4BQVA

Mouse cathepsin s with covalent ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
b'TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bqvA00
4HWYA 3IV2A 1K3BB 3BPFA 2R9CA 4RY2A 3AI8A 2JQFR 4X6IA 2R9FA 3OVXA 2VHSA 3N4CA 2F1GA 1POPA 1NLJA 4YYUA 2WBFX 3H8CA 2AYNA 2DCDA 1SP4B 2F7DA 4BQVA 4CDEB 1M6DA 2R9OA 1AU2A 1AYUA 1NPZA 3OISA 5PADA 4AXLA 1ME4A 3CH2X 3F5VA 4FIPA 4W5BA 1PPPA 4QRXA 2Y6EA 1CS8A 2AUXA 4PI3A 4Q8HA 2CB5A 1SNKA 4YYRA 2C0YA 3H6SA 1EWOA 2DCAA 2NQIA 1Y4HA 1U9QX 1AU3A 1BQIA 1GMYA 1YALA 1JQPA 2DC7A 2R9NA 1MIRA 2P86A 1TU6A 3HHIA 1U9VA 3RVVA 3RVXA 3CBKA 4Q8GA 1QXPA 2PADA 5EF4A 2ARYA 2FTDA 3PBHA 4N8WA 3ERVA 1CSBB 9PAPA 4P6EA 1F2CA 1F2BA 2AS8A 4CDDB 2NQAA 4MSXA 1CTEA 2CIOA 1MHWA 3IEJA 2G8JA 2HXZA 4QBBA 4YYVA 1F29A 4YYSA 1AIMA 1PPOA 4ZUXU 1PPNA 1YVBA 1GECE 1EF7A 3HD3A 4CDFB 4PADA 3TNXA 3USVA 1YK7A 3BC3A 4K7CA 1IWDA 5FPWA 2FRQA 1DF0A 1U9XA 3BCNA 2OZ2A 3H8BA 3H89A 3O1GA 3U8EA 1CVZA 2DJGB 5K16A 5CHTA 4WA6A 4G54A 2AU1A 2ACTA 2E02A 3KSEA 2BDZA 1ICFA 3MORA 3ZUAA 3IOQA 5J94A 2P0RA 3MHHA 3DF0A 3PDFA 4X6HA 2FQ9A 3I06A 1KFUL 1NQCA 2E00A 3HWNA 4FJCA 1PE6A 1Y08A 3QT4A 3MTNA 3F75A 4QH6A 1U9WA 2XU4A 4YV8A 2JQGR 3KX1A 2OULA 3KKUA 2P7UA 2FT2A 4I07A 4BPVA 2G6DA 3KFQA 3M99A 3MHSA 1KHQA 4XR7A 3K8UA 4MZSA 2IBIA 3LXSA 3OF9A 1A6RA 1CV8A 5EGWA 1ZIVA 3WXGA 4CDCB 3IUTA 1BGOA 3BWKA 3S3QA 1PXVA 4OELA 2B1NA 1MEMA 3D6SA 4YVAA 2B1MA 1AYWA 1VSNA 2FO5A 2BDLA 3CBJA 1PPDA 4KLBA 4FK5A 2OP3A 4MZOA 2XU5A 2DCBA 2AYOA 3I3TA 4QRGA 2O6XA 4DMYA 3NHEA 3GCBA 2AIMA 3IHPA 1PADA 1QDQA 3K9MA 3P5UA 1PBHA 3OVZA 1KXRA 3BOWA 2Y5BA 2DJFB 1DEUA 1EWMA 3H7DA 5JH3A 3QJ3A 5JA7A 2HH5A 2R6NA 2DZYA 2PNSA 1YK8A 2DZZA 1GLOA 1S4VA 1AU0A 2GHUA 2PBHA 6PADA 2GFOA 4QRVA 4I05A 2ATOA 1AECA 2VHFA 1PIPA 3KW9A 2XU3A 3KWZA 3QSDA 1EWPA 2R9MA 4PP1A 1QOLA 4OEMA 2DC6A 3PW3A 3C9EA 3KWBX 4YYQA 1STFE 2DC8A 1AU4A 2YJ9A 1CPJA 3BPMA 1THEA 2YJ2A 3IMAA 5CVMA 1ME3A 1FH0A 5CVOB 1CJLA 3P5VA 1VJVA 3E1ZB 4X6JA 2XU1A 3WXFA 1EWLA 3S3RA 2YJCA 3HHAA 3OF8A 4XUIA 2E03A 1BY8A 3RVWA 1XKGA 1MDWA 2HD5A 3PNRA 5A24A 1NB5A 4P6GA 5CVNB 1AYVA 2DCCA 1KHPA 2YJBA 3N3KA 3K24A 1TLOA 4CZWA 4BSQA 2NQDB 4N79A 3V6CA 3P5WA 1ITOA 1KFXL 1NL6A 3WXEA 3V6EA 2G8EA 5CHVA 1QMYA 1ATKA 4BS5A 3O0UA 4W4UA 2G7YA 2YJ8A 4YYWA 2FYEA 1Q6KA 3N3GA 1CB5A 2PREA 2AVWA 1BP4A 1X9YA 8PCHA 4BS6A 2DC9A 4I04A 1CQDA 1O0EA 1PCIA 2FRAA 7PCKA 3P5XA 2E01A 1U5IA 2FUDA 1YT7A 3CH3X 1MS6A 1ZCMA 2IPPB 3B79A 3LFYA 1HUCB 1TL9A 4N4ZA 2HHNA 1MEGA 1NB3A 5F02A 1F2AA 2AUZA 4AXMA 4W5CA 1GCBA 4PP2E 4DMXA 2H7JA 2NQGA
