YJ9 A;  3N3K A;  4K7C A;  2G8E A;  2DC9 A;  1CJL A;  1THE A;  2AIM A;  4CDF B;  3MTN A;  2E00 A;  2GHU A;  2BDL A;  4P6E A;  3KSE A;  2VHS A;  1F29 A;  2H7J A;  1O0E A;  2YJ2 A;  3KFQ A;  3H7D A;  1AU4 A;  3F75 A;  1BGO A;  5A24 A;  4HWY A;  1MS6 A;  1ATK A;  4QRX A;  2C0Y A;  3OF8 A;  4PP2 E;  1GLO A;  4MZO A;  3QT4 A;  3IOQ A;  2ATO A;  4QH6 A;  3O0U A;  2GFO A;  1PIP A;  3H8C A;  4OEM A;  5CHV A;  3IUT A;  3TNX A;  3MHH A;  1U9V A;  3I06 A;  2JQF R;  1ME3 A;  1ZCM A;  1U9W A;  1NB5 A;  3F5V A;  7PCK A; 
#chains in the Genus database with same CATH topology
 1SP4 B;  3I3T A;  2FUD A;  1CQD A;  4WA6 A;  1DEU A;  4MZS A;  4FIP A;  1YT7 A;  2BTW A;  1U9X A;  4OW0 A;  3MOR A;  1KXR A;  3BPM A;  2G7Y A;  1AYV A;  2CB5 A;  4KLB A;  4YV8 A;  3P5X A;  3IV2 A;  3MJ5 A;  2NQI A;  1AYU A;  5EZS A;  4YYU A;  2BTW B;  1NLJ A;  1CB5 A;  3KWB X;  1MDW A;  2AUZ A;  2FTD A;  2G6D A;  1TLO A;  2BDZ A;  1AEC A;  2HH5 A;  2DJF B;  3CH3 X;  4D8B A;  1F2B A;  3C9E A;  3D6S A;  3HWN A;  3P5W A;  3P5U A;  4BS6 A;  4PP1 A;  1CVZ A;  8PCH A;  2G8J A;  2DZY A;  1DKI A;  2XU5 A;  3TMP A;  1A6R A;  3OVX A;  4CZW A;  1F2C A;  1STF E;  2FRA A;  2IPP B;  4BQV A;  1YZB A;  2JRI A;  1Y08 A;  4RY2 A;  4X6J A;  3H89 A;  2OZ2 A;  1GMY A;  5CVN B;  4AXL A;  2ACT A;  4G54 A;  2AS8 A;  4YYQ A;  1F2A A;  3N4C A;  3BWK A;  3LXS A;  1CSB B;  1NB3 A;  3S3Q A;  3E1Z B;  1S4V A;  4A5U A;  2YJB A;  3KX1 A;  3IMA A;  3KW9 A;  3HHI A;  4IUM A;  1KFX L;  2P0R A;  2E03 A;  1FH0 A;  4XZX A;  1MIR A;  2BU3 A;  2NQA A;  4D8I A;  3BY4 A;  2HWK A;  4OVZ A;  1ICF A;  3GCB A;  3BCN A;  3NHE A;  3KKU A;  2AGA A;  6PAD A;  5CVM A;  2DJG B;  2DCD A;  3K9M A;  4I07 A;  1PPP A;  1U5I A;  3HHA A;  3PBH A;  1PXV A;  1BP4 A;  4MSX A;  5JA7 A;  3W30 A;  2HXZ A;  2FYE A;  2OUL A;  1MEM A;  4M0W A;  4BOP A;  5JZE A;  4FK5 A;  3IHP A;  3OF9 A;  4ZUX U;  1PPD A;  3K8U A;  2R9F A;  1AIM A;  3WXG A;  1MEG A;  1EWP A;  1NL6 A;  1IWD A;  4D8E A;  1YK7 A;  4XR7 A;  4X6H A;  2DCB A;  3BBA A;  2R9M A;  4BPV A;  2P86 A;  4RF1 A;  5FPW A;  2PNS A;  3AI8 A;  4QRG A;  1BQI A;  1Y4H A;  4YVA A;  2AU1 A;  2E01 A;  