4BQVA

Mouse cathepsin s with covalent ligand
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
TLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN S
publication title Cathepsin S Nitrile Inhibitors
rcsb
source organism Mus musculus
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4bqvA00
2FT2A 3N3GA 3K24A 2HXZA 2R9OA 2YJBA 3ZUAA 2PADA 1AYUA 2DCAA 1YK7A 9PAPA 2P0RA 2VHSA 3K9MA 1CB5A 3N3KA 1U9VA 4YYWA 4N8WA 3OF9A 4YYRA 3V6EA 2O6XA 1X9YA 3BWKA 3U8EA 2FUDA 4CDEB 6PADA 3LFYA 2HHNA 4X6JA 3GCBA 3S3QA 2P7UA 3F75A 2WBFX 5EF4A 1S4VA 3HHIA 2C0YA 2HD5A 1VSNA 5J94A 1YALA 2NQIA 4RY2A 3KFQA 1MEGA 1AECA 1AIMA 3KWBX 2R9MA 4AXLA 4YV8A 1PXVA 2JQGR 8PCHA 3BC3A 5CVNB 3OISA 1KHQA 4DMYA 1GLOA 1ITOA 5JH3A 3HD3A 2H7JA 4PI3A 1PADA 1Q6KA 4Q8GA 2ACTA 1KHPA 1TLOA 2R9CA 4KLBA 3QT4A 1HUCB 1A6RA 2PNSA 3QSDA 3E1ZB 3USVA 3CH2X 3MORA 1AU4A 3N4CA 5F02A 2FTDA 4WA6A 3H7DA 4FIPA 3KSEA 4W5CA 5CHVA 2XU3A 2G7YA 3IV2A 4QBBA 3IEJA 4OELA 3TNXA 1ZIVA 1AYVA 2F7DA 1JQPA 3KX1A 3I3TA 1GMYA 2YJ9A 1MEMA 4X6IA 3BPMA 4I05A 1O0EA 4N79A 1ICFA 1PPPA 4N4ZA 3OF8A 3KWZA 3IOQA 3PBHA 3CBKA 3RVXA 3QJ3A 4QRXA 1KXRA 4FJCA 1ME3A 2E00A 2JQFR 2B1MA 3WXGA 3I06A 3KW9A 3H89A 1CSBB 4CDFB 4YYSA 2B1NA 2XU1A 1CVZA 4G54A 1ZCMA 4K7CA 1U9QX 1BP4A 1AU0A 2VHFA 3HHAA 5FPWA 1AYWA 1CPJA 1SNKA 1TU6A 2CIOA 4I04A 1NLJA 1YT7A 4DMXA 3P5WA 4BS5A 4CDDB 1SP4B 3O0UA 1AU3A 3K8UA 3RVWA 1AU2A 3O1GA 2ARYA 2FO5A 1ATKA 4XUIA 4YVAA 1DF0A 2E02A 3AI8A 4X6HA 1VJVA 1EWOA 3HWNA 2OZ2A 2G8JA 4MZOA 5JA7A 4I07A 2DC8A 1KFXL 2FRAA 1STFE 2FRQA 2E03A 4QH6A 2DCDA 4PADA 1MDWA 3DF0A 3BCNA 3M99A 4MZSA 2G8EA 5CVOB 3PDFA 1NPZA 5PADA 4CZWA 2ATOA 1YVBA 4XR7A 1PPNA 2OULA 1PIPA 3V6CA 1MIRA 1EWPA 3PNRA 4BS6A 2DJGB 1CJLA 1F2BA 3P5UA 5CHTA 2Y6EA 4BQVA 4W5BA 2R6NA 1NQCA 3C9EA 4FK5A 2AVWA 1CTEA 4QRVA 2Y5BA 2DCBA 2AYOA 1BY8A 1PPDA 1F29A 2AUZA 1U9XA 3MTNA 3S3RA 3D6SA 2NQDB 3B79A 2XU5A 2GHUA 1POPA 2BDZA 3OVZA 2CB5A 3MHSA 3PW3A 1EF7A 2IBIA 