chains in the Genus database with same CATH superfamily
4HWYA 3IV2A 4MI7A 1K3BB 3BPFA 2R9CA 4RY2A 3AI8A 2JQFR 4X6IA 2R9FA 3OVXA 2VHSA 3N4CA 2F1GA 1POPA 1NLJA 4YYUA 2WBFX 3H8CA 2AYNA 1UKFA 2DCDA 1SP4B 5EZQA 2F7DA 4P16A 4BQVA 4CDEB 1M6DA 2R9OA 1AU2A 4BOZA 1AYUA 1NPZA 3OISA 5PADA 4AXLA 1ME4A 3CH2X 3F5VA 4FIPA 4W5BA 1PPPA 4QRXA 2Y6EA 1CS8A 2AUXA 4PI3A 4Q8HA 2CB5A 1SNKA 3MTVA 4YYRA 2C0YA 3H6SA 1EWOA 3C0RA 2DCAA 2NQIA 1Y4HA 1U9QX 1AU3A 1BQIA 1GMYA 1YALA 1JQPA 2DC7A 2R9NA 1MIRA 2P86A 1TU6A 3HHIA 1U9VA 3RVVA 2UZJA 3RVXA 3CBKA 4Q8GA 1QXPA 2PADA 5EF4A 2ARYA 2FTDA 4REZA 3PBHA 4N8WA 3ERVA 1CSBB 9PAPA 4P6EA 2JRIA 1PVJA 1F2CA 1F2BA 2AS8A 4CDDB 2NQAA 4MSXA 4WURA 4BOQA 1CTEA 2CIOA 2DOSA 1MHWA 2BU3A 2FE8A 3IEJA 2G8JA 2HXZA 4QBBA 4YYVA 1F29A 4YYSA 3MP2A 1AIMA 1PPOA 3PRMA 4ZUXU 3PRPA 1PPNA 1YVBA 5E6JA 1GECE 1EF7A 3HD3A 4CDFB 4MM3B 4PADA 3TNXA 3USVA 1YK7A 4R3DA 3BC3A 4K7CA 1IWDA 5FPWA 2FRQA 1DF0A 1U9XA 3MJ5A 3BCNA 2OZ2A 3H8BA 3H89A 3O1GA 3U8EA 1CVZA 2DJGB 5K16A 5CHTA 4WA6A 4G54A 2AU1A 2ACTA 2E02A 3ZNHA 3KSEA 2BDZA 1ICFA 2J7QC 3MORA 3ZUAA 3IOQA 5J94A 2P0RA 3MHHA 3DF0A 4OVZB 3TRKA 2JTCA 3PDFA 4X6HA 2FQ9A 4XZXA 3I06A 1KFUL 1NQCA 2E00A 2AGAA 3HWNA 4FJCA 1PE6A 1Y08A 3QT4A 3MTNA 3F75A 4QH6A 1U9WA 2XU4A 4YV8A 2JQGR 4IUMA 4RKXA 3KX1A 2OULA 3KKUA 2P7UA 3BY4A 2FT2A 4I07A 4BPVA 2G6DA 3KFQA 3M99A 3MHSA 1KHQA 4XR7A 3K8UA 4MZSA 5JZEA 2IBIA 3LXSA 4ZTBA 3OF9A 1DKIA 1A6RA 1CV8A 3TMPA 5EGWA 1ZIVA 3WXGA 4CDCB 3IUTA 1BGOA 3BWKA 3S3QA 1PXVA 4OELA 2B1NA 4D8IA 1MEMA 3D6SA 4YVAA 2J7QA 2B1MA 1AYWA 3O65A 1VSNA 2FO5A 2BDLA 3CBJA 1PPDA 3BBAA 4KLBA 4FK5A 2OP3A 4MZOA 2XU5A 5EZSA 2DCBA 2AYOA 3I3TA 2BTWB 4QRGA 3PHWA 2O6XA 4DMYA 3NHEA 3GCBA 2AIMA 3IHPA 1PADA 4RNAA 2Z84A 1QDQA 4BOSA 3K9MA 3P5UA 1PBHA 3OVZA 1KXRA 3BOWA 2Y5BA 2DJFB 4OW0A 1DEUA 1EWMA 3H7DA 5JH3A 3QJ3A 5JA7A 5KO3A 2HH5A 1YZBA 2R6NA 2DZYA 3PHUA 2PNSA 1YK8A 2DZZA 1GLOA 1S4VA 1AU0A 2GHUA 2PBHA 2HWKA 6PADA 2GFOA 4A5UA 4QRVA 4I05A 2ATOA 3KW9A 1AECA 2VHFA 1PIPA 2XU3A 3KWZA 3QSDA 1EWPA 2R9MA 4PP1A 1QOLA 4OEMA 2DC6A 3PW3A 3C9EA 3KWBX 4PT5A 4YYQA 3RNVA 1STFE 2DC8A 1AU4A 2YJ9A 1CPJA 4OVZA 3BPMA 1THEA 2YJ2A 3IMAA 5CVMA 3PHXA 1ME3A 1FH0A 5CVOB 1CJLA 3P5VA 1VJVA 3BB7A 4BOPA 3E1ZB 4X6JA 2XU1A 3IFUA 3WXFA 1EWLA 3S3RA 2YJCA 3HHAA 3OF8A 4XUIA 2E03A 1BY8A 3RVWA 1XKGA 1MDWA 2HD5A 3PNRA 5A24A 1NB5A 4P6GA 5CVNB 1AYVA 2DCCA 1KHPA 2YJBA 3N3KA 3K24A 1TLOA 