4BQVA

Mouse cathepsin s with covalent ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords CATHEPSIN S
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bqvA00
2B1NA 3MHHA 1AU2A 3KSEA 2F7DA 2CB5A 2E01A 1EWOA 1ITOA 1MS6A 3PBHA 1YT7A 2OZ2A 3HHIA 4YYRA 3KKUA 3RVWA 1CSBB 4YVAA 4PADA 1VSNA 4QRGA 1NLJA 3RVVA 1GMYA 1F2BA 4W5CA 3CBJA 1MEMA 4MSXA 4QH6A 1X9YA 4QRVA 2G7YA 3PDFA 3N3GA 1KFXL 1A6RA 1BP4A 2HXZA 2Y5BA 1YALA 3H7DA 1Y08A 4I07A 1PPPA 1QMYA 2G6DA 2ACTA 1K3BB 1Y4HA 4CDCB 1KFUL 2FT2A 2FRAA 1AYVA 2OP3A 1NPZA 4Q8HA 3QT4A 1O0EA 1YK8A 1KHPA 2DC8A 3TNXA 1JQPA 3LFYA 3O0UA 1NQCA 1IWDA 5PADA 4AXMA 1BY8A 1U9WA 5CVOB 3S3QA 4RY2A 2NQGA 3S3RA 3IHPA 1QXPA 1YVBA 2B1MA 2FO5A 5JA7A 4I04A 3CH3X 4PP2E 3PW3A 2OULA 2R9MA 3ERVA 2R9NA 3I06A 5JH3A 2PBHA 4HWYA 9PAPA 1THEA 2DCAA 3GCBA 1PE6A 2E03A 4I05A 1POPA 3LXSA 4BPVA 2AUXA 1TL9A 1NL6A 4WA6A 1ME4A 3HD3A 3N3KA 4YYVA 2DC7A 3D6SA 4FJCA 2FTDA 3H8BA 2F1GA 1CB5A 1VJVA 1MIRA 5A24A 2DCCA 3CBKA 1YK7A 3E1ZB 4OEMA 1ATKA 1CJLA 1PBHA 4MZSA 1AIMA 2R9CA 3P5UA 1U9VA 1XKGA 2AU1A 3KX1A 4AXLA 3WXGA 4ZUXU 1AU3A 3IMAA 4CDDB 2YJCA 4XR7A 4X6JA 1CPJA 2DC6A 1PPOA 1M6DA 4PP1A 4G54A 4QRXA 2AS8A 2XU4A 3IEJA 2NQAA 3OVZA 2FYEA 4BSQA 2HH5A 3BCNA 4BS5A 3O1GA 3IOQA 1PIPA 4CDFB 4DMXA 1ZCMA 1MDWA 3K24A 4X6HA 1U5IA 2DZYA 1F2CA 4FK5A 3MTNA 3NHEA 1PPDA 3BPMA 3OISA 4YV8A 3P5XA 1AYUA 1CQDA 2NQIA 3V6CA 3B79A 5CVNB 3IV2A 3M99A 1AU0A 1AECA 2YJ2A 3USVA 2E02A 2FUDA 3P5VA 4W5BA 7PCKA 1F2AA 1GECE 2ARYA 2IBIA 1TLOA 1QOLA 2JQGR 4KLBA 4CDEB 8PCHA 2R9FA 2PADA 4DMYA 1S4VA 4N79A 2PNSA 1PXVA 1MEGA 1CV8A 1CTEA 3H89A 5F02A 3K8UA 3KW9A 3HHAA 2H7JA 5EF4A 5K16A 2XU1A 2AYNA 3WXFA 3U8EA 1PPNA 4YYQA 2GHUA 3F75A 2VHFA 4BQVA 2YJ8A 4X6IA 4K7CA 1AYWA 2ATOA 1ME3A 1EWMA 3IUTA 4W4UA 1U9QX 2HHNA 5CHTA 1U9XA 4P6GA 2JQFR 2XU5A 3HWNA 4XUIA 4PI3A 3QSDA 6PADA 2YJ9A 3KWBX 3K9MA 4QBBA 3H8CA 1PCIA 3MHSA 3V6EA 3P5WA 2BDZA 4P6EA 4Q8GA 3ZUAA 3I3TA 1ZIVA 1HUCB 4YYWA 3BPFA 5CVMA 2DJFB 2HD5A 2PREA 1Q6KA 3OF9A 2G8EA 2R9OA 2VHSA 3H6SA 4N4ZA 1NB3A 5J94A 1BGOA 2P86A 1CVZA 2XU3A 3DF0A 1DEUA 3OVXA 3KFQA 4YYUA 3PNRA 2DC9A 5CHVA 2IPPB 2DJGB 1PADA 4CZWA 2AUZA 1MHWA 3WXEA 1FH0A 1CS8A 3MORA 4YYSA 3CH2X 1DF0A 1ICFA 5FPWA 4MZOA 5EGWA 1SNKA 3OF8A 4OELA 1TU6A 1KXRA 3BWKA 4N8WA 2FRQA 1EWLA 2GFOA 1EWPA 1NB5A 3KWZA 3C9EA 2FQ9A 2WBFX 3QJ3A 1SP4B 2NQDB 3BC3A 3N4CA 2R6NA 3F5VA 2O6XA 2AIMA 1F29A 1EF7A 3RVXA 2AVWA 2G8JA 2DZZA 1GLOA 2C0YA 2P7UA 2DCDA 2P0RA 1GCBA 3AI8A 2DCBA 1AU4A 2CIOA 4FIPA 3BOWA 1BQIA 2E00A 1KHQA 2AYOA 1QDQA 2BDLA 2YJBA 1STFE 2Y6EA 4BS6A