2R9FA 2YJCA 2FYEA 1M6DA 1THEA 2DJFB 2F1GA 4MSXA 4HWYA 2DZZA 2DC6A 3IUTA 4PP1A 1XKGA 2DCCA 2HH5A 1FH0A 1U9WA 4YYQA 1GECE 1CQDA 3WXFA 1PE6A 4YYUA 2GFOA 2NQAA 4CDCB 1BQIA 3RVVA 1IWDA 1CV8A 2G6DA 2FQ9A 1DEUA 4BSQA 2AS8A 2BDLA 7PCKA 2DC9A 1QXPA 3CBJA 2XU4A 1K3BB 1GCBA 4YYVA 1MS6A 3BOWA 3IHPA 1PPOA 1NB3A 4P6EA 4P6GA 4OEMA 3H6SA 4BPVA 5EGWA 3BPFA 3H8BA 2IPPB 2R9NA 2PREA 2AUXA 2YJ8A 3H8CA 1NL6A 2YJ2A 2AIMA 1PCIA 4QRGA 3MHHA 1EWMA 5K16A 3KKUA 2AYNA 2P86A 3F5VA 5CVMA 1Y08A 1F2CA 3ERVA 1QOLA 1YK8A 2NQGA 1Y4HA 4ZUXU 2DC7A 3CH3X 1PBHA 1BGOA 3IMAA 1F2AA 4PP2E 3OVXA 4AXMA 2PBHA 3P5VA 1U5IA 5A24A 3P5XA 3LXSA 3NHEA 1TL9A 1KFUL 1QMYA 1EWLA 2DZYA 3WXEA 1ME4A 1CS8A 4W4UA 1QDQA 2E01A 4Q8HA 2OP3A 1MHWA 2AU1A 1NB5A
chains in the Genus database with same CATH superfamily
2FT2A 3N3GA 3K24A 2HXZA 4OW0A 2R9OA 2YJBA 3ZUAA 2PADA 1AYUA 2DCAA 1YK7A 9PAPA 1PVJA 2P0RA 2VHSA 3K9MA 1CB5A 3N3KA 4BOQA 1U9VA 4YYWA 4N8WA 3OF9A 2J7QC 4BOSA 4YYRA 3V6EA 2O6XA 1X9YA 3BWKA 3U8EA 2FUDA 4CDEB 4IP3A 6PADA 3RNVA 3LFYA 2HHNA 3MTVA 4X6JA 2Z84A 3GCBA 3S3QA 2HWKA 2P7UA 3F75A 2WBFX 5EF4A 1S4VA 3HHIA 2C0YA 2HD5A 1VSNA 5J94A 1YALA 3PT2A 2NQIA 4RY2A 3KFQA 4R3DA 1MEGA 1AECA 1DKIA 1AIMA 3KWBX 2R9MA 4AXLA 4M0WA 4YV8A 1PXVA 2JTCA 2JQGR 8PCHA 3BC3A 5CVNB 3OISA 1KHQA 4DMYA 1GLOA 3PHWA 1ITOA 3HD3A 5JH3A 3C0RA 3E9SA 4REZA 2H7JA 4PI3A 1PADA 1Q6KA 2ACTA 1KHPA 4Q8GA 1TLOA 4MM3B 2R9CA 4KLBA 3QT4A 1HUCB 1A6RA 2PNSA 3QSDA 3E1ZB 3USVA 3CH2X 3MORA 1AU4A 3N4CA 5F02A 2FTDA 4WA6A 4RNAA 3H7DA 4FIPA 3KSEA 4W5CA 5CHVA 2XU3A 3PRMA 2G7YA 3IV2A 4QBBA 4P16A 3IEJA 4OELA 3TNXA 1ZIVA 1AYVA 2F7DA 1JQPA 3KX1A 3I3TA 1GMYA 2YJ9A 4XZXA 4BOZA 1MEMA 4X6IA 5KO3A 3BPMA 4I05A 1O0EA 4N79A 1ICFA 1PPPA 4N4ZA 3OF8A 3KWZA 3IOQA 3PBHA 3CBKA 3RVXA 2DOSA 3QJ3A 4QRXA 1KXRA 3B21A 4FJCA 1ME3A 2E00A 2JQFR 2B1MA 3WXGA 3I06A 3KW9A 3H89A 1CSBB 4CDFB 4YYSA 3BB7A 2B1NA 3PHUA 2XU1A 1CVZA 4G54A 2UZJA 2BU3A 1ZCMA 2BTWA 4K7CA 3MP2A 1U9QX 