4BQVA

Mouse cathepsin s with covalent ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bqvA00
2AYNA 3RVVA 1PPDA 1XKGA 3GCBA 3OVXA 2DJFB 3AI8A 1F29A 1KFUL 2R9NA 3WXGA 1ITOA 3ZUAA 2AYOA 2XU1A 3DF0A 1CSBB 1TU6A 1THEA 1U9VA 3PNRA 4MZOA 3IHPA 2NQGA 4N79A 1QXPA 1ME4A 5J94A 5PADA 2OP3A 2P7UA 1CS8A 3V6EA 2HH5A 2CB5A 1SNKA 4YV8A 1VJVA 3P5WA 4BS6A 3F75A 4MSXA 2E02A 3TNXA 3RVWA 1CPJA 1PPOA 4BPVA 1YK7A 4Q8GA 5CHVA 4CDEB 3F5VA 1PIPA 5JA7A 2ACTA 1AYVA 1IWDA 2PREA 3M99A 3OF9A 1YK8A 1AYUA 1ICFA 1STFE 3LXSA 3ERVA 2XU5A 2Y5BA 1ZCMA 4MZSA 1CV8A 3K9MA 3PDFA 3BOWA 4P6EA 4AXMA 3RVXA 1F2BA 2FYEA 2GFOA 3PBHA 5EF4A 2R9FA 2XU3A 3IV2A 2DCAA 4ZUXU 5CVMA 2WBFX 4YYQA 1SP4B 8PCHA 1Y08A 2G6DA 2DC7A 3K8UA 4P6GA 5JH3A 1EWLA 1F2CA 1ZIVA 1EWMA 3WXFA 2P0RA 2JQGR 3KX1A 2G8JA 1PPPA 4KLBA 3O0UA 1M6DA 4PI3A 3H8BA 3P5UA 2YJBA 2NQDB 2YJ9A 2BDZA 3P5XA 4PADA 4AXLA 2F7DA 1AECA 3OISA 1DEUA 4YYUA 2ARYA 1U9WA 2DZZA 2YJ2A 1AU4A 3P5VA 1O0EA 3KWBX 2FTDA 1X9YA 2AUZA 1NB3A 1VSNA 2DCBA 4G54A 2DCDA 3LFYA 1TLOA 2AUXA 2Y6EA 1CVZA 5CVOB 3IEJA 3C9EA 1CJLA 2AS8A 4QRGA 1YT7A 3H7DA 1K3BB 2FO5A 3CBKA 2E01A 4FIPA 1Q6KA 4I04A 4W5BA 4W5CA 2C0YA 4QRVA 4YYWA 2ATOA 4CDDB 2AVWA 2PADA 4WA6A 1PBHA 2AIMA 1NPZA 2FUDA 4YYSA 2YJ8A 3N3GA 4OELA 4BSQA 1KHQA 1ME3A 4CZWA 2R9OA 3MHHA 5EGWA 1AYWA 4I05A 1BP4A 3BC3A 4XUIA 4CDFB 3IUTA 3HHAA 1TL9A 1PCIA 1EWPA 5A24A 4N8WA 1GLOA 3IMAA 3KW9A 1BQIA 4BQVA 1AU2A 3MORA 4OEMA 2JQFR 4QH6A 2FT2A 2HD5A 1Y4HA 2G8EA 5F02A 3OVZA 3CH2X 4BS5A 1PPNA 1KFXL 1MS6A 5CHTA 2AU1A 3QJ3A 5CVNB 1NB5A 1POPA 3MTNA 3N4CA 1BY8A 1AU3A 3QSDA 1MDWA 2PNSA 4W4UA 4FJCA 5K16A 3B79A 3MHSA 5FPWA 4K7CA 1MEGA 3USVA 3KKUA 9PAPA 2IPPB 2DC8A 4CDCB 1U5IA 3QT4A 3S3QA 1MEMA 2HHNA 1U9XA 3HHIA 6PADA 4FK5A 1CB5A 3N3KA 1U9QX 2E00A 1MIRA 2DC6A 2XU4A 3OF8A 1MHWA 4HWYA 1KXRA 1YALA 1GECE 7PCKA 2E03A 3KWZA 2FQ9A 4PP2E 3IOQA 2IBIA 2OZ2A 3HD3A 1AIMA 3D6SA 3KSEA 3CH3X 4X6IA 1JQPA 3E1ZB 2F1GA 2FRQA 4PP1A 3BWKA 3CBJA 4X6JA 2VHSA 1EF7A 1HUCB 3H6SA 2CIOA 2NQAA 2P86A 2H7JA 1PADA 1A6RA 1DF0A 3BPFA 2YJCA 1S4VA 4XR7A 2VHFA 2GHUA 4DMXA 2G7YA 2OULA 4YYVA 2DZYA 2O6XA 1AU0A 4YYRA 3HWNA 3BPMA 1YVBA 2R9CA 1F2AA 2NQIA 4QBBA 1GMYA 4Q8HA 3PW3A 1NLJA 3I06A 3H8CA 1PE6A 1NQCA 2FRAA 1QMYA 1GCBA 4QRXA 3V6CA 2DJGB 1QDQA 4DMYA 1QOLA 3H89A 3U8EA 3I3TA 3NHEA 1CQDA 1KHPA 1EWOA 2DCCA 4YVAA 2R6NA 2DC9A 3K24A 1PXVA 2B1MA 4RY2A 4X6HA 1FH0A 1CTEA 2PBHA 1NL6A 3O1GA 3S3RA 2R9MA 1ATKA 3WXEA 1BGOA 2BDLA 3KFQA 4I07A 2HXZA 3BCNA 2B1NA 4N4ZA