chains in the Genus database with same CATH superfamily
3E9SA 2B1NA 3MHHA 1AU2A 3KSEA 2F7DA 2CB5A 4BOUA 2JRIA 2E01A 1EWOA 1ITOA 1MS6A 3PBHA 1YT7A 2OZ2A 3HHIA 4YYRA 3KKUA 3RVWA 1CSBB 4YVAA 4PADA 1VSNA 4QRGA 1NLJA 3W31A 3RVVA 1GMYA 4D8EA 4ZTBA 1F2BA 4W5CA 3CBJA 1MEMA 3OQCA 4MSXA 4QH6A 1X9YA 4QRVA 4A5UA 2G7YA 3PDFA 3N3GA 1KFXL 1A6RA 1BP4A 2HXZA 2Y5BA 1YALA 3H7DA 1Y08A 4MM3B 4I07A 1PPPA 1QMYA 2G6DA 3PHXA 4HXDB 2ACTA 1K3BB 1Y4HA 4CDCB 1KFUL 2FT2A 2FRAA 4IUMA 1AYVA 2OP3A 1NPZA 4Q8HA 3QT4A 1O0EA 1YK8A 1KHPA 2DC8A 3TNXA 1JQPA 3LFYA 3O0UA 4WURA 1NQCA 1IWDA 5PADA 4AXMA 1BY8A 1U9WA 2J7QC 3PSEA 4GUAA 5CVOB 2BU3A 3S3QA 4RY2A 2NQGA 2Z84A 3S3RA 3IHPA 1QXPA 1YVBA 2B1MA 3PHUA 2FO5A 5JA7A 4I04A 4RKXA 3CH3X 4PP2E 4BOPA 3PW3A 2OULA 2R9MA 3ERVA 2R9NA 3MJ5A 2AGAA 3I06A 5JH3A 2PBHA 4RF0A 4HWYA 2UZJA 9PAPA 1THEA 2DCAA 3GCBA 1PE6A 2E03A 4I05A 1POPA 3LXSA 4BPVA 5E6JA 2AUXA 1YZBA 1TL9A 1NL6A 4WA6A 1ME4A 4PT5A 4M0WA 3HD3A 3N3KA 4YYVA 2DC7A 3D6SA 4FJCA 2FTDA 3H8BA 2F1GA 2FE8A 2BTWB 1CB5A 1VJVA 1MIRA 5A24A 2DCCA 3CBKA 1YK7A 3E1ZB 4OEMA 1ATKA 1CJLA 1PBHA 4MZSA 1AIMA 2R9CA 3P5UA 1U9VA 1XKGA 2AU1A 3KX1A 4AXLA 3WXGA 4ZUXU 1AU3A 3IMAA 4CDDB 2YJCA 4X6JA 1CPJA 2DC6A 4XR7A 1PPOA 1M6DA 4PP1A 4G54A 4QRXA 2AS8A 2XU4A 3IEJA 2NQAA 3OVZA 2FYEA 4OW0A 4BSQA 3PT2A 2HH5A 3BCNA 4BS5A 3O1GA 4D8IA 3IOQA 1PIPA 4CDFB 4DMXA 1ZCMA 1MDWA 3K24A 4X6HA 3TMPA 1U5IA 2DZYA 1F2CA 4FK5A 3MTNA 3BB7A 3NHEA 1PPDA 3BPMA 3OISA 4YV8A 3P5XA 1AYUA 4RNAA 4OVZA 1CQDA 2NQIA 3V6CA 3B79A 5CVNB 3IV2A 3M99A 1AU0A 1AECA 2YJ2A 3USVA 2E02A 3ZNHA 2FUDA 3P5VA 4BOZA 4W5BA 7PCKA 1F2AA 1GECE 2ARYA 2IBIA 1TLOA 1QOLA 2JQGR 4KLBA 4CDEB 8PCHA 2R9FA 2PADA 4DMYA 1S4VA 4N79A 2PNSA 1PXVA 1MEGA 1CV8A 1CTEA 3H89A 5F02A 3K8UA 3PRMA 3KW9A 4IP3A 3HHAA 2H7JA 5EF4A 5K16A 2XU1A 4XZXA 2AYNA 3WXFA 3U8EA 1PPNA 4YYQA 2GHUA 1DKIA 2DOSA 2HWKA 3F75A 2VHFA 3BY4A 4REZA 4BQVA 2YJ8A 5EZSA 4BOQA 4X6IA 2JTCA 4K7CA 1AYWA 2ATOA 1ME3A 1UKFA 1EWMA 3IUTA 4W4UA 1U9QX 2HHNA 5CHTA 1U9XA 4P6GA 2JQFR 2XU5A 3HWNA 4XUIA 4OVZB 4PI3A 3QSDA 6PADA 2YJ9A 3KWBX 3K9MA 4QBBA 3H8CA 1PCIA 3MHSA 3V6EA 3P5WA 2BDZA 4P6EA 4Q8GA 3ZUAA 3W30A 3I3TA 3O65A 1ZIVA 1HUCB 3IFUA 4YYWA 3BPFA 3RNVA 5CVMA 2DJFB 5KO3A 2HD5A 2PREA 1Q6KA 3OF9A 2G8EA 2R9OA 2VHSA 3H6SA 1PVJA 4N4ZA 4P16A 1NB3A 5J94A 1BGOA 2P86A 1CVZA 2XU3A 3DF0A 1DEUA 3OVXA 3KFQA 4YYUA 3PNRA 2DC9A 5CHVA 2IPPB 2DJGB 1PADA 4CZWA 