1BP4A 1AU0A 2VHFA 3HHAA 5FPWA 1AYWA 1CPJA 1SNKA 1TU6A 2CIOA 4I04A 1NLJA 1YT7A 4DMXA 3P5WA 4BS5A 4CDDB 1SP4B 5JZEA 3O0UA 3BY4A 1AU3A 4IUMA 3K8UA 3RVWA 1AU2A 3O1GA 2ARYA 2FO5A 1ATKA 4XUIA 4YVAA 1DF0A 2E02A 3AI8A 3BBAA 4X6HA 1VJVA 1EWOA 2BTWB 3HWNA 2OZ2A 2G8JA 4MZOA 5JA7A 4I07A 2DC8A 1KFXL 2FRAA 1STFE 2FRQA 2E03A 4QH6A 5EZSA 2DCDA 4PADA 1MDWA 3DF0A 3BCNA 3M99A 4MZSA 4OVZA 2G8EA 5CVOB 3PDFA 1NPZA 5PADA 4CZWA 2ATOA 1YVBA 4XR7A 1PPNA 2OULA 1PIPA 3V6CA 1MIRA 3O65A 1EWPA 4WURA 3PNRA 4BS6A 4A5UA 2DJGB 4RKXA 1CJLA 1F2BA 3P5UA 5CHTA 2Y6EA 4BQVA 4W5BA 2R6NA 1NQCA 3C9EA 4FK5A 2AVWA 1CTEA 4QRVA 2Y5BA 2DCBA 2AYOA 1BY8A 1PPDA 1F29A 2AUZA 1U9XA 3MTNA 3S3RA 3W31A 3D6SA 2NQDB 4HXDB 3B79A 4OVZB 2XU5A 2GHUA 1POPA 1YZBA 3OVZA 2BDZA 3MHSA 2CB5A 5EZQA 3PW3A 1EF7A 2IBIA 2R9FA 2YJCA 2FYEA 1M6DA 1THEA 3PHXA 2DJFB 2F1GA 4MSXA 4HWYA 3TRKA 2DZZA 4MI7A 2DC6A 3PSEA 3IUTA 4PP1A 1XKGA 2DCCA 2HH5A 1FH0A 1U9WA 2J7QA 4YYQA 1GECE 1CQDA 3WXFA 1PE6A 4YYUA 2GFOA 2NQAA 5E6JA 4CDCB 1BQIA 3RVVA 1IWDA 3OQCA 1CV8A 2G6DA 2FQ9A 1DEUA 4BOPA 4BSQA 2JRIA 3MJ5A 2AS8A 2BDLA 3W30A 4ZTBA 7PCKA 2DC9A 4PT5A 1QXPA 3CBJA 2XU4A 1K3BB 1GCBA 4YYVA 1MS6A 3BOWA 3IHPA 1PPOA 1NB3A 4P6EA 4P6GA 4OEMA 3H6SA 4BPVA 5EGWA 3BPFA 3H8BA 2IPPB 2R9NA 2PREA 2AUXA 1UKFA 2YJ8A 3IFUA 3H8CA 1NL6A 2YJ2A 3PRPA 2AIMA 4BOUA 1PCIA 4RF1A 2AGAA 4QRGA 3MHHA 1EWMA 2FE8A 5K16A 3KKUA 2AYNA 4GUAA 2P86A 3F5VA 5CVMA 3ZNHA 1Y08A 1F2CA 3ERVA 1QOLA 1YK8A 2NQGA 1Y4HA 4ZUXU 2DC7A 3CH3X 1PBHA 1BGOA 3IMAA 1F2AA 4PP2E 4D8EA 3OVXA 4AXMA 2PBHA 3P5VA 1U5IA 5A24A 3P5XA 3LXSA 3NHEA 1TL9A 1KFUL 1QMYA 1EWLA 2DZYA 4D8BA 3TMPA 3WXEA 1ME4A 4D8IA 1CS8A 4W4UA 1QDQA 2E01A 4Q8HA 2OP3A 1MHWA 4RF0A 2AU1A 1NB5A
chains in the Genus database with same CATH topology