chains in the Genus database with same CATH superfamily
2AYNA 3RVVA 1PPDA 1XKGA 3GCBA 3OVXA 2DJFB 1UKFA 3AI8A 1F29A 5E6JA 1KFUL 3PSEA 2R9NA 2AGAA 3WXGA 1ITOA 3ZUAA 2AYOA 2XU1A 3DF0A 1CSBB 1TU6A 3TRKA 1THEA 1U9VA 4RF0A 3PNRA 4MZOA 3MJ5A 3IHPA 2NQGA 4N79A 1QXPA 1ME4A 5J94A 5PADA 2OP3A 2P7UA 2J7QA 1CS8A 3V6EA 2HH5A 2CB5A 1SNKA 4YV8A 1VJVA 3P5WA 4BS6A 3F75A 4MSXA 2E02A 1DKIA 3TNXA 3RVWA 1CPJA 1PPOA 4BPVA 1YK7A 4Q8GA 5CHVA 4CDEB 3F5VA 1PIPA 5JA7A 2ACTA 1AYVA 1IWDA 2PREA 3M99A 3OF9A 1YK8A 1AYUA 1ICFA 1STFE 3LXSA 3ERVA 4RNAA 2XU5A 2Y5BA 1ZCMA 4MZSA 1CV8A 3PDFA 3K9MA 3BOWA 4P6EA 4AXMA 3RVXA 1F2BA 2FYEA 3PHXA 2GFOA 3PBHA 5EF4A 2R9FA 4GUAA 2XU3A 3IV2A 2DCAA 4ZUXU 5CVMA 5EZSA 1YZBA 2WBFX 3ZNHA 4OW0A 4YYQA 1SP4B 8PCHA 1Y08A 4IUMA 2G6DA 2DC7A 3K8UA 4P6GA 3W30A 5JH3A 1EWLA 1F2CA 1ZIVA 1EWMA 3WXFA 2P0RA 3IFUA 2JQGR 3KX1A 2G8JA 1PPPA 3PHWA 3O0UA 4KLBA 1M6DA 4PI3A 3H8BA 3P5UA 4RKXA 2YJBA 2NQDB 2YJ9A 2BDZA 3P5XA 4PADA 4D8IA 4AXLA 2F7DA 1AECA 3BBAA 3OISA 1DEUA 4YYUA 2ARYA 1U9WA 2DZZA 2YJ2A 4R3DA 4A5UA 5JZEA 1AU4A 3P5VA 1O0EA 3KWBX 2FTDA 1X9YA 2AUZA 1NB3A 1VSNA 3C0RA 2DCBA 4BOPA 4G54A 2DCDA 4D8BA 3LFYA 1TLOA 2AUXA 2Y6EA 1CVZA 5CVOB 3IEJA 3C9EA 2JTCA 1CJLA 3W31A 2AS8A 4QRGA 1YT7A 4MI7A 3H7DA 1K3BB 2FO5A 3CBKA 3B21A 2E01A 4FIPA 1Q6KA 4D8EA 4I04A 4W5BA 4W5CA 2C0YA 4QRVA 4M0WA 4YYWA 2ATOA 4CDDB 2AVWA 3MTVA 2PADA 3O65A 4WA6A 1PBHA 2AIMA 1NPZA 2FUDA 4YYSA 2YJ8A 3N3GA 4OELA 4BSQA 1KHQA 1ME3A 4CZWA 2R9OA 3MHHA 4BOSA 5EGWA 1AYWA 4I05A 4REZA 1BP4A 3BC3A 4XUIA 4CDFB 3IUTA 3HHAA 1TL9A 1PCIA 1EWPA 5A24A 4N8WA 1GLOA 3IMAA 3KW9A 1BQIA 4BQVA 1AU2A 3MORA 4OVZA 4OEMA 2JQFR 4QH6A 2BTWB 2FT2A 2HD5A 1Y4HA 4RF1A 2G8EA 3RNVA 5F02A 3PRPA 3OVZA 3CH2X 4BS5A 1PPNA 1KFXL 1MS6A 5CHTA 2AU1A 3QJ3A 5CVNB 1NB5A 1POPA 3MTNA 5EZQA 3N4CA 3MP2A 2HWKA 2J7QC 1BY8A 1AU3A 3QSDA 1MDWA 2PNSA 5KO3A 4W4UA 4FJCA 5K16A 4XZXA 3B79A 3MHSA 5FPWA 4K7CA 1MEGA 3USVA 3KKUA 9PAPA 2UZJA 2FE8A 2IPPB 2DC8A 4CDCB 1U5IA 2JRIA 3QT4A 3S3QA 1MEMA 2HHNA 1U9XA 3HHIA 6PADA 4FK5A 1CB5A 3N3KA 1U9QX 2E00A 1MIRA 2DC6A 4HXDB 2XU4A 3OF8A 4P16A 1MHWA 4HWYA 4BOZA 1KXRA 1YALA 1GECE 7PCKA 2E03A 4OVZB 4ZTBA 3KWZA 2FQ9A 4PP2E 3IOQA 2IBIA 2OZ2A 3PT2A 3HD3A 1AIMA 3D6SA 4WURA 3KSEA 3CH3X 4X6IA 1JQPA 3E1ZB 2F1GA 2FRQA 4PT5A 4PP1A 3BWKA 3CBJA 4X6JA 2VHSA 1EF7A 1HUCB 3H6SA 3BB7A 2Z84A 2CIOA 2NQAA 2P86A 2H7JA 1PADA 1A6RA 1DF0A 2BTWA 3BPFA 2YJCA 1S4VA 4XR7A 2VHFA 2GHUA 4DMXA 2G7YA 2OULA 4YYVA 