2AUZA 1MHWA 3WXEA 1FH0A 3PRPA 1CS8A 3MORA 4YYSA 2J7QA 4R3DA 3CH2X 1DF0A 1ICFA 2BTWA 5FPWA 4MZOA 5EGWA 1SNKA 3OF8A 4OELA 4N8WA 1TU6A 1KXRA 3BWKA 3PHWA 3BBAA 2FRQA 4BOSA 1EWLA 2GFOA 3B21A 1EWPA 1NB5A 3KWZA 3C9EA 2FQ9A 2WBFX 3QJ3A 1SP4B 2NQDB 3MP2A 3BC3A 3N4CA 2R6NA 3F5VA 2O6XA 3TRKA 2AIMA 1F29A 1EF7A 3RVXA 2AVWA 2G8JA 2DZZA 4D8BA 1GLOA 2C0YA 2P7UA 2DCDA 2P0RA 1GCBA 3AI8A 5JZEA 2DCBA 4MI7A 1AU4A 2CIOA 4FIPA 3MTVA 3BOWA 1BQIA 5EZQA 4RF1A 2E00A 1KHQA 2AYOA 1QDQA 2BDLA 2YJBA 1STFE 2Y6EA 4BS6A 3C0RA
chains in the Genus database with same CATH topology
2B1NA 3MHHA 1AU2A 3KSEA 2F7DA 2CB5A 2E01A 1W5RA 1EWOA 1ITOA 1MS6A 3PBHA 1YT7A 2OZ2A 3HHIA 4YYRA 3KKUA 3RVWA 1CSBB 4YVAA 4PADA 1VSNA 4QRGA 1NLJA 3RVVA 1GMYA 1F2BA 4W5CA 3CBJA 1MEMA 4MSXA 4QH6A 1X9YA 4QRVA 2G7YA 3PDFA 3N3GA 1KFXL 1A6RA 1BP4A 2HXZA 2Y5BA 1YALA 3H7DA 1Y08A 4I07A 1PPPA 1QMYA 2G6DA 2ACTA 1K3BB 1Y4HA 4CDCB 1KFUL 2FT2A 2FRAA 1AYVA 2OP3A 1NPZA 4NV8A 4Q8HA 3QT4A 1O0EA 1YK8A 1KHPA 2DC8A 3TNXA 1JQPA 3LFYA 3O0UA 1E2TA 1NQCA 1IWDA 5PADA 1W6FA 4AXMA 1BY8A 1U9WA 5CVOB 3S3QA 4RY2A 2NQGA 3S3RA 3D9WA 3IHPA 1QXPA 1YVBA 2B1MA 2FO5A 5JA7A 4I04A 3CH3X 4PP2E 3PW3A 2OULA 2R9MA 3ERVA 2VFBA 2R9NA 3I06A 5JH3A 2PBHA 4HWYA 9PAPA 1THEA 2DCAA 3GCBA 1PE6A 2E03A 4I05A 1POPA 3LXSA 4BPVA 2AUXA 1TL9A 1NL6A 4WA6A 1ME4A 3HD3A 3N3KA 4YYVA 2DC7A 4BGFA 3D6SA 4FJCA 2FTDA 3H8BA 2F1GA 1CB5A 1VJVA 1MIRA 5A24A 1W4TA 2DCCA 3CBKA 1YK7A 3E1ZB 4OEMA 1ATKA 1CJLA 1PBHA 4MZSA 1AIMA 2R9CA 3P5UA 1U9VA 1XKGA 2AU1A 3KX1A 4AXLA 3WXGA 4ZUXU 1AU3A 3IMAA 4CDDB 2YJCA 4XR7A 4X6JA 1CPJA 2DC6A 1PPOA 1M6DA 4PP1A 4G54A 4QRXA 2AS8A 2XU4A 3IEJA 2NQAA 3OVZA 2FYEA 4BSQA 2HH5A 3BCNA 4BS5A 3O1GA 3IOQA 1PIPA 4C5PA 4CDFB 4DMXA 1ZCMA 4GUZA 1MDWA 3K24A 4X6HA 1U5IA 2DZYA 1F2CA 4FK5A 3MTNA 3NHEA 1PPDA 3BPMA 3OISA 4YV8A 3P5XA 1AYUA 1CQDA 2NQIA 3V6CA 3B79A 5CVNB 3IV2A 3M99A 1AU0A 1AECA 2YJ2A 3USVA 2E02A 2FUDA 3P5VA 4W5BA 7PCKA 1F2AA 1GECE 2ARYA 2IBIA 2BSZA 1TLOA 1QOLA 2JQGR 4KLBA 4CDEB 8PCHA 2R9FA 2PADA 4DMYA 1S4VA 4N79A 2PNSA 1PXVA 1MEGA 1CV8A 1CTEA 3H89A 5F02A 3K8UA 3KW9A 3HHAA 2H7JA 5EF4A 5K16A 2XU1A 2AYNA 3WXFA 3U8EA 1PPNA 4YYQA 2GHUA 3F75A 2VHFA 4BQVA 2YJ8A 4X6IA 4K7CA 1AYWA 2ATOA 1ME3A 1EWMA 3IUTA 4W4UA 1U9QX 2HHNA 5CHTA 1U9XA 4P6GA 2JQFR 2XU5A 3HWNA 4XUIA 4PI3A 3QSDA 6PADA 2YJ9A 3KWBX 3K9MA 4QBBA 3H8CA 1PCIA 3MHSA 3V6EA 3P5WA 2BDZA 4P6EA 4Q8GA 3ZUAA 3I3TA 1ZIVA 1HUCB 4YYWA 3BPFA 5CVMA 2DJFB 2HD5A 2PREA 1Q6KA 3OF9A 2G8EA 2R9OA 