3PSEA 4M0WA 4CZWA 4BSQA 2NQDB 4N79A 3W30A 3V6CA 3OQCA 3P5WA 1ITOA 1KFXL 4HXDB 1NL6A 3WXEA 3V6EA 3PT2A 2G8EA 5CHVA 4D8EA 1QMYA 4RF0A 1ATKA 4BOUA 4BS5A 3O0UA 4W4UA 2G7YA 2YJ8A 4YYWA 3W31A 2FYEA 1Q6KA 3N3GA 1CB5A 2PREA 3B21A 2AVWA 1BP4A 1X9YA 8PCHA 4BS6A 2DC9A 4I04A 1CQDA 1O0EA 1PCIA 4IP3A 4GUAA 2BTWA 2FRAA 7PCKA 3P5XA 2E01A 1U5IA 2FUDA 1YT7A 3CH3X 1MS6A 1ZCMA 2IPPB 3E9SA 3B79A 3LFYA 1HUCB 1TL9A 4N4ZA 2HHNA 1MEGA 1NB3A 5F02A 4RF1A 1F2AA 4D8BA 2AUZA 4AXMA 4W5CA 1GCBA 4PP2E 4DMXA 2H7JA 2NQGA
chains in the Genus database with same CATH topology
4HWYA 3IV2A 1K3BB 3BPFA 2R9CA 4RY2A 3AI8A 2JQFR 4X6IA 2R9FA 3OVXA 2VHSA 3N4CA 2F1GA 1POPA 1NLJA 4YYUA 2WBFX 3H8CA 2AYNA 2DCDA 1SP4B 2F7DA 4BQVA 4CDEB 1W5RA 1M6DA 2R9OA 1AU2A 1AYUA 1NPZA 3OISA 5PADA 4AXLA 1ME4A 3CH2X 3F5VA 4FIPA 4W5BA 1PPPA 4QRXA 2Y6EA 1CS8A 2AUXA 4PI3A 4Q8HA 2CB5A 1SNKA 4YYRA 2C0YA 3H6SA 1EWOA 2DCAA 2NQIA 1Y4HA 1U9QX 1AU3A 1BQIA 1GMYA 2VFCA 1YALA 1JQPA 2DC7A 2R9NA 1MIRA 2P86A 1TU6A 3HHIA 1U9VA 3RVVA 3RVXA 3CBKA 4Q8GA 1QXPA 2PADA 5EF4A 2ARYA 2FTDA 3PBHA 4N8WA 3ERVA 1CSBB 9PAPA 4P6EA 1F2CA 1F2BA 2AS8A 4CDDB 2NQAA 4MSXA 1CTEA 2CIOA 1MHWA 3IEJA 2G8JA 2HXZA 4QBBA 4YYVA 1F29A 4YYSA 1AIMA 1PPOA 4ZUXU 1PPNA 1YVBA 4BGFA 1GECE 1EF7A 3HD3A 4CDFB 4B55A 4PADA 3TNXA 3USVA 1YK7A 3BC3A 4K7CA 1IWDA 5FPWA 2FRQA 1DF0A 1U9XA 3BCNA 2OZ2A 3H8BA 3H89A 3O1GA 3U8EA 1CVZA 2DJGB 5K16A 5CHTA 4WA6A 4G54A 2AU1A 2ACTA 2E02A 3KSEA 2BDZA 2BSZA 1ICFA 3MORA 3ZUAA 3IOQA 5J94A 2P0RA 3MHHA 3DF0A 3PDFA 4X6HA 2FQ9A 3I06A 4NV8A 1KFUL 1NQCA 2E00A 3HWNA 4FJCA 1PE6A 1Y08A 3QT4A 3MTNA 3F75A 4QH6A 1U9WA 2XU4A 4YV8A 2JQGR 3KX1A 2OULA 3KKUA 2P7UA 2FT2A 4I07A 4BPVA 2G6DA 3KFQA 3M99A 3LTWA 3MHSA 1KHQA 4XR7A 3K8UA 4MZSA 2IBIA 3LXSA 3OF9A 1A6RA 1CV8A 5EGWA 1ZIVA 3WXGA 4CDCB 3IUTA 1BGOA 3BWKA 3S3QA 1PXVA 4OELA 2B1NA 1MEMA 3D6SA 4YVAA 2B1MA 1AYWA 1VSNA 2FO5A 2BDLA 3CBJA 1PPDA 4KLBA 4FK5A 2OP3A 4MZOA 2XU5A 2DCBA 2AYOA 3I3TA 4GUZA 4QRGA 2O6XA 4DMYA 3NHEA 3GCBA 2AIMA 3IHPA 1PADA 1QDQA 3K9MA 3P5UA 1PBHA 3OVZA 1KXRA 3BOWA 2Y5BA 2DJFB 1DEUA 1EWMA 3H7DA 5JH3A 3QJ3A 5JA7A 2HH5A 2R6NA 2DZYA 2PNSA 1YK8A 2DZZA 1GLOA 1S4VA 1AU0A 2GHUA 2PBHA 6PADA 2GFOA 4QRVA 4I05A 2ATOA 1AECA 2VHFA 1PIPA 3KW9A 2XU3A 3KWZA 3QSDA 1EWPA 2R9MA 4PP1A 1QOLA 4OEMA 2DC6A 3PW3A 3C9EA 3KWBX 4YYQA 1STFE 2DC8A 1AU4A 2YJ9A 1CPJA 3BPMA 1THEA 2YJ2A 3IMAA 5CVMA 1ME3A 1FH0A 5CVOB 1CJLA 4NV7A 3P5VA 1VJVA 3E1ZB 4X6JA 2XU1A 3WXFA 1W4TA 1EWLA 3S3RA 2YJCA 3HHAA 