3KWZ A;  4W5B A;  1K3B B;  4MI7 A;  2FE8 A;  4YYW A;  2J7Q A;  2NQG A;  1PAD A;  1AU3 A;  2R9C A;  1PCI A;  4N4Z A;  3MTV A;  1YK8 A;  4X6I A;  4WUR A;  4CDE B;  1AYW A;  2XU3 A;  1NQC A;  4XUI A;  2HHN A;  3MHS A;  3CBK A;  4FJC A;  3E9S A;  2FQ9 A;  5EF4 A;  3P5V A;  3RVX A;  4REZ A;  4DMY A;  2PAD A;  2F7D A;  2O6X A;  4ZTB A;  1M6D A;  3MP2 A;  2OP3 A;  2IBI A;  3BOW A;  5KO3 A;  1EWL A;  4RF0 A;  4DMX A;  2DOS A;  4Q8G A;  3PW3 A;  2WBF X;  4BS5 A;  5J94 A;  3WXE A;  1VSN A;  2Y6E A;  4YYV A;  3O1G A;  5CVO B;  2JTC A;  4BOQ A;  3PNR A;  3CBJ A;  4BOS A;  5JH3 A;  4AXM A;  1KFU L;  3BC3 A;  5PAD A;  3TRK A;  3V6E A;  1DF0 A;  4QBB A;  2R9N A;  1X9Y A;  2YJC A;  2XU1 A;  2DCA A;  3DF0 A;  4QRV A;  1CTE A;  2Y5B A;  3U8E A;  2XU4 A;  4I05 A;  4PT5 A;  1YVB A;  3IEJ A;  3IFU A;  2PRE A;  1KHP A;  3WXF A;  2DCC A;  1PVJ A;  1AU0 A;  2P7U A;  3OQC A;  1CS8 A;  1EWO A;  1GEC E;  1AU2 A;  3PHU A;  3PDF A;  2E02 A;  3LFY A;  3PSE A;  1U9Q X;  2AVW A;  1TL9 A;  3PRM A;  2DC8 A;  1PE6 A;  4OVZ B;  1PPO A;  4BSQ A;  4W4U A;  1YAL A;  3BPF A;  2DC6 A;  1UKF A;  1VJV A;  1TU6 A;  3B79 A;  3HD3 A;  4R3D A;  1JQP A;  2AYO A;  1HUC B;  4CDC B;  2J7Q C;  2R9O A;  2F1G A;  1QDQ A;  5F02 A;  4CDD B;  3V6C A;  3BB7 A;  1QMY A;  3ZUA A;  3O65 A;  4YYR A;  1CV8 A;  4RKX A;  1CPJ A;  1Q6K A;  1ITO A;  2DZZ A;  2R6N A;  3QJ3 A;  2VHF A;  2CIO A;  4OEL A;  3ERV A;  4N8W A;  4BOU A;  1SNK A;  1PPN A;  1EF7 A;  1QOL A;  5K16 A;  1ME4 A;  2PBH A;  4P16 A;  3H8B A;  2AUX A;  2FRQ A;  4I04 A;  2B1N A;  4YYS A;  2YJ8 A;  3N3G A;  2ARY A;  1MHW A;  2NQD B;  1BY8 A;  3PRP A;  4MM3 B;  4W5C A;  3K24 A;  3M99 A;  1GCB A;  3OIS A;  4PI3 A;  3S3R A;  5EGW A;  2FO5 A;  4P6G A;  2HD5 A;  5CHT A;  1XKG A;  4GUA A;  3H6S A;  1EWM A;  4RNA A;  2FT2 A;  3PT2 A;  3QSD A;  1QXP A;  3RVW A;  2B1M A;  1NPZ A;  3USV A;  9PAP A;  4PAD A;  2JQG R;  4N79 A;  3CH2 X;  2DC7 A;  3OVZ A;  3RVV A;  4Q8H A;  2UZJ A;  1PBH A;  3PHW A;  1POP A;  2AYN A;  4HXD B;  1KHQ A;  1ZIV A;  2YJ9 A;  3N3K A;  4K7C A;  4IP3 A;  2G8E A;  5E6J A;  2DC9 A;  1CJL A;  1THE A;  2AIM A;  2Z84 A;  4CDF B;  