2VHSA 3H6SA 4N4ZA 1NB3A 5J94A 1BGOA 2P86A 1CVZA 2XU3A 3DF0A 1DEUA 3OVXA 2VFCA 3KFQA 4YYUA 3PNRA 2DC9A 5CHVA 2IPPB 2DJGB 1PADA 4CZWA 2AUZA 1MHWA 3WXEA 1FH0A 4NV7A 1CS8A 3MORA 4B55A 4YYSA 3CH2X 1DF0A 1ICFA 5FPWA 4MZOA 5EGWA 1SNKA 3OF8A 4OELA 1TU6A 1KXRA 3BWKA 4N8WA 2FRQA 1EWLA 2GFOA 1GX3A 1EWPA 1NB5A 3KWZA 3C9EA 2FQ9A 2WBFX 3QJ3A 1SP4B 2NQDB 3BC3A 3N4CA 2R6NA 3LTWA 3F5VA 2O6XA 2AIMA 1F29A 1EF7A 3RVXA 2AVWA 2G8JA 2DZZA 1GLOA 2C0YA 2P7UA 2DCDA 2P0RA 1GCBA 3AI8A 2DCBA 1AU4A 2CIOA 4FIPA 3BOWA 1BQIA 2E00A 1KHQA 2AYOA 1QDQA 2BDLA 2YJBA 1STFE 2Y6EA 4BS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1N A;  3MHH A;  1AU2 A;  3KSE A;  2F7D A;  2CB5 A;  2E01 A;  1EWO A;  1ITO A;  1MS6 A;  3PBH A;  1YT7 A;  2OZ2 A;  3HHI A;  4YYR A;  3KKU A;  3RVW A;  1CSB B;  4YVA A;  4PAD A;  1VSN A;  4QRG A;  1NLJ A;  3RVV A;  1GMY A;  1F2B A;  4W5C A;  3CBJ A;  1MEM A;  4MSX A;  4QH6 A;  1X9Y A;  4QRV A;  2G7Y A;  3PDF A;  3N3G A;  1KFX L;  1A6R A;  1BP4 A;  2HXZ A;  2Y5B A;  1YAL A;  3H7D A;  1Y08 A;  4I07 A;  1PPP A;  1QMY A;  2G6D A;  2ACT A;  1K3B B;  1Y4H A;  4CDC B;  1KFU L;  2FT2 A;  2FRA A;  1AYV A;  2OP3 A;  1NPZ A;  4Q8H A;  3QT4 A;  1O0E A;  1YK8 A;  1KHP A;  2DC8 A;  3TNX A;  1JQP A;  3LFY A;  3O0U A;  1NQC A;  1IWD A;  5PAD A;  4AXM A;  1BY8 A;  1U9W A;  5CVO B;  3S3Q A;  4RY2 A;  2NQG A;  3S3R A;  3IHP A;  1QXP A;  1YVB A;  2B1M A;  2FO5 A;  5JA7 A;  4I04 A;  3CH3 X;  4PP2 E;  3PW3 A;  2OUL A;  2R9M A;  3ERV A;  2R9N A;  3I06 A;  5JH3 A;  2PBH A;  4HWY A;  9PAP A;  1THE A;  2DCA A;  3GCB A;  1PE6 A;  2E03 A;  4I05 A;  1POP A;  3LXS A;  4BPV A;  2AUX A;  1TL9 A;  1NL6 A;  4WA6 A;  1ME4 A;  3HD3 A;  3N3K A;  4YYV A;  2DC7 A;  3D6S A;  4FJC A;  2FTD A;  3H8B A;  2F1G A;  1CB5 A;  1VJV A;  1MIR A;  5A24 A;  2DCC A;  3CBK A;  1YK7 A;  3E1Z B;  4OEM A;  1ATK A;  1CJL A;  1PBH A;  4MZS A;  1AIM A;  2R9C A;  3P5U A;  1U9V A;  1XKG A;  2AU1 A;  3KX1 A;  4AXL A;  3WXG A;  4ZUX U;  1AU3 A;  3IMA A;  4CDD B;  2YJC A;  4XR7 A;  4X6J A;  1CPJ A;  2DC6 A;  1PPO A;  1M6D A;  4PP1 A;  4G54 A;  4QRX A;  2AS8 A;  2XU4 A;  3IEJ A;  2NQA A;  3OVZ A;  2FYE A;  4BSQ A;  2HH5 A;  3BCN A;  4BS5 A;  3O1G A;  3IOQ A;  1PIP A;  4CDF B;  4DMX A;  1ZCM A;  1MDW A;  3K24 A;  4X6H A;  1U5I A;  2DZY A;  1F2C A;  4FK5 A;  3MTN A;  3NHE A;  1PPD A;  3BPM A;  3OIS A;  4YV8 A;  3P5X A;  1AYU A;  1CQD A;  2NQI A;  3V6C A;  3B79 A;  5CVN B;  3IV2 A;  