3OF8A 4XUIA 2E03A 1BY8A 3RVWA 1XKGA 1MDWA 2HD5A 3PNRA 5A24A 1E2TA 1NB5A 4P6GA 5CVNB 1AYVA 2DCCA 1KHPA 2YJBA 1GX3A 3N3KA 3K24A 1TLOA 4CZWA 4BSQA 2NQDB 4N79A 3V6CA 3P5WA 1ITOA 1KFXL 1NL6A 3WXEA 3V6EA 2G8EA 5CHVA 1QMYA 1ATKA 4BS5A 3O0UA 4W4UA 2G7YA 2YJ8A 4YYWA 2FYEA 1Q6KA 3N3GA 3D9WA 1CB5A 2PREA 2AVWA 1W6FA 1BP4A 4C5PA 1X9YA 8PCHA 4BS6A 2DC9A 4I04A 1CQDA 1O0EA 1PCIA 2FRAA 7PCKA 3P5XA 2E01A 1U5IA 2FUDA 1YT7A 2VFBA 3CH3X 1MS6A 1ZCMA 2IPPB 3B79A 3LFYA 1HUCB 1TL9A 4N4ZA 2HHNA 1MEGA 1NB3A 5F02A 1F2AA 2AUZA 4AXMA 4W5CA 1GCBA 4PP2E 4DMXA 2H7JA 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWY A;  3IV2 A;  1K3B B;  3BPF A;  2R9C A;  4RY2 A;  3AI8 A;  2JQF R;  4X6I A;  2R9F A;  3OVX A;  2VHS A;  3N4C A;  2F1G A;  1POP A;  1NLJ A;  4YYU A;  2WBF X;  3H8C A;  2AYN A;  2DCD A;  1SP4 B;  2F7D A;  4BQV A;  4CDE B;  1M6D A;  2R9O A;  1AU2 A;  1AYU A;  1NPZ A;  3OIS A;  5PAD A;  4AXL A;  1ME4 A;  3CH2 X;  3F5V A;  4FIP A;  4W5B A;  1PPP A;  4QRX A;  2Y6E A;  1CS8 A;  2AUX A;  4PI3 A;  4Q8H A;  2CB5 A;  1SNK A;  4YYR A;  2C0Y A;  3H6S A;  1EWO A;  2DCA A;  2NQI A;  1Y4H A;  1U9Q X;  1AU3 A;  1BQI A;  1GMY A;  1YAL A;  1JQP A;  2DC7 A;  2R9N A;  1MIR A;  2P86 A;  1TU6 A;  3HHI A;  1U9V A;  3RVV A;  3RVX A;  3CBK A;  4Q8G A;  1QXP A;  2PAD A;  5EF4 A;  2ARY A;  2FTD A;  3PBH A;  4N8W A;  3ERV A;  1CSB B;  9PAP A;  4P6E A;  1F2C A;  1F2B A;  2AS8 A;  4CDD B;  2NQA A;  4MSX A;  1CTE A;  2CIO A;  1MHW A;  3IEJ A;  2G8J A;  2HXZ A;  4QBB A;  4YYV A;  1F29 A;  4YYS A;  1AIM A;  1PPO A;  4ZUX U;  1PPN A;  1YVB A;  1GEC E;  1EF7 A;  3HD3 A;  4CDF B;  4PAD A;  3TNX A;  3USV A;  1YK7 A;  3BC3 A;  4K7C A;  1IWD A;  5FPW A;  2FRQ A;  1DF0 A;  1U9X A;  3BCN A;  2OZ2 A;  3H8B A;  3H89 A;  3O1G A;  3U8E A;  1CVZ A;  2DJG B;  5K16 A;  5CHT A;  4WA6 A;  4G54 A;  2AU1 A;  2ACT A;  2E02 A;  3KSE A;  2BDZ A;  1ICF A;  3MOR A;  3ZUA A;  3IOQ A;  5J94 A;  2P0R A;  3MHH A;  3DF0 A;  3PDF A;  4X6H A;  2FQ9 A;  3I06 A;  1KFU L;  1NQC A;  2E00 A;  3HWN A;  4FJC A;  1PE6 A;  1Y08 A;  3QT4 A;  3MTN A;  3F75 A;  4QH6 A;  1U9W A;  2XU4 A;  4YV8 A;  2JQG R;  3KX1 A;  2OUL A;  3KKU A;  2P7U A;  2FT2 A;  4I07 A;  4BPV A;  2G6D A;  3KFQ A;  3M99 A;  3MHS A;  1KHQ A;  4XR7 A;  3K8U A;  4MZS A;  2IBI A;  3LXS A;  3OF9 A;  1A6R A;  1CV8 A;  5EGW A;  1ZIV A;  3WXG A;  4CDC B;  3IUT A;  1BGO A;  3BWK A;  3S3Q A;  1PXV A;  4OEL A;  2B1N A;  1MEM A;  3D6S A;  