2DZYA 3PRMA 2O6XA 1AU0A 4YYRA 3HWNA 3BPMA 1PVJA 1YVBA 2R9CA 3BY4A 1F2AA 2BU3A 2NQIA 4QBBA 1GMYA 4Q8HA 3PW3A 1NLJA 3I06A 3H8CA 1PE6A 3PHUA 1NQCA 2FRAA 1QMYA 1GCBA 4QRXA 3V6CA 2DJGB 3TMPA 1QDQA 4DMYA 1QOLA 3H89A 3U8EA 3E9SA 3I3TA 3NHEA 1CQDA 1KHPA 1EWOA 2DCCA 4YVAA 2R6NA 2DC9A 2DOSA 1PXVA 3K24A 2B1MA 4MM3B 4RY2A 4X6HA 1FH0A 1CTEA 2PBHA 3OQCA 1NL6A 3O1GA 3S3RA 2R9MA 4BOQA 1ATKA 4IP3A 3WXEA 4BOUA 1BGOA 2BDLA 3KFQA 4I07A 2HXZA 3BCNA 2B1NA 4N4ZA
chains in the Genus database with same CATH topology
2AYNA 3RVVA 1PPDA 1XKGA 3GCBA 3OVXA 2DJFB 3AI8A 1F29A 1KFUL 2R9NA 3WXGA 1ITOA 3ZUAA 2AYOA 2XU1A 3D9WA 3DF0A 1CSBB 1TU6A 1THEA 1U9VA 3PNRA 4MZOA 3IHPA 2NQGA 4N79A 1QXPA 1ME4A 5J94A 5PADA 1GX3A 2OP3A 2P7UA 1CS8A 3V6EA 2HH5A 2CB5A 1SNKA 4YV8A 1VJVA 3P5WA 4BS6A 3F75A 4MSXA 2E02A 3TNXA 3RVWA 1CPJA 1PPOA 4BPVA 1YK7A 4Q8GA 5CHVA 4CDEB 3F5VA 1PIPA 5JA7A 2ACTA 1AYVA 1IWDA 2PREA 3M99A 3OF9A 1YK8A 1AYUA 1ICFA 1STFE 3LXSA 3ERVA 2XU5A 2Y5BA 1ZCMA 4MZSA 1CV8A 3K9MA 3PDFA 3BOWA 4P6EA 4NV7A 4AXMA 3RVXA 1F2BA 2FYEA 2GFOA 3PBHA 5EF4A 2R9FA 2XU3A 3IV2A 2DCAA 4ZUXU 5CVMA 1E2TA 2WBFX 4YYQA 1SP4B 8PCHA 1Y08A 2G6DA 2DC7A 3K8UA 4P6GA 5JH3A 1EWLA 1F2CA 1ZIVA 1EWMA 4GUZA 3WXFA 2P0RA 2JQGR 1W6FA 3KX1A 2G8JA 1PPPA 4KLBA 3O0UA 1M6DA 4PI3A 3H8BA 3P5UA 2YJBA 2NQDB 2YJ9A 2BDZA 3P5XA 4PADA 4AXLA 2F7DA 1AECA 3OISA 1DEUA 4YYUA 2ARYA 1U9WA 2DZZA 2YJ2A 1AU4A 3P5VA 1O0EA 3KWBX 2FTDA 1X9YA 2AUZA 1NB3A 1VSNA 2DCBA 3LTWA 4G54A 2DCDA 3LFYA 1TLOA 2AUXA 2Y6EA 1CVZA 5CVOB 3IEJA 3C9EA 2BSZA 1CJLA 2AS8A 4QRGA 1YT7A 3H7DA 1K3BB 2FO5A 3CBKA 2E01A 4FIPA 1Q6KA 1W5RA 4I04A 4W5BA 4W5CA 2C0YA 4QRVA 4YYWA 2ATOA 4CDDB 2AVWA 2PADA 4WA6A 1PBHA 2AIMA 1NPZA 2FUDA 4YYSA 2YJ8A 3N3GA 4OELA 4BSQA 1KHQA 1ME3A 4CZWA 2R9OA 3MHHA 5EGWA 1AYWA 4I05A 1BP4A 4BGFA 3BC3A 4XUIA 4CDFB 3IUTA 3HHAA 1TL9A 1PCIA 1EWPA 5A24A 4N8WA 1GLOA 3IMAA 3KW9A 1BQIA 4BQVA 1AU2A 3MORA 4OEMA 2JQFR 4QH6A 2FT2A 2HD5A 1Y4HA 2G8EA 5F02A 3OVZA 3CH2X 4BS5A 1PPNA 1KFXL 1MS6A 5CHTA 2AU1A 3QJ3A 5CVNB 1NB5A 1POPA 3MTNA 3N4CA 1BY8A 1AU3A 3QSDA 1MDWA 2PNSA 4W4UA 4FJCA 5K16A 3B79A 3MHSA 5FPWA 4K7CA 1MEGA 3USVA 3KKUA 9PAPA 2IPPB 2DC8A 4CDCB 1U5IA 3QT4A 3S3QA 1MEMA 2HHNA 1U9XA 3HHIA 6PADA 4FK5A 1CB5A 3N3KA 1U9QX 2E00A 1MIRA 2DC6A 2XU4A 3OF8A 1MHWA 4HWYA 1W4TA 1KXRA 1YALA 1GECE 7PCKA 2E03A 3KWZA 2FQ9A 4PP2E 3IOQA 2IBIA 2OZ2A 3HD3A 1AIMA 3D6SA 4NV8A 3KSEA 3CH3X 4X6IA 1JQPA 3E1ZB 2F1GA 2FRQA 4PP1A 3BWKA 3CBJA 4X6JA 2VHSA 