3M99 A;  1AU0 A;  1AEC A;  2YJ2 A;  3USV A;  2E02 A;  2FUD A;  3P5V A;  4W5B A;  7PCK A;  1F2A A;  1GEC E;  2ARY A;  2IBI A;  1TLO A;  1QOL A;  2JQG R;  4KLB A;  4CDE B;  8PCH A;  2R9F A;  2PAD A;  4DMY A;  1S4V A;  4N79 A;  2PNS A;  1PXV A;  1MEG A;  1CV8 A;  1CTE A;  3H89 A;  5F02 A;  3K8U A;  3KW9 A;  3HHA A;  2H7J A;  5EF4 A;  5K16 A;  2XU1 A;  2AYN A;  3WXF A;  3U8E A;  1PPN A;  4YYQ A;  2GHU A;  3F75 A;  2VHF A;  4BQV A;  2YJ8 A;  4X6I A;  4K7C A;  1AYW A;  2ATO A;  1ME3 A;  1EWM A;  3IUT A;  4W4U A;  1U9Q X;  2HHN A;  5CHT A;  1U9X A;  4P6G A;  2JQF R;  2XU5 A;  3HWN A;  4XUI A;  4PI3 A;  3QSD A;  6PAD A;  2YJ9 A;  3KWB X;  3K9M A;  4QBB A;  3H8C A;  1PCI A;  3MHS A;  3V6E A;  3P5W A;  2BDZ A;  4P6E A;  4Q8G A;  3ZUA A;  3I3T A;  1ZIV A;  1HUC B;  4YYW A;  3BPF A;  5CVM A;  2DJF B;  2HD5 A;  2PRE A;  1Q6K A;  3OF9 A;  2G8E A;  2R9O A;  2VHS A;  3H6S A;  4N4Z A;  1NB3 A;  5J94 A;  1BGO A;  2P86 A;  1CVZ A;  2XU3 A;  3DF0 A;  1DEU A;  3OVX A;  3KFQ A;  4YYU A;  3PNR A;  2DC9 A;  5CHV A;  2IPP B;  2DJG B;  1PAD A;  4CZW A;  2AUZ A;  1MHW A;  3WXE A;  1FH0 A;  1CS8 A;  3MOR A;  4YYS A;  3CH2 X;  1DF0 A;  1ICF A;  5FPW A;  4MZO A;  5EGW A;  1SNK A;  3OF8 A;  4OEL A;  1TU6 A;  1KXR A;  3BWK A;  4N8W A;  2FRQ A;  1EWL A;  2GFO A;  1EWP A;  1NB5 A;  3KWZ A;  3C9E A;  2FQ9 A;  2WBF X;  3QJ3 A;  1SP4 B;  2NQD B;  3BC3 A;  3N4C A;  2R6N A;  3F5V A;  2O6X A;  2AIM A;  1F29 A;  1EF7 A;  3RVX A;  2AVW A;  2G8J A;  2DZZ A;  1GLO A;  2C0Y A;  2P7U A;  2DCD A;  2P0R A;  1GCB A;  3AI8 A;  2DCB A;  1AU4 A;  2CIO A;  4FIP A;  3BOW A;  1BQI A;  2E00 A;  1KHQ A;  2AYO A;  1QDQ A;  2BDL A;  2YJB A;  1STF E;  2Y6E A;  4BS6 A; 
#chains in the Genus database with same CATH topology
 3E9S A;  2B1N A;  3MHH A;  1AU2 A;  3KSE A;  2F7D A;  2CB5 A;  4BOU A;  2JRI A;  2E01 A;  1EWO A;  1ITO A;  1MS6 A;  3PBH A;  1YT7 A;  2OZ2 A;  3HHI A;  4YYR A;  3KKU A;  3RVW A;  1CSB B;  4YVA A;  4PAD A;  1VSN A;  4QRG A;  1NLJ A;  3W31 A;  3RVV A;  1GMY A;  4D8E A;  4ZTB A;  1F2B A;  4W5C A;  3CBJ A;  1MEM A;  3OQC A;  4MSX A;  4QH6 A;  1X9Y A;  4QRV A;  4A5U A;  2G7Y A;  3PDF A;  3N3G A;  1KFX L;  1A6R A;  1BP4 A;  2HXZ A;  2Y5B A;  1YAL A;  3H7D A;  1Y08 A;  4MM3 B;  4I07 A;  1PPP A;  1QMY A;  2G6D A;  3PHX A;  4HXD B;  2ACT A;  1K3B B;  1Y4H A;  4CDC B;  1KFU L;  2FT2 A;  2FRA A;  4IUM A;  1AYV A;  2OP3 A;  1NPZ A;  4Q8H A;  3QT4 A;  1O0E A;  1YK8 