4YVA A;  2B1M A;  1AYW A;  1VSN A;  2FO5 A;  2BDL A;  3CBJ A;  1PPD A;  4KLB A;  4FK5 A;  2OP3 A;  4MZO A;  2XU5 A;  2DCB A;  2AYO A;  3I3T A;  4QRG A;  2O6X A;  4DMY A;  3NHE A;  3GCB A;  2AIM A;  3IHP A;  1PAD A;  1QDQ A;  3K9M A;  3P5U A;  1PBH A;  3OVZ A;  1KXR A;  3BOW A;  2Y5B A;  2DJF B;  1DEU A;  1EWM A;  3H7D A;  5JH3 A;  3QJ3 A;  5JA7 A;  2HH5 A;  2R6N A;  2DZY A;  2PNS A;  1YK8 A;  2DZZ A;  1GLO A;  1S4V A;  1AU0 A;  2GHU A;  2PBH A;  6PAD A;  2GFO A;  4QRV A;  4I05 A;  2ATO A;  1AEC A;  2VHF A;  1PIP A;  3KW9 A;  2XU3 A;  3KWZ A;  3QSD A;  1EWP A;  2R9M A;  4PP1 A;  1QOL A;  4OEM A;  2DC6 A;  3PW3 A;  3C9E A;  3KWB X;  4YYQ A;  1STF E;  2DC8 A;  1AU4 A;  2YJ9 A;  1CPJ A;  3BPM A;  1THE A;  2YJ2 A;  3IMA A;  5CVM A;  1ME3 A;  1FH0 A;  5CVO B;  1CJL A;  3P5V A;  1VJV A;  3E1Z B;  4X6J A;  2XU1 A;  3WXF A;  1EWL A;  3S3R A;  2YJC A;  3HHA A;  3OF8 A;  4XUI A;  2E03 A;  1BY8 A;  3RVW A;  1XKG A;  1MDW A;  2HD5 A;  3PNR A;  5A24 A;  1NB5 A;  4P6G A;  5CVN B;  1AYV A;  2DCC A;  1KHP A;  2YJB A;  3N3K A;  3K24 A;  1TLO A;  4CZW A;  4BSQ A;  2NQD B;  4N79 A;  3V6C A;  3P5W A;  1ITO A;  1KFX L;  1NL6 A;  3WXE A;  3V6E A;  2G8E A;  5CHV A;  1QMY A;  1ATK A;  4BS5 A;  3O0U A;  4W4U A;  2G7Y A;  2YJ8 A;  4YYW A;  2FYE A;  1Q6K A;  3N3G A;  1CB5 A;  2PRE A;  2AVW A;  1BP4 A;  1X9Y A;  8PCH A;  4BS6 A;  2DC9 A;  4I04 A;  1CQD A;  1O0E A;  1PCI A;  2FRA A;  7PCK A;  3P5X A;  2E01 A;  1U5I A;  2FUD A;  1YT7 A;  3CH3 X;  1MS6 A;  1ZCM A;  2IPP B;  3B79 A;  3LFY A;  1HUC B;  1TL9 A;  4N4Z A;  2HHN A;  1MEG A;  1NB3 A;  5F02 A;  1F2A A;  2AUZ A;  4AXM A;  4W5C A;  1GCB A;  4PP2 E;  4DMX A;  2H7J A;  2NQG A; 
#chains in the Genus database with same CATH topology
 4HWY A;  3IV2 A;  4MI7 A;  1K3B B;  3BPF A;  2R9C A;  4RY2 A;  3AI8 A;  2JQF R;  4X6I A;  2R9F A;  3OVX A;  2VHS A;  3N4C A;  2F1G A;  1POP A;  1NLJ A;  4YYU A;  2WBF X;  3H8C A;  2AYN A;  1UKF A;  2DCD A;  1SP4 B;  5EZQ A;  2F7D A;  4P16 A;  4BQV A;  4CDE B;  1M6D A;  2R9O A;  1AU2 A;  4BOZ A;  1AYU A;  1NPZ A;  3OIS A;  5PAD A;  4AXL A;  1ME4 A;  3CH2 X;  3F5V A;  4FIP A;  4W5B A;  1PPP A;  4QRX A;  2Y6E A;  1CS8 A;  2AUX A;  4PI3 A;  4Q8H A;  2CB5 A;  1SNK A;  3MTV A;  4YYR A;  2C0Y A;  3H6S A;  1EWO A;  3C0R A;  2DCA A;  2NQI A;  1Y4H A;  1U9Q X;  1AU3 A;  1BQI A;  1GMY A;  1YAL A;  1JQP A;  2DC7 A;  2R9N A;  1MIR A;  2P86 A;  1TU6 A;  3HHI A;  1U9V