1EF7A 1HUCB 3H6SA 2CIOA 2NQAA 2P86A 2H7JA 1PADA 1A6RA 1DF0A 3BPFA 2YJCA 1S4VA 4XR7A 2VHFA 2GHUA 4DMXA 4B55A 2G7YA 2OULA 4YYVA 2VFBA 2DZYA 2O6XA 1AU0A 4YYRA 3HWNA 3BPMA 1YVBA 2R9CA 1F2AA 2NQIA 4QBBA 1GMYA 4C5PA 4Q8HA 3PW3A 1NLJA 3I06A 3H8CA 1PE6A 1NQCA 2FRAA 1QMYA 1GCBA 4QRXA 3V6CA 2DJGB 1QDQA 4DMYA 1QOLA 2VFCA 3H89A 3U8EA 3I3TA 3NHEA 1CQDA 1KHPA 1EWOA 2DCCA 4YVAA 2R6NA 2DC9A 3K24A 1PXVA 2B1MA 4RY2A 4X6HA 1FH0A 1CTEA 2PBHA 1NL6A 3O1GA 3S3RA 2R9MA 1ATKA 3WXEA 1BGOA 2BDLA 3KFQA 4I07A 2HXZA 3BCNA 2B1NA 4N4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYN A;  3RVV A;  1PPD A;  1XKG A;  3GCB A;  3OVX A;  2DJF B;  3AI8 A;  1F29 A;  1KFU L;  2R9N A;  3WXG A;  1ITO A;  3ZUA A;  2AYO A;  2XU1 A;  3DF0 A;  1CSB B;  1TU6 A;  1THE A;  1U9V A;  3PNR A;  4MZO A;  3IHP A;  2NQG A;  4N79 A;  1QXP A;  1ME4 A;  5J94 A;  5PAD A;  2OP3 A;  2P7U A;  1CS8 A;  3V6E A;  2HH5 A;  2CB5 A;  1SNK A;  4YV8 A;  1VJV A;  3P5W A;  4BS6 A;  3F75 A;  4MSX A;  2E02 A;  3TNX A;  3RVW A;  1CPJ A;  1PPO A;  4BPV A;  1YK7 A;  4Q8G A;  5CHV A;  4CDE B;  3F5V A;  1PIP A;  5JA7 A;  2ACT A;  1AYV A;  1IWD A;  2PRE A;  3M99 A;  3OF9 A;  1YK8 A;  1AYU A;  1ICF A;  1STF E;  3LXS A;  3ERV A;  2XU5 A;  2Y5B A;  1ZCM A;  4MZS A;  1CV8 A;  3K9M A;  3PDF A;  3BOW A;  4P6E A;  4AXM A;  3RVX A;  1F2B A;  2FYE A;  2GFO A;  3PBH A;  5EF4 A;  2R9F A;  2XU3 A;  3IV2 A;  2DCA A;  4ZUX U;  5CVM A;  2WBF X;  4YYQ A;  1SP4 B;  8PCH A;  1Y08 A;  2G6D A;  2DC7 A;  3K8U A;  4P6G A;  5JH3 A;  1EWL A;  1F2C A;  1ZIV A;  1EWM A;  3WXF A;  2P0R A;  2JQG R;  3KX1 A;  2G8J A;  1PPP A;  4KLB A;  3O0U A;  1M6D A;  4PI3 A;  3H8B A;  3P5U A;  2YJB A;  2NQD B;  2YJ9 A;  2BDZ A;  3P5X A;  4PAD A;  4AXL A;  2F7D A;  1AEC A;  3OIS A;  1DEU A;  4YYU A;  2ARY A;  1U9W A;  2DZZ A;  2YJ2 A;  1AU4 A;  3P5V A;  1O0E A;  3KWB X;  2FTD A;  1X9Y A;  2AUZ A;  1NB3 A;  1VSN A;  2DCB A;  4G54 A;  2DCD A;  3LFY A;  1TLO A;  2AUX A;  2Y6E A;  1CVZ A;  5CVO B;  3IEJ A;  3C9E A;  1CJL A;  2AS8 A;  4QRG A;  1YT7 A;  3H7D A;  1K3B B;  2FO5 A;  3CBK A;  2E01 A;  4FIP A;  1Q6K A;  4I04 A;  4W5B A;  4W5C A;  2C0Y A;  4QRV A;  4YYW A;  2ATO A;  4CDD B;  2AVW A;  2PAD A;  4WA6 A;  1PBH A;  2AIM A;  1NPZ A;  2FUD A;  4YYS A;  2YJ8 A;  3N3G A;  4OEL A;  4BSQ A;  1KHQ A;  1ME3 A;  4CZW A;  2R9O A;  3MHH A;  5EGW A;  1AYW A;  4I05 A;  1BP4 A;  3BC3 A;  4XUI A;  4CDF B;  3IUT A;  3HHA A;  1TL9 A;  