3MTN A;  2E00 A;  2GHU A;  5EZQ A;  2BDL A;  4P6E A;  3KSE A;  2VHS A;  3B21 A;  1F29 A;  2H7J A;  1O0E A;  2YJ2 A;  3KFQ A;  3H7D A;  3RNV A;  1AU4 A;  3F75 A;  1BGO A;  5A24 A;  4HWY A;  1MS6 A;  1ATK A;  4BOZ A;  4QRX A;  3W31 A;  2C0Y A;  3OF8 A;  4PP2 E;  3ZNH A;  1GLO A;  4MZO A;  3QT4 A;  3IOQ A;  2ATO A;  4QH6 A;  3C0R A;  3O0U A;  2GFO A;  1PIP A;  3PHX A;  3H8C A;  4OEM A;  5CHV A;  3IUT A;  3TNX A;  3MHH A;  1U9V A;  3I06 A;  2JQF R;  1ME3 A;  1ZCM A;  1U9W A;  1NB5 A;  3F5V A;  7PCK A; 
#chains in the Genus database with same CATH homology
 4NV7 A;  1SP4 B;  3I3T A;  2FUD A;  1CQD A;  4WA6 A;  1DEU A;  4MZS A;  4FIP A;  1YT7 A;  1U9X A;  3MOR A;  1KXR A;  3BPM A;  2G7Y A;  1AYV A;  2CB5 A;  4KLB A;  4YV8 A;  3P5X A;  3IV2 A;  2NQI A;  1AYU A;  4YYU A;  1NLJ A;  1CB5 A;  1GX3 A;  3KWB X;  1MDW A;  2AUZ A;  2FTD A;  2G6D A;  1TLO A;  2BDZ A;  1AEC A;  2HH5 A;  2DJF B;  4BGF A;  3CH3 X;  1F2B A;  3C9E A;  3D6S A;  3HWN A;  3P5W A;  3P5U A;  4BS6 A;  4PP1 A;  1CVZ A;  8PCH A;  2G8J A;  2VFB A;  2DZY A;  2XU5 A;  1A6R A;  3OVX A;  4CZW A;  1F2C A;  1STF E;  2FRA A;  2IPP B;  4BQV A;  4RY2 A;  1Y08 A;  4X6J A;  3H89 A;  2OZ2 A;  1GMY A;  5CVN B;  4AXL A;  2ACT A;  4G54 A;  2AS8 A;  4YYQ A;  1F2A A;  3N4C A;  3BWK A;  3LXS A;  1CSB B;  1NB3 A;  3S3Q A;  3E1Z B;  1S4V A;  2YJB A;  3KX1 A;  3IMA A;  3KW9 A;  3HHI A;  1KFX L;  2P0R A;  2E03 A;  1FH0 A;  1MIR A;  2NQA A;  1ICF A;  3GCB A;  3BCN A;  3NHE A;  3KKU A;  6PAD A;  5CVM A;  2DJG B;  2DCD A;  3K9M A;  4I07 A;  1PPP A;  1U5I A;  3HHA A;  3PBH A;  4GUZ A;  1PXV A;  1BP4 A;  4MSX A;  5JA7 A;  2HXZ A;  2FYE A;  2OUL A;  1MEM A;  4FK5 A;  3IHP A;  3OF9 A;  4ZUX U;  1PPD A;  3K8U A;  2R9F A;  1AIM A;  3WXG A;  1NL6 A;  1EWP A;  1MEG A;  1IWD A;  1YK7 A;  4XR7 A;  4X6H A;  2DCB A;  2R9M A;  4BPV A;  2P86 A;  5FPW A;  2PNS A;  3AI8 A;  4QRG A;  1BQI A;  1Y4H A;  4YVA A;  2AU1 A;  2E01 A;  3KWZ A;  4W5B A;  1W5R A;  1K3B B;  4YYW A;  2NQG A;  1PAD A;  1AU3 A;  2R9C A;  1PCI A;  4N4Z A;  1E2T A;  1YK8 A;  4X6I A;  4CDE B;  1AYW A;  2XU3 A;  1NQC A;  4XUI A;  2HHN A;  3MHS A;  3CBK