A;  3RVV A;  2UZJ A;  3RVX A;  3CBK A;  4Q8G A;  1QXP A;  2PAD A;  5EF4 A;  2ARY A;  2FTD A;  4REZ A;  3PBH A;  4N8W A;  3ERV A;  1CSB B;  9PAP A;  4P6E A;  2JRI A;  1PVJ A;  1F2C A;  1F2B A;  2AS8 A;  4CDD B;  2NQA A;  4MSX A;  4WUR A;  4BOQ A;  1CTE A;  2CIO A;  2DOS A;  1MHW A;  2BU3 A;  2FE8 A;  3IEJ A;  2G8J A;  2HXZ A;  4QBB A;  4YYV A;  1F29 A;  4YYS A;  3MP2 A;  1AIM A;  1PPO A;  3PRM A;  4ZUX U;  3PRP A;  1PPN A;  1YVB A;  5E6J A;  1GEC E;  1EF7 A;  3HD3 A;  4CDF B;  4MM3 B;  4PAD A;  3TNX A;  3USV A;  1YK7 A;  4R3D A;  3BC3 A;  4K7C A;  1IWD A;  5FPW A;  2FRQ A;  1DF0 A;  1U9X A;  3MJ5 A;  3BCN A;  2OZ2 A;  3H8B A;  3H89 A;  3O1G A;  3U8E A;  1CVZ A;  2DJG B;  5K16 A;  5CHT A;  4WA6 A;  4G54 A;  2AU1 A;  2ACT A;  2E02 A;  3ZNH A;  3KSE A;  2BDZ A;  1ICF A;  2J7Q C;  3MOR A;  3ZUA A;  3IOQ A;  5J94 A;  2P0R A;  3MHH A;  3DF0 A;  4OVZ B;  3TRK A;  2JTC A;  3PDF A;  4X6H A;  2FQ9 A;  4XZX A;  3I06 A;  1KFU L;  1NQC A;  2E00 A;  2AGA A;  3HWN A;  4FJC A;  1PE6 A;  1Y08 A;  3QT4 A;  3MTN A;  3F75 A;  4QH6 A;  1U9W A;  2XU4 A;  4YV8 A;  2JQG R;  4IUM A;  4RKX A;  3KX1 A;  2OUL A;  3KKU A;  2P7U A;  3BY4 A;  2FT2 A;  4I07 A;  4BPV A;  2G6D A;  3KFQ A;  3M99 A;  3MHS A;  1KHQ A;  4XR7 A;  3K8U A;  4MZS A;  5JZE A;  2IBI A;  3LXS A;  4ZTB A;  3OF9 A;  1DKI A;  1A6R A;  1CV8 A;  3TMP A;  5EGW A;  1ZIV A;  3WXG A;  4CDC B;  3IUT A;  1BGO A;  3BWK A;  3S3Q A;  1PXV A;  4OEL A;  2B1N A;  4D8I A;  1MEM A;  3D6S A;  4YVA A;  2J7Q A;  2B1M A;  1AYW A;  3O65 A;  1VSN A;  2FO5 A;  2BDL A;  3CBJ A;  1PPD A;  3BBA A;  4KLB A;  4FK5 A;  2OP3 A;  4MZO A;  2XU5 A;  5EZS A;  2DCB A;  2AYO A;  3I3T A;  2BTW B;  4QRG A;  3PHW A;  2O6X A;  4DMY A;  3NHE A;  3GCB A;  2AIM A;  3IHP A;  1PAD A;  4RNA A;  2Z84 A;  1QDQ A;  4BOS A;  3K9M A;  3P5U A;  1PBH A;  3OVZ A;  1KXR A;  3BOW A;  2Y5B A;  2DJF B;  4OW0 A;  1DEU A;  1EWM A;  3H7D A;  5JH3 A;  3QJ3 A;  5JA7 A;  5KO3 A;  2HH5 A;  1YZB A;  2R6N A;  2DZY A;  3PHU A;  2PNS A;  1YK8 A;  2DZZ A;  1GLO A;  1S4V A;  1AU0 A;  2GHU A;  2PBH A;  2HWK A;  6PAD A;  2GFO A;  4A5U A;  4QRV A;  4I05 A;  2ATO A;  3KW9 A;  1AEC A;  2VHF A;  1PIP A;  2XU3 A;  3KWZ A;  3QSD A;  1EWP A;  2R9M A;  4PP1 A;  1QOL A;  4OEM A;  2DC6 A;  3PW3 A;  3C9E A;  3KWB X;  4PT5 A;  4YYQ A;  3RNV A;  1STF E;  2DC8 A;  1AU4 A;  2YJ9 A;  1CPJ A;  4OVZ A;  3BPM A;  1THE A;  2YJ2 A;  3IMA A;  5CVM A;  3PHX A;  1ME3 