1PCI A;  1EWP A;  5A24 A;  4N8W A;  1GLO A;  3IMA A;  3KW9 A;  1BQI A;  4BQV A;  1AU2 A;  3MOR A;  4OEM A;  2JQF R;  4QH6 A;  2FT2 A;  2HD5 A;  1Y4H A;  2G8E A;  5F02 A;  3OVZ A;  3CH2 X;  4BS5 A;  1PPN A;  1KFX L;  1MS6 A;  5CHT A;  2AU1 A;  3QJ3 A;  5CVN B;  1NB5 A;  1POP A;  3MTN A;  3N4C A;  1BY8 A;  1AU3 A;  3QSD A;  1MDW A;  2PNS A;  4W4U A;  4FJC A;  5K16 A;  3B79 A;  3MHS A;  5FPW A;  4K7C A;  1MEG A;  3USV A;  3KKU A;  9PAP A;  2IPP B;  2DC8 A;  4CDC B;  1U5I A;  3QT4 A;  3S3Q A;  1MEM A;  2HHN A;  1U9X A;  3HHI A;  6PAD A;  4FK5 A;  1CB5 A;  3N3K A;  1U9Q X;  2E00 A;  1MIR A;  2DC6 A;  2XU4 A;  3OF8 A;  1MHW A;  4HWY A;  1KXR A;  1YAL A;  1GEC E;  7PCK A;  2E03 A;  3KWZ A;  2FQ9 A;  4PP2 E;  3IOQ A;  2IBI A;  2OZ2 A;  3HD3 A;  1AIM A;  3D6S A;  3KSE A;  3CH3 X;  4X6I A;  1JQP A;  3E1Z B;  2F1G A;  2FRQ A;  4PP1 A;  3BWK A;  3CBJ A;  4X6J A;  2VHS A;  1EF7 A;  1HUC B;  3H6S A;  2CIO A;  2NQA A;  2P86 A;  2H7J A;  1PAD A;  1A6R A;  1DF0 A;  3BPF A;  2YJC A;  1S4V A;  4XR7 A;  2VHF A;  2GHU A;  4DMX A;  2G7Y A;  2OUL A;  4YYV A;  2DZY A;  2O6X A;  1AU0 A;  4YYR A;  3HWN A;  3BPM A;  1YVB A;  2R9C A;  1F2A A;  2NQI A;  4QBB A;  1GMY A;  4Q8H A;  3PW3 A;  1NLJ A;  3I06 A;  3H8C A;  1PE6 A;  1NQC A;  2FRA A;  1QMY A;  1GCB A;  4QRX A;  3V6C A;  2DJG B;  1QDQ A;  4DMY A;  1QOL A;  3H89 A;  3U8E A;  3I3T A;  3NHE A;  1CQD A;  1KHP A;  1EWO A;  2DCC A;  4YVA A;  2R6N A;  2DC9 A;  3K24 A;  1PXV A;  2B1M A;  4RY2 A;  4X6H A;  1FH0 A;  1CTE A;  2PBH A;  1NL6 A;  3O1G A;  3S3R A;  2R9M A;  1ATK A;  3WXE A;  1BGO A;  2BDL A;  3KFQ A;  4I07 A;  2HXZ A;  3BCN A;  2B1N A;  4N4Z A; 
#chains in the Genus database with same CATH topology
 2AYN A;  3RVV A;  1PPD A;  1XKG A;  3GCB A;  3OVX A;  2DJF B;  1UKF A;  3AI8 A;  1F29 A;  5E6J A;  1KFU L;  3PSE A;  2R9N A;  2AGA A;  3WXG A;  1ITO A;  3ZUA A;  2AYO A;  2XU1 A;  3DF0 A;  1CSB B;  1TU6 A;  3TRK A;  1THE A;  1U9V A;  4RF0 A;  3PNR A;  4MZO A;  3MJ5 A;  3IHP A;  2NQG A;  4N79 A;  1QXP A;  1ME4 A;  5J94 A;  5PAD A;  2OP3 A;  2P7U A;  2J7Q A;  1CS8 A;  3V6E A;  2HH5 A;  2CB5 A;  1SNK A;  4YV8 A;  1VJV A;  3P5W A;  4BS6 A;  3F75 A;  4MSX A;  2E02 A;  1DKI A;  3TNX A;  3RVW A;  1CPJ A;  1PPO A;  4BPV A;  1YK7 A;  4Q8G A;  5CHV A;  4CDE B;  3F5V A;  1PIP A;  5JA7 A;  2ACT A;  1AYV A;  1IWD A;  2PRE A;  3M99 A;  3OF9 A;  1YK8 A;  1AYU A;  1ICF A;  1STF E;  3LXS A;  