A;  4FJC A;  2FQ9 A;  5EF4 A;  3P5V A;  3RVX A;  4DMY A;  2PAD A;  2F7D A;  2O6X A;  1M6D A;  2OP3 A;  2IBI A;  3BOW A;  1EWL A;  4DMX A;  4Q8G A;  3PW3 A;  2WBF X;  4BS5 A;  5J94 A;  3WXE A;  1VSN A;  2Y6E A;  4YYV A;  3O1G A;  5CVO B;  3PNR A;  3CBJ A;  5JH3 A;  4AXM A;  1KFU L;  3BC3 A;  5PAD A;  3V6E A;  1DF0 A;  4QBB A;  4NV8 A;  2R9N A;  1X9Y A;  2YJC A;  2XU1 A;  2DCA A;  3DF0 A;  4QRV A;  1CTE A;  2Y5B A;  3U8E A;  2XU4 A;  4I05 A;  2VFC A;  1YVB A;  3IEJ A;  3WXF A;  2PRE A;  1KHP A;  2DCC A;  1AU0 A;  2P7U A;  1CS8 A;  1EWO A;  1GEC E;  1AU2 A;  3PDF A;  2E02 A;  3LFY A;  1U9Q X;  2AVW A;  2BSZ A;  1TL9 A;  2DC8 A;  1PE6 A;  1PPO A;  4BSQ A;  4W4U A;  1YAL A;  3BPF A;  2DC6 A;  1VJV A;  1TU6 A;  3B79 A;  3HD3 A;  1JQP A;  2AYO A;  1HUC B;  4CDC B;  2R9O A;  2F1G A;  1QDQ A;  5F02 A;  4CDD B;  3V6C A;  1QMY A;  3ZUA A;  4YYR A;  1CV8 A;  1CPJ A;  1Q6K A;  1ITO A;  2DZZ A;  2R6N A;  3QJ3 A;  2VHF A;  4B55 A;  2CIO A;  4OEL A;  3ERV A;  4N8W A;  1SNK A;  1PPN A;  1EF7 A;  1QOL A;  5K16 A;  1ME4 A;  2PBH A;  3H8B A;  2AUX A;  1W4T A;  2FRQ A;  4I04 A;  2B1N A;  4YYS A;  2YJ8 A;  3N3G A;  2ARY A;  1MHW A;  2NQD B;  1BY8 A;  4W5C A;  1W6F A;  3K24 A;  3M99 A;  1GCB A;  3OIS A;  4PI3 A;  3S3R A;  5EGW A;  2FO5 A;  4P6G A;  2HD5 A;  5CHT A;  1XKG A;  3H6S A;  1EWM A;  2FT2 A;  3QSD A;  1QXP A;  3RVW A;  2B1M A;  1NPZ A;  3USV A;  9PAP A;  4PAD A;  2JQG R;  4N79 A;  3CH2 X;  2DC7 A;  3OVZ A;  3RVV A;  4Q8H A;  1PBH A;  1POP A;  2AYN A;  1KHQ A;  1ZIV A;  2YJ9 A;  3N3K A;  4K7C A;  2G8E A;  2DC9 A;  1CJL A;  1THE A;  2AIM A;  4CDF B;  3MTN A;  2E00 A;  2GHU A;  2BDL A;  4P6E A;  3KSE A;  2VHS A;  4C5P A;  1F29 A;  2H7J A;  1O0E A;  2YJ2 A;  3KFQ A;  3H7D A;  1AU4 A;  3F75 A;  1BGO A;  5A24 A;  4HWY A;  1MS6 A;  1ATK A;  3D9W A;  3LTW A;  4QRX A;  2C0Y A;  3OF8 A;  4PP2 E;  1GLO A;  4MZO A;  3QT4 A;  3IOQ A;  2ATO A;  4QH6 A;  3O0U A;  2GFO A;  1PIP A;  3H8C A;  4OEM A;  5CHV A;  3IUT A;  3TNX A;  3MHH A;  1U9V A;  3I06 A;  2JQF R;  1ME3 A;  1ZCM A;  1U9W A;  1NB5 A;  3F5V A;  7PCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...