A;  1KHP A;  2DC8 A;  3TNX A;  1JQP A;  3LFY A;  3O0U A;  4WUR A;  1NQC A;  1IWD A;  5PAD A;  4AXM A;  1BY8 A;  1U9W A;  2J7Q C;  3PSE A;  4GUA A;  5CVO B;  2BU3 A;  3S3Q A;  4RY2 A;  2NQG A;  2Z84 A;  3S3R A;  3IHP A;  1QXP A;  1YVB A;  2B1M A;  3PHU A;  2FO5 A;  5JA7 A;  4I04 A;  4RKX A;  3CH3 X;  4PP2 E;  4BOP A;  3PW3 A;  2OUL A;  2R9M A;  3ERV A;  2R9N A;  3MJ5 A;  2AGA A;  3I06 A;  5JH3 A;  2PBH A;  4RF0 A;  4HWY A;  2UZJ A;  9PAP A;  1THE A;  2DCA A;  3GCB A;  1PE6 A;  2E03 A;  4I05 A;  1POP A;  3LXS A;  4BPV A;  5E6J A;  2AUX A;  1YZB A;  1TL9 A;  1NL6 A;  4WA6 A;  1ME4 A;  4PT5 A;  4M0W A;  3HD3 A;  3N3K A;  4YYV A;  2DC7 A;  3D6S A;  4FJC A;  2FTD A;  3H8B A;  2F1G A;  2FE8 A;  2BTW B;  1CB5 A;  1VJV A;  1MIR A;  5A24 A;  2DCC A;  3CBK A;  1YK7 A;  3E1Z B;  4OEM A;  1ATK A;  1CJL A;  1PBH A;  4MZS A;  1AIM A;  2R9C A;  3P5U A;  1U9V A;  1XKG A;  2AU1 A;  3KX1 A;  4AXL A;  3WXG A;  4ZUX U;  1AU3 A;  3IMA A;  4CDD B;  2YJC A;  4X6J A;  1CPJ A;  2DC6 A;  4XR7 A;  1PPO A;  1M6D A;  4PP1 A;  4G54 A;  4QRX A;  2AS8 A;  2XU4 A;  3IEJ A;  2NQA A;  3OVZ A;  2FYE A;  4OW0 A;  4BSQ A;  3PT2 A;  2HH5 A;  3BCN A;  4BS5 A;  3O1G A;  4D8I A;  3IOQ A;  1PIP A;  4CDF B;  4DMX A;  1ZCM A;  1MDW A;  3K24 A;  4X6H A;  3TMP A;  1U5I A;  2DZY A;  1F2C A;  4FK5 A;  3MTN A;  3BB7 A;  3NHE A;  1PPD A;  3BPM A;  3OIS A;  4YV8 A;  3P5X A;  1AYU A;  4RNA A;  4OVZ A;  1CQD A;  2NQI A;  3V6C A;  3B79 A;  5CVN B;  3IV2 A;  3M99 A;  1AU0 A;  1AEC A;  2YJ2 A;  3USV A;  2E02 A;  3ZNH A;  2FUD A;  3P5V A;  4BOZ A;  4W5B A;  7PCK A;  1F2A A;  1GEC E;  2ARY A;  2IBI A;  1TLO A;  1QOL A;  2JQG R;  4KLB A;  4CDE B;  8PCH A;  2R9F A;  2PAD A;  4DMY A;  1S4V A;  4N79 A;  2PNS A;  1PXV A;  1MEG A;  1CV8 A;  1CTE A;  3H89 A;  5F02 A;  3K8U A;  3PRM A;  3KW9 A;  4IP3 A;  3HHA A;  2H7J A;  5EF4 A;  5K16 A;  2XU1 A;  4XZX A;  2AYN A;  3WXF A;  3U8E A;  1PPN A;  4YYQ A;  2GHU A;  1DKI A;  2DOS A;  2HWK A;  3F75 A;  2VHF A;  3BY4 A;  4REZ A;  4BQV A;  2YJ8 A;  5EZS A;  4BOQ A;  4X6I A;  2JTC A;  4K7C A;  1AYW A;  2ATO A;  1ME3 A;  1UKF A;  1EWM A;  3IUT A;  4W4U A;  1U9Q X;  2HHN A;  5CHT A;  1U9X A;  4P6G A;  2JQF R;  2XU5 A;  3HWN A;  4XUI A;  4OVZ B;  4PI3 A;  3QSD A;  6PAD A;  2YJ9 A;  3KWB X;  3K9M A;  4QBB A;  3H8C A;  1PCI A;  3MHS A;  3V6E A;  3P5W A;  2BDZ A;  4P6E A;  4Q8G A;  3ZUA A;  3W30 A;  3I3T A;  3O65 A;  1ZIV A;  1HUC B;  3IFU