3ERV A;  4RNA A;  2XU5 A;  2Y5B A;  1ZCM A;  4MZS A;  1CV8 A;  3PDF A;  3K9M A;  3BOW A;  4P6E A;  4AXM A;  3RVX A;  1F2B A;  2FYE A;  3PHX A;  2GFO A;  3PBH A;  5EF4 A;  2R9F A;  4GUA A;  2XU3 A;  3IV2 A;  2DCA A;  4ZUX U;  5CVM A;  5EZS A;  1YZB A;  2WBF X;  3ZNH A;  4OW0 A;  4YYQ A;  1SP4 B;  8PCH A;  1Y08 A;  4IUM A;  2G6D A;  2DC7 A;  3K8U A;  4P6G A;  3W30 A;  5JH3 A;  1EWL A;  1F2C A;  1ZIV A;  1EWM A;  3WXF A;  2P0R A;  3IFU A;  2JQG R;  3KX1 A;  2G8J A;  1PPP A;  3PHW A;  3O0U A;  4KLB A;  1M6D A;  4PI3 A;  3H8B A;  3P5U A;  4RKX A;  2YJB A;  2NQD B;  2YJ9 A;  2BDZ A;  3P5X A;  4PAD A;  4D8I A;  4AXL A;  2F7D A;  1AEC A;  3BBA A;  3OIS A;  1DEU A;  4YYU A;  2ARY A;  1U9W A;  2DZZ A;  2YJ2 A;  4R3D A;  4A5U A;  5JZE A;  1AU4 A;  3P5V A;  1O0E A;  3KWB X;  2FTD A;  1X9Y A;  2AUZ A;  1NB3 A;  1VSN A;  3C0R A;  2DCB A;  4BOP A;  4G54 A;  2DCD A;  4D8B A;  3LFY A;  1TLO A;  2AUX A;  2Y6E A;  1CVZ A;  5CVO B;  3IEJ A;  3C9E A;  2JTC A;  1CJL A;  3W31 A;  2AS8 A;  4QRG A;  1YT7 A;  4MI7 A;  3H7D A;  1K3B B;  2FO5 A;  3CBK A;  3B21 A;  2E01 A;  4FIP A;  1Q6K A;  4D8E A;  4I04 A;  4W5B A;  4W5C A;  2C0Y A;  4QRV A;  4M0W A;  4YYW A;  2ATO A;  4CDD B;  2AVW A;  3MTV A;  2PAD A;  3O65 A;  4WA6 A;  1PBH A;  2AIM A;  1NPZ A;  2FUD A;  4YYS A;  2YJ8 A;  3N3G A;  4OEL A;  4BSQ A;  1KHQ A;  1ME3 A;  4CZW A;  2R9O A;  3MHH A;  4BOS A;  5EGW A;  1AYW A;  4I05 A;  4REZ A;  1BP4 A;  3BC3 A;  4XUI A;  4CDF B;  3IUT A;  3HHA A;  1TL9 A;  1PCI A;  1EWP A;  5A24 A;  4N8W A;  1GLO A;  3IMA A;  3KW9 A;  1BQI A;  4BQV A;  1AU2 A;  3MOR A;  4OVZ A;  4OEM A;  2JQF R;  4QH6 A;  2BTW B;  2FT2 A;  2HD5 A;  1Y4H A;  4RF1 A;  2G8E A;  3RNV A;  5F02 A;  3PRP A;  3OVZ A;  3CH2 X;  4BS5 A;  1PPN A;  1KFX L;  1MS6 A;  5CHT A;  2AU1 A;  3QJ3 A;  5CVN B;  1NB5 A;  1POP A;  3MTN A;  5EZQ A;  3N4C A;  3MP2 A;  2HWK A;  2J7Q C;  1BY8 A;  1AU3 A;  3QSD A;  1MDW A;  2PNS A;  5KO3 A;  4W4U A;  4FJC A;  5K16 A;  4XZX A;  3B79 A;  3MHS A;  5FPW A;  4K7C A;  1MEG A;  3USV A;  3KKU A;  9PAP A;  2UZJ A;  2FE8 A;  2IPP B;  2DC8 A;  4CDC B;  1U5I A;  2JRI A;  3QT4 A;  3S3Q A;  1MEM A;  2HHN A;  1U9X A;  3HHI A;  6PAD A;  4FK5 A;  1CB5 A;  3N3K A;  1U9Q X;  2E00 A;  1MIR A;  2DC6 A;  4HXD B;  2XU4 A;  3OF8 A;  4P16 A;  1MHW A;  4HWY A;  4BOZ A;  1KXR A;  1YAL A;  1GEC E;  7PCK A;  2E03 A;  4OVZ B;  4ZTB A;  3KWZ A;  2FQ9 A;  4PP2 E;  3IOQ A;  2IBI