2FT2A 3N3GA 3K24A 2HXZA 2R9OA 2YJBA 3ZUAA 2PADA 1AYUA 2DCAA 1YK7A 9PAPA 2P0RA 2VHSA 3K9MA 1CB5A 3N3KA 1U9VA 4YYWA 4N8WA 3OF9A 2VFBA 4YYRA 3V6EA 2O6XA 1X9YA 3BWKA 3U8EA 2FUDA 4CDEB 6PADA 3LFYA 2HHNA 4B55A 4X6JA 3GCBA 3S3QA 2P7UA 3F75A 2WBFX 5EF4A 1S4VA 3HHIA 2C0YA 2HD5A 1VSNA 5J94A 1YALA 2NQIA 4RY2A 3KFQA 1MEGA 1AECA 1AIMA 3KWBX 2R9MA 4AXLA 4YV8A 1PXVA 2JQGR 8PCHA 3BC3A 5CVNB 3OISA 1KHQA 1W5RA 4DMYA 1GLOA 1ITOA 5JH3A 3HD3A 2H7JA 4PI3A 1PADA 1Q6KA 2ACTA 1KHPA 4Q8GA 1TLOA 2R9CA 4KLBA 3QT4A 1HUCB 1A6RA 2PNSA 3QSDA 3E1ZB 3USVA 3CH2X 3MORA 1AU4A 3N4CA 5F02A 2FTDA 4WA6A 3H7DA 4FIPA 3KSEA 4W5CA 5CHVA 2XU3A 2G7YA 3IV2A 4QBBA 3IEJA 4OELA 3TNXA 1ZIVA 1AYVA 2F7DA 1JQPA 3KX1A 3I3TA 1GMYA 2YJ9A 1MEMA 4X6IA 3BPMA 4I05A 1O0EA 4N79A 1ICFA 1PPPA 4N4ZA 3OF8A 3KWZA 3IOQA 3PBHA 3CBKA 3RVXA 3QJ3A 4QRXA 1KXRA 4FJCA 1ME3A 2E00A 2JQFR 2B1MA 3WXGA 3I06A 3KW9A 3H89A 1CSBB 4CDFB 4YYSA 2B1NA 2XU1A 1CVZA 4G54A 1ZCMA 4K7CA 1U9QX 1BP4A 1AU0A 2VHFA 3HHAA 5FPWA 1AYWA 1CPJA 1SNKA 1TU6A 2CIOA 4I04A 1NLJA 1YT7A 4DMXA 3P5WA 4BS5A 4CDDB 1SP4B 3O0UA 1AU3A 3K8UA 3RVWA 1AU2A 3O1GA 2ARYA 2FO5A 1ATKA 4XUIA 4YVAA 1DF0A 2E02A 3AI8A 4X6HA 1VJVA 1EWOA 3HWNA 2OZ2A 2G8JA 3D9WA 1E2TA 4MZOA 5JA7A 4NV8A 4I07A 2DC8A 1KFXL 1GX3A 2FRAA 1STFE 2FRQA 2E03A 4QH6A 2DCDA 4PADA 1MDWA 3DF0A 4C5PA 3BCNA 3M99A 4MZSA 2G8EA 5CVOB 3PDFA 1NPZA 5PADA 4CZWA 2ATOA 1YVBA 4XR7A 1PPNA 2OULA 1PIPA 3V6CA 1MIRA 1EWPA 3PNRA 4BS6A 2DJGB 1CJLA 1F2BA 3P5UA 5CHTA 2Y6EA 4BQVA 4W5BA 2R6NA 1NQCA 3C9EA 4FK5A 2AVWA 4GUZA 1CTEA 4QRVA 2Y5BA 2DCBA 2AYOA 1BY8A 1PPDA 1F29A 2AUZA 1U9XA 3MTNA 3S3RA 3D6SA 2NQDB 3B79A 2XU5A 2GHUA 1POPA 2BDZA 3OVZA 2CB5A 3MHSA 3PW3A 1EF7A 2IBIA 2R9FA 2YJCA 2FYEA 1M6DA 1THEA 2DJFB 2F1GA 4MSXA 4HWYA 2BSZA 2DZZA 2DC6A 4BGFA 3IUTA 4PP1A 1XKGA 2DCCA 2HH5A 1FH0A 1U9WA 4YYQA 1GECE 1CQDA 3WXFA 1PE6A 4YYUA 2GFOA 2NQAA 4CDCB 1BQIA 3RVVA 1IWDA 1CV8A 2G6DA 2FQ9A 1DEUA 2VFCA 4BSQA 2AS8A 2BDLA 4NV7A 7PCKA 2DC9A 1QXPA 3CBJA 2XU4A 1K3BB 1GCBA 4YYVA 1MS6A 3BOWA 3IHPA 1PPOA 1NB3A 4P6EA 4P6GA 4OEMA 3LTWA 3H6SA 4BPVA 5EGWA 3BPFA 3H8BA 2IPPB 2R9NA 2PREA 2AUXA 2YJ8A 3H8CA 1NL6A 2YJ2A 