A;  4YYW A;  3BPF A;  3RNV A;  5CVM A;  2DJF B;  5KO3 A;  2HD5 A;  2PRE A;  1Q6K A;  3OF9 A;  2G8E A;  2R9O A;  2VHS A;  3H6S A;  1PVJ A;  4N4Z A;  4P16 A;  1NB3 A;  5J94 A;  1BGO A;  2P86 A;  1CVZ A;  2XU3 A;  3DF0 A;  1DEU A;  3OVX A;  3KFQ A;  4YYU A;  3PNR A;  2DC9 A;  5CHV A;  2IPP B;  2DJG B;  1PAD A;  4CZW A;  2AUZ A;  1MHW A;  3WXE A;  1FH0 A;  3PRP A;  1CS8 A;  3MOR A;  4YYS A;  2J7Q A;  4R3D A;  3CH2 X;  1DF0 A;  1ICF A;  2BTW A;  5FPW A;  4MZO A;  5EGW A;  1SNK A;  3OF8 A;  4OEL A;  4N8W A;  1TU6 A;  1KXR A;  3BWK A;  3PHW A;  3BBA A;  2FRQ A;  4BOS A;  1EWL A;  2GFO A;  3B21 A;  1EWP A;  1NB5 A;  3KWZ A;  3C9E A;  2FQ9 A;  2WBF X;  3QJ3 A;  1SP4 B;  2NQD B;  3MP2 A;  3BC3 A;  3N4C A;  2R6N A;  3F5V A;  2O6X A;  3TRK A;  2AIM A;  1F29 A;  1EF7 A;  3RVX A;  2AVW A;  2G8J A;  2DZZ A;  4D8B A;  1GLO A;  2C0Y A;  2P7U A;  2DCD A;  2P0R A;  1GCB A;  3AI8 A;  5JZE A;  2DCB A;  4MI7 A;  1AU4 A;  2CIO A;  4FIP A;  3MTV A;  3BOW A;  1BQI A;  5EZQ A;  4RF1 A;  2E00 A;  1KHQ A;  2AYO A;  1QDQ A;  2BDL A;  2YJB A;  1STF E;  2Y6E A;  4BS6 A;  3C0R A; 
#chains in the Genus database with same CATH homology
 2B1N A;  3MHH A;  1AU2 A;  3KSE A;  2F7D A;  2CB5 A;  2E01 A;  1W5R A;  1EWO A;  1ITO A;  1MS6 A;  3PBH A;  1YT7 A;  2OZ2 A;  3HHI A;  4YYR A;  3KKU A;  3RVW A;  1CSB B;  4YVA A;  4PAD A;  1VSN A;  4QRG A;  1NLJ A;  3RVV A;  1GMY A;  1F2B A;  4W5C A;  3CBJ A;  1MEM A;  4MSX A;  4QH6 A;  1X9Y A;  4QRV A;  2G7Y A;  3PDF A;  3N3G A;  1KFX L;  1A6R A;  1BP4 A;  2HXZ A;  2Y5B A;  1YAL A;  3H7D A;  1Y08 A;  4I07 A;  1PPP A;  1QMY A;  2G6D A;  2ACT A;  1K3B B;  1Y4H A;  4CDC B;  1KFU L;  2FT2 A;  2FRA A;  1AYV A;  2OP3 A;  1NPZ A;  4NV8 A;  4Q8H A;  3QT4 A;  1O0E A;  1YK8 A;  1KHP A;  2DC8 A;  3TNX A;  1JQP A;  3LFY A;  3O0U A;  1E2T A;  1NQC A;  1IWD A;  5PAD A;  1W6F A;  4AXM A;  1BY8 A;  1U9W A;  5CVO B;  3S3Q A;  4RY2 A;  2NQG A;  3S3R A;  3D9W A;  3IHP A;  1QXP A;  1YVB A;  2B1M A;  2FO5 A;  5JA7 A;  4I04 A;  3CH3 X;  4PP2 E;  3PW3 A;  2OUL A;  2R9M A;  3ERV A;  2VFB A;  2R9N A;  3I06 A;  5JH3 A;  2PBH A;  4HWY A;  9PAP A;  1THE A;  2DCA A;  3GCB A;  1PE6 A;  2E03 A;  4I05 A;  1POP A;  3LXS A;  4BPV A;  2AUX A;  1TL9 A;  1NL6 A;  4WA6 A;  1ME4 A;  3HD3 A;  3N3K A;  4YYV A;  2DC7 A;  4BGF A;  3D6S A;  4FJC A;  2FTD A;  3H8B A;  2F1G A;  1CB5 A;  1VJV A;  1MIR A;  5A24 A;  1W4T A;  2DCC A;  3CBK A;  1YK7 A;  3E1Z