A;  1FH0 A;  5CVO B;  1CJL A;  3P5V A;  1VJV A;  3BB7 A;  4BOP A;  3E1Z B;  4X6J A;  2XU1 A;  3IFU A;  3WXF A;  1EWL A;  3S3R A;  2YJC A;  3HHA A;  3OF8 A;  4XUI A;  2E03 A;  1BY8 A;  3RVW A;  1XKG A;  1MDW A;  2HD5 A;  3PNR A;  5A24 A;  1NB5 A;  4P6G A;  5CVN B;  1AYV A;  2DCC A;  1KHP A;  2YJB A;  3N3K A;  3K24 A;  1TLO A;  3PSE A;  4M0W A;  4CZW A;  4BSQ A;  2NQD B;  4N79 A;  3W30 A;  3V6C A;  3OQC A;  3P5W A;  1ITO A;  1KFX L;  4HXD B;  1NL6 A;  3WXE A;  3V6E A;  3PT2 A;  2G8E A;  5CHV A;  4D8E A;  1QMY A;  4RF0 A;  1ATK A;  4BOU A;  4BS5 A;  3O0U A;  4W4U A;  2G7Y A;  2YJ8 A;  4YYW A;  3W31 A;  2FYE A;  1Q6K A;  3N3G A;  1CB5 A;  2PRE A;  3B21 A;  2AVW A;  1BP4 A;  1X9Y A;  8PCH A;  4BS6 A;  2DC9 A;  4I04 A;  1CQD A;  1O0E A;  1PCI A;  4IP3 A;  4GUA A;  2BTW A;  2FRA A;  7PCK A;  3P5X A;  2E01 A;  1U5I A;  2FUD A;  1YT7 A;  3CH3 X;  1MS6 A;  1ZCM A;  2IPP B;  3E9S A;  3B79 A;  3LFY A;  1HUC B;  1TL9 A;  4N4Z A;  2HHN A;  1MEG A;  1NB3 A;  5F02 A;  4RF1 A;  1F2A A;  4D8B A;  2AUZ A;  4AXM A;  4W5C A;  1GCB A;  4PP2 E;  4DMX A;  2H7J A;  2NQG A; 
#chains in the Genus database with same CATH homology
 4HWY A;  3IV2 A;  1K3B B;  3BPF A;  2R9C A;  4RY2 A;  3AI8 A;  2JQF R;  4X6I A;  2R9F A;  3OVX A;  2VHS A;  3N4C A;  2F1G A;  1POP A;  1NLJ A;  4YYU A;  2WBF X;  3H8C A;  2AYN A;  2DCD A;  1SP4 B;  2F7D A;  4BQV A;  4CDE B;  1W5R A;  1M6D A;  2R9O A;  1AU2 A;  1AYU A;  1NPZ A;  3OIS A;  5PAD A;  4AXL A;  1ME4 A;  3CH2 X;  3F5V A;  4FIP A;  4W5B A;  1PPP A;  4QRX A;  2Y6E A;  1CS8 A;  2AUX A;  4PI3 A;  4Q8H A;  2CB5 A;  1SNK A;  4YYR A;  2C0Y A;  3H6S A;  1EWO A;  2DCA A;  2NQI A;  1Y4H A;  1U9Q X;  1AU3 A;  1BQI A;  1GMY A;  2VFC A;  1YAL A;  1JQP A;  2DC7 A;  2R9N A;  1MIR A;  2P86 A;  1TU6 A;  3HHI A;  1U9V A;  3RVV A;  3RVX A;  3CBK A;  4Q8G A;  1QXP A;  2PAD A;  5EF4 A;  2ARY A;  2FTD A;  3PBH A;  4N8W A;  3ERV A;  1CSB B;  9PAP A;  4P6E A;  1F2C A;  1F2B A;  2AS8 A;  4CDD B;  2NQA A;  4MSX A;  1CTE A;  2CIO A;  1MHW A;  3IEJ A;  2G8J A;  2HXZ A;  4QBB A;  4YYV A;  1F29 A;  4YYS A;  1AIM A;  1PPO A;  4ZUX U;  1PPN A;  1YVB A;  4BGF A;  1GEC E;  1EF7 A;  3HD3 A;  4CDF B;  4B55 A;  4PAD A;  3TNX A;  3USV A;  1YK7 A;  3BC3 A;  4K7C A;  1IWD A;  5FPW A;  2FRQ A;  1DF0 A;  1U9X A;  3BCN A;  2OZ2 A;  3H8B A;  3H89 A;  3O1G A;  3U8E A;  1CVZ A;  2DJG B;  5K16 A;  5CHT A;  4WA6 A;  4G54 A;  2AU1 A;  2ACT A;  