2AIMA 1PCIA 4QRGA 1W4TA 3MHHA 1EWMA 5K16A 3KKUA 2AYNA 2P86A 3F5VA 5CVMA 1Y08A 1F2CA 3ERVA 1QOLA 1YK8A 2NQGA 1Y4HA 4ZUXU 2DC7A 3CH3X 1PBHA 1BGOA 3IMAA 1F2AA 4PP2E 3OVXA 4AXMA 2PBHA 3P5VA 1U5IA 5A24A 3P5XA 3LXSA 3NHEA 1TL9A 1KFUL 1QMYA 1EWLA 2DZYA 1W6FA 3WXEA 1ME4A 1CS8A 4W4UA 1QDQA 2E01A 4Q8HA 2OP3A 1MHWA 2AU1A 1NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT2 A;  3N3G A;  3K24 A;  2HXZ A;  2R9O A;  2YJB A;  3ZUA A;  2PAD A;  1AYU A;  2DCA A;  1YK7 A;  9PAP A;  2P0R A;  2VHS A;  3K9M A;  1CB5 A;  3N3K A;  1U9V A;  4YYW A;  4N8W A;  3OF9 A;  4YYR A;  3V6E A;  2O6X A;  1X9Y A;  3BWK A;  3U8E A;  2FUD A;  4CDE B;  6PAD A;  3LFY A;  2HHN A;  4X6J A;  3GCB A;  3S3Q A;  2P7U A;  3F75 A;  2WBF X;  5EF4 A;  1S4V A;  3HHI A;  2C0Y A;  2HD5 A;  1VSN A;  5J94 A;  1YAL A;  2NQI A;  4RY2 A;  3KFQ A;  1MEG A;  1AEC A;  1AIM A;  3KWB X;  2R9M A;  4AXL A;  4YV8 A;  1PXV A;  2JQG R;  8PCH A;  3BC3 A;  5CVN B;  3OIS A;  1KHQ A;  4DMY A;  1GLO A;  1ITO A;  5JH3 A;  3HD3 A;  2H7J A;  4PI3 A;  1PAD A;  1Q6K A;  4Q8G A;  2ACT A;  1KHP A;  1TLO A;  2R9C A;  4KLB A;  3QT4 A;  1HUC B;  1A6R A;  2PNS A;  3QSD A;  3E1Z B;  3USV A;  3CH2 X;  3MOR A;  1AU4 A;  3N4C A;  5F02 A;  2FTD A;  4WA6 A;  3H7D A;  4FIP A;  3KSE A;  4W5C A;  5CHV A;  2XU3 A;  2G7Y A;  3IV2 A;  4QBB A;  3IEJ A;  4OEL A;  3TNX A;  1ZIV A;  1AYV A;  2F7D A;  1JQP A;  3KX1 A;  3I3T A;  1GMY A;  2YJ9 A;  1MEM A;  4X6I A;  3BPM A;  4I05 A;  1O0E A;  4N79 A;  1ICF A;  1PPP A;  4N4Z A;  3OF8 A;  3KWZ A;  3IOQ A;  3PBH A;  3CBK A;  3RVX A;  3QJ3 A;  4QRX A;  1KXR A;  4FJC A;  1ME3 A;  2E00 A;  2JQF R;  2B1M A;  3WXG A;  3I06 A;  3KW9 A;  3H89 A;  1CSB B;  4CDF B;  4YYS A;  2B1N A;  2XU1 A;  1CVZ A;  4G54 A;  1ZCM A;  4K7C A;  1U9Q X;  1BP4 A;  1AU0 A;  2VHF A;  3HHA A;  5FPW A;  1AYW A;  1CPJ A;  1SNK A;  1TU6 A;  2CIO A;  4I04 A;  1NLJ A;  1YT7 A;  4DMX A;  3P5W A;  4BS5 A;  4CDD