B;  4OEM A;  1ATK A;  1CJL A;  1PBH A;  4MZS A;  1AIM A;  2R9C A;  3P5U A;  1U9V A;  1XKG A;  2AU1 A;  3KX1 A;  4AXL A;  3WXG A;  4ZUX U;  1AU3 A;  3IMA A;  4CDD B;  2YJC A;  4XR7 A;  4X6J A;  1CPJ A;  2DC6 A;  1PPO A;  1M6D A;  4PP1 A;  4G54 A;  4QRX A;  2AS8 A;  2XU4 A;  3IEJ A;  2NQA A;  3OVZ A;  2FYE A;  4BSQ A;  2HH5 A;  3BCN A;  4BS5 A;  3O1G A;  3IOQ A;  1PIP A;  4C5P A;  4CDF B;  4DMX A;  1ZCM A;  4GUZ A;  1MDW A;  3K24 A;  4X6H A;  1U5I A;  2DZY A;  1F2C A;  4FK5 A;  3MTN A;  3NHE A;  1PPD A;  3BPM A;  3OIS A;  4YV8 A;  3P5X A;  1AYU A;  1CQD A;  2NQI A;  3V6C A;  3B79 A;  5CVN B;  3IV2 A;  3M99 A;  1AU0 A;  1AEC A;  2YJ2 A;  3USV A;  2E02 A;  2FUD A;  3P5V A;  4W5B A;  7PCK A;  1F2A A;  1GEC E;  2ARY A;  2IBI A;  2BSZ A;  1TLO A;  1QOL A;  2JQG R;  4KLB A;  4CDE B;  8PCH A;  2R9F A;  2PAD A;  4DMY A;  1S4V A;  4N79 A;  2PNS A;  1PXV A;  1MEG A;  1CV8 A;  1CTE A;  3H89 A;  5F02 A;  3K8U A;  3KW9 A;  3HHA A;  2H7J A;  5EF4 A;  5K16 A;  2XU1 A;  2AYN A;  3WXF A;  3U8E A;  1PPN A;  4YYQ A;  2GHU A;  3F75 A;  2VHF A;  4BQV A;  2YJ8 A;  4X6I A;  4K7C A;  1AYW A;  2ATO A;  1ME3 A;  1EWM A;  3IUT A;  4W4U A;  1U9Q X;  2HHN A;  5CHT A;  1U9X A;  4P6G A;  2JQF R;  2XU5 A;  3HWN A;  4XUI A;  4PI3 A;  3QSD A;  6PAD A;  2YJ9 A;  3KWB X;  3K9M A;  4QBB A;  3H8C A;  1PCI A;  3MHS A;  3V6E A;  3P5W A;  2BDZ A;  4P6E A;  4Q8G A;  3ZUA A;  3I3T A;  1ZIV A;  1HUC B;  4YYW A;  3BPF A;  5CVM A;  2DJF B;  2HD5 A;  2PRE A;  1Q6K A;  3OF9 A;  2G8E A;  2R9O A;  2VHS A;  3H6S A;  4N4Z A;  1NB3 A;  5J94 A;  1BGO A;  2P86 A;  1CVZ A;  2XU3 A;  3DF0 A;  1DEU A;  3OVX A;  2VFC A;  3KFQ A;  4YYU A;  3PNR A;  2DC9 A;  5CHV A;  2IPP B;  2DJG B;  1PAD A;  4CZW A;  2AUZ A;  1MHW A;  3WXE A;  1FH0 A;  4NV7 A;  1CS8 A;  3MOR A;  4B55 A;  4YYS A;  3CH2 X;  1DF0 A;  1ICF A;  5FPW A;  4MZO A;  5EGW A;  1SNK A;  3OF8 A;  4OEL A;  1TU6 A;  1KXR A;  3BWK A;  4N8W A;  2FRQ A;  1EWL A;  2GFO A;  1GX3 A;  1EWP A;  1NB5 A;  3KWZ A;  3C9E A;  2FQ9 A;  2WBF X;  3QJ3 A;  1SP4 B;  2NQD B;  3BC3 A;  3N4C A;  2R6N A;  3LTW A;  3F5V A;  2O6X A;  2AIM A;  1F29 A;  1EF7 A;  3RVX A;  2AVW A;  2G8J A;  2DZZ A;  1GLO A;  2C0Y A;  2P7U A;  2DCD A;  2P0R A;  1GCB A;  3AI8 A;  2DCB A;  1AU4 A;  2CIO A;  4FIP A;  3BOW A;  1BQI A;  2E00 A;  1KHQ A;  2AYO A;  1QDQ A;  2BDL A;  2YJB A;  1STF E;  2Y6E A;  4BS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...