2E02 A;  3KSE A;  2BDZ A;  2BSZ A;  1ICF A;  3MOR A;  3ZUA A;  3IOQ A;  5J94 A;  2P0R A;  3MHH A;  3DF0 A;  3PDF A;  4X6H A;  2FQ9 A;  3I06 A;  4NV8 A;  1KFU L;  1NQC A;  2E00 A;  3HWN A;  4FJC A;  1PE6 A;  1Y08 A;  3QT4 A;  3MTN A;  3F75 A;  4QH6 A;  1U9W A;  2XU4 A;  4YV8 A;  2JQG R;  3KX1 A;  2OUL A;  3KKU A;  2P7U A;  2FT2 A;  4I07 A;  4BPV A;  2G6D A;  3KFQ A;  3M99 A;  3LTW A;  3MHS A;  1KHQ A;  4XR7 A;  3K8U A;  4MZS A;  2IBI A;  3LXS A;  3OF9 A;  1A6R A;  1CV8 A;  5EGW A;  1ZIV A;  3WXG A;  4CDC B;  3IUT A;  1BGO A;  3BWK A;  3S3Q A;  1PXV A;  4OEL A;  2B1N A;  1MEM A;  3D6S A;  4YVA A;  2B1M A;  1AYW A;  1VSN A;  2FO5 A;  2BDL A;  3CBJ A;  1PPD A;  4KLB A;  4FK5 A;  2OP3 A;  4MZO A;  2XU5 A;  2DCB A;  2AYO A;  3I3T A;  4GUZ A;  4QRG A;  2O6X A;  4DMY A;  3NHE A;  3GCB A;  2AIM A;  3IHP A;  1PAD A;  1QDQ A;  3K9M A;  3P5U A;  1PBH A;  3OVZ A;  1KXR A;  3BOW A;  2Y5B A;  2DJF B;  1DEU A;  1EWM A;  3H7D A;  5JH3 A;  3QJ3 A;  5JA7 A;  2HH5 A;  2R6N A;  2DZY A;  2PNS A;  1YK8 A;  2DZZ A;  1GLO A;  1S4V A;  1AU0 A;  2GHU A;  2PBH A;  6PAD A;  2GFO A;  4QRV A;  4I05 A;  2ATO A;  1AEC A;  2VHF A;  1PIP A;  3KW9 A;  2XU3 A;  3KWZ A;  3QSD A;  1EWP A;  2R9M A;  4PP1 A;  1QOL A;  4OEM A;  2DC6 A;  3PW3 A;  3C9E A;  3KWB X;  4YYQ A;  1STF E;  2DC8 A;  1AU4 A;  2YJ9 A;  1CPJ A;  3BPM A;  1THE A;  2YJ2 A;  3IMA A;  5CVM A;  1ME3 A;  1FH0 A;  5CVO B;  1CJL A;  4NV7 A;  3P5V A;  1VJV A;  3E1Z B;  4X6J A;  2XU1 A;  3WXF A;  1W4T A;  1EWL A;  3S3R A;  2YJC A;  3HHA A;  3OF8 A;  4XUI A;  2E03 A;  1BY8 A;  3RVW A;  1XKG A;  1MDW A;  2HD5 A;  3PNR A;  5A24 A;  1E2T A;  1NB5 A;  4P6G A;  5CVN B;  1AYV A;  2DCC A;  1KHP A;  2YJB A;  1GX3 A;  3N3K A;  3K24 A;  1TLO A;  4CZW A;  4BSQ A;  2NQD B;  4N79 A;  3V6C A;  3P5W A;  1ITO A;  1KFX L;  1NL6 A;  3WXE A;  3V6E A;  2G8E A;  5CHV A;  1QMY A;  1ATK A;  4BS5 A;  3O0U A;  4W4U A;  2G7Y A;  2YJ8 A;  4YYW A;  2FYE A;  1Q6K A;  3N3G A;  3D9W A;  1CB5 A;  2PRE A;  2AVW A;  1W6F A;  1BP4 A;  4C5P A;  1X9Y A;  8PCH A;  4BS6 A;  2DC9 A;  4I04 A;  1CQD A;  1O0E A;  1PCI A;  2FRA A;  7PCK A;  3P5X A;  2E01 A;  1U5I A;  2FUD A;  1YT7 A;  2VFB A;  3CH3 X;  1MS6 A;  1ZCM A;  2IPP B;  3B79 A;  3LFY A;  1HUC B;  1TL9 A;  4N4Z A;  2HHN A;  1MEG A;  1NB3 A;  5F02 A;  1F2A A;  2AUZ A;  4AXM A;  4W5C A;  1GCB A;  4PP2 E;  4DMX A;  2H7J A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...