A;  2OZ2 A;  3PT2 A;  3HD3 A;  1AIM A;  3D6S A;  4WUR A;  3KSE A;  3CH3 X;  4X6I A;  1JQP A;  3E1Z B;  2F1G A;  2FRQ A;  4PT5 A;  4PP1 A;  3BWK A;  3CBJ A;  4X6J A;  2VHS A;  1EF7 A;  1HUC B;  3H6S A;  3BB7 A;  2Z84 A;  2CIO A;  2NQA A;  2P86 A;  2H7J A;  1PAD A;  1A6R A;  1DF0 A;  2BTW A;  3BPF A;  2YJC A;  1S4V A;  4XR7 A;  2VHF A;  2GHU A;  4DMX A;  2G7Y A;  2OUL A;  4YYV A;  2DZY A;  3PRM A;  2O6X A;  1AU0 A;  4YYR A;  3HWN A;  3BPM A;  1PVJ A;  1YVB A;  2R9C A;  3BY4 A;  1F2A A;  2BU3 A;  2NQI A;  4QBB A;  1GMY A;  4Q8H A;  3PW3 A;  1NLJ A;  3I06 A;  3H8C A;  1PE6 A;  3PHU A;  1NQC A;  2FRA A;  1QMY A;  1GCB A;  4QRX A;  3V6C A;  2DJG B;  3TMP A;  1QDQ A;  4DMY A;  1QOL A;  3H89 A;  3U8E A;  3E9S A;  3I3T A;  3NHE A;  1CQD A;  1KHP A;  1EWO A;  2DCC A;  4YVA A;  2R6N A;  2DC9 A;  2DOS A;  1PXV A;  3K24 A;  2B1M A;  4MM3 B;  4RY2 A;  4X6H A;  1FH0 A;  1CTE A;  2PBH A;  3OQC A;  1NL6 A;  3O1G A;  3S3R A;  2R9M A;  4BOQ A;  1ATK A;  4IP3 A;  3WXE A;  4BOU A;  1BGO A;  2BDL A;  3KFQ A;  4I07 A;  2HXZ A;  3BCN A;  2B1N A;  4N4Z A; 
#chains in the Genus database with same CATH homology
 2AYN A;  3RVV A;  1PPD A;  1XKG A;  3GCB A;  3OVX A;  2DJF B;  3AI8 A;  1F29 A;  1KFU L;  2R9N A;  3WXG A;  1ITO A;  3ZUA A;  2AYO A;  2XU1 A;  3D9W A;  3DF0 A;  1CSB B;  1TU6 A;  1THE A;  1U9V A;  3PNR A;  4MZO A;  3IHP A;  2NQG A;  4N79 A;  1QXP A;  1ME4 A;  5J94 A;  5PAD A;  1GX3 A;  2OP3 A;  2P7U A;  1CS8 A;  3V6E A;  2HH5 A;  2CB5 A;  1SNK A;  4YV8 A;  1VJV A;  3P5W A;  4BS6 A;  3F75 A;  4MSX A;  2E02 A;  3TNX A;  3RVW A;  1CPJ A;  1PPO A;  4BPV A;  1YK7 A;  4Q8G A;  5CHV A;  4CDE B;  3F5V A;  1PIP A;  5JA7 A;  2ACT A;  1AYV A;  1IWD A;  2PRE A;  3M99 A;  3OF9 A;  1YK8 A;  1AYU A;  1ICF A;  1STF E;  3LXS A;  3ERV A;  2XU5 A;  2Y5B A;  1ZCM A;  4MZS A;  1CV8 A;  3K9M A;  3PDF A;  3BOW A;  4P6E A;  4NV7 A;  4AXM A;  3RVX A;  1F2B A;  2FYE A;  2GFO A;  3PBH A;  5EF4 A;  2R9F A;  2XU3 A;  3IV2 A;  2DCA A;  4ZUX U;  5CVM A;  1E2T A;  2WBF X;  4YYQ A;  1SP4 B;  8PCH A;  1Y08 A;  2G6D A;  2DC7 A;  3K8U A;  4P6G A;  5JH3 A;  1EWL A;  1F2C A;  1ZIV A;  1EWM A;  4GUZ A;  3WXF A;  2P0R A;  2JQG R;  1W6F A;  3KX1 A;  2G8J A;  1PPP A;  4KLB A;  3O0U A;  1M6D A;  4PI3 A;  3H8B A;  3P5U A;  2YJB A;  2NQD B;  2YJ9 A;  2BDZ A;  3P5X A;  4PAD A;  4AXL A;  2F7D A;  1AEC A;  3OIS A;  1DEU A;  4YYU A;  2ARY A;  1U9W A;  2DZZ A;  2YJ2 A;  1AU4 A;  3P5V A;  1O0E A;  3KWB X;  2FTD A;  1X9Y A;  2AUZ A;  1NB3 A;  1VSN A;  2DCB A;  3LTW A;  4G54 A;  2DCD A;  3LFY A;  1TLO A;  2AUX A;  2Y6E A;  1CVZ A;  5CVO B;  3IEJ A;  3C9E A;  2BSZ A;  1CJL A;  2AS8 A;  4QRG A;  1YT7 A;  3H7D A;  1K3B B;  2FO5 A;  3CBK A;  2E01 A;  4FIP A;  1Q6K A;  1W5R A;  4I04 A;  4W5B A;  4W5C A;  2C0Y A;  4QRV A;  4YYW A;  2ATO A;  4CDD B;  2AVW A;  2PAD A;  4WA6 A;  1PBH A;  2AIM A;  1NPZ A;  2FUD A;  4YYS A;  2YJ8 A;  3N3G A;  4OEL A;  4BSQ A;  1KHQ A;  1ME3 A;  4CZW A;  2R9O A;  3MHH A;  5EGW A;  1AYW A;  4I05 A;  1BP4 A;  4BGF A;  3BC3 A;  4XUI A;  4CDF B;  3IUT A;  3HHA A;  1TL9 A;  1PCI A;  1EWP A;  5A24 A;  4N8W A;  1GLO A;  3IMA A;  3KW9 A;  1BQI A;  4BQV A;  1AU2 A;  3MOR A;  4OEM A;  2JQF R;  4QH6 A;  2FT2 A;  2HD5 A;  1Y4H A;  2G8E A;  5F02 A;  3OVZ A;  3CH2 X;  4BS5 A;  1PPN A;  1KFX L;  1MS6 A;  5CHT A;  2AU1 A;  3QJ3 A;  5CVN B;  1NB5 A;  1POP A;  3MTN A;  3N4C A;  1BY8 A;  1AU3 A;  3QSD A;  1MDW A;  2PNS A;  4W4U A;  4FJC A;  5K16 A;  3B79 A;  3MHS A;  5FPW A;  4K7C A;  1MEG A;  3USV A;  3KKU A;  9PAP A;  2IPP B;  2DC8 A;  4CDC B;  1U5I A;  3QT4 A;  3S3Q A;  1MEM A;  2HHN A;  1U9X A;  3HHI A;  6PAD A;  4FK5 A;  1CB5 A;  3N3K A;  1U9Q X;  2E00 A;  1MIR A;  2DC6 A;  2XU4 A;  3OF8 A;  1MHW A;  4HWY A;  1W4T A;  1KXR A;  1YAL A;  1GEC E;  7PCK A;  2E03 A;  3KWZ A;  2FQ9 A;  4PP2 E;  3IOQ A;  2IBI A;  2OZ2 A;  3HD3 A;  1AIM A;  3D6S A;  4NV8 A;  3KSE A;  3CH3 X;  4X6I A;  1JQP A;  3E1Z B;  2F1G A;  2FRQ A;  4PP1 A;  3BWK A;  3CBJ A;  4X6J A;  2VHS A;  1EF7 A;  1HUC B;  3H6S A;  2CIO A;  2NQA A;  2P86 A;  2H7J A;  1PAD A;  1A6R A;  1DF0 A;  3BPF A;  2YJC A;  1S4V A;  4XR7 A;  2VHF A;  2GHU A;  4DMX A;  4B55 A;  2G7Y A;  2OUL A;  4YYV A;  2VFB A;  2DZY A;  2O6X A;  1AU0 A;  4YYR A;  3HWN A;  3BPM A;  1YVB A;  2R9C A;  1F2A A;  2NQI A;  4QBB A;  1GMY A;  4C5P A;  4Q8H A;  3PW3 A;  1NLJ A;  3I06 A;  3H8C A;  1PE6 A;  1NQC A;  2FRA A;  1QMY A;  1GCB A;  4QRX A;  3V6C A;  2DJG B;  1QDQ A;  4DMY A;  1QOL A;  2VFC A;  3H89 A;  3U8E A;  3I3T A;  3NHE A;  1CQD A;  1KHP A;  1EWO A;  2DCC A;  4YVA A;  2R6N A;  2DC9 A;  3K24 A;  1PXV A;  2B1M A;  4RY2 A;  4X6H A;  1FH0 A;  1CTE A;  2PBH A;  1NL6 A;  3O1G A;  3S3R A;  2R9M A;  1ATK A;  3WXE A;  1BGO A;  2BDL A;  3KFQ A;  4I07 A;  2HXZ A;  3BCN A;  2B1N A;  4N4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...