B;  1SP4 B;  3O0U A;  1AU3 A;  3K8U A;  3RVW A;  1AU2 A;  3O1G A;  2ARY A;  2FO5 A;  1ATK A;  4XUI A;  4YVA A;  1DF0 A;  2E02 A;  3AI8 A;  4X6H A;  1VJV A;  1EWO A;  3HWN A;  2OZ2 A;  2G8J A;  4MZO A;  5JA7 A;  4I07 A;  2DC8 A;  1KFX L;  2FRA A;  1STF E;  2FRQ A;  2E03 A;  4QH6 A;  2DCD A;  4PAD A;  1MDW A;  3DF0 A;  3BCN A;  3M99 A;  4MZS A;  2G8E A;  5CVO B;  3PDF A;  1NPZ A;  5PAD A;  4CZW A;  2ATO A;  1YVB A;  4XR7 A;  1PPN A;  2OUL A;  1PIP A;  3V6C A;  1MIR A;  1EWP A;  3PNR A;  4BS6 A;  2DJG B;  1CJL A;  1F2B A;  3P5U A;  5CHT A;  2Y6E A;  4BQV A;  4W5B A;  2R6N A;  1NQC A;  3C9E A;  4FK5 A;  2AVW A;  1CTE A;  4QRV A;  2Y5B A;  2DCB A;  2AYO A;  1BY8 A;  1PPD A;  1F29 A;  2AUZ A;  1U9X A;  3MTN A;  3S3R A;  3D6S A;  2NQD B;  3B79 A;  2XU5 A;  2GHU A;  1POP A;  2BDZ A;  3OVZ A;  2CB5 A;  3MHS A;  3PW3 A;  1EF7 A;  2IBI A;  2R9F A;  2YJC A;  2FYE A;  1M6D A;  1THE A;  2DJF B;  2F1G A;  4MSX A;  4HWY A;  2DZZ A;  2DC6 A;  3IUT A;  4PP1 A;  1XKG A;  2DCC A;  2HH5 A;  1FH0 A;  1U9W A;  4YYQ A;  1GEC E;  1CQD A;  3WXF A;  1PE6 A;  4YYU A;  2GFO A;  2NQA A;  4CDC B;  1BQI A;  3RVV A;  1IWD A;  1CV8 A;  2G6D A;  2FQ9 A;  1DEU A;  4BSQ A;  2AS8 A;  2BDL A;  7PCK A;  2DC9 A;  1QXP A;  3CBJ A;  2XU4 A;  1K3B B;  1GCB A;  4YYV A;  1MS6 A;  3BOW A;  3IHP A;  1PPO A;  1NB3 A;  4P6E A;  4P6G A;  4OEM A;  3H6S A;  4BPV A;  5EGW A;  3BPF A;  3H8B A;  2IPP B;  2R9N A;  2PRE A;  2AUX A;  2YJ8 A;  3H8C A;  1NL6 A;  2YJ2 A;  2AIM A;  1PCI A;  4QRG A;  3MHH A;  1EWM A;  5K16 A;  3KKU A;  2AYN A;  2P86 A;  3F5V A;  5CVM A;  1Y08 A;  1F2C A;  3ERV A;  1QOL A;  1YK8 A;  2NQG A;  1Y4H A;  4ZUX U;  2DC7 A;  3CH3 X;  1PBH A;  1BGO A;  3IMA A;  1F2A A;  4PP2 E;  3OVX A;  4AXM A;  2PBH A;  3P5V A;  1U5I A;  5A24 A;  3P5X A;  3LXS A;  3NHE A;  1TL9 A;  1KFU L;  1QMY A;  1EWL A;  2DZY A;  3WXE A;  1ME4 A;  1CS8 A;  4W4U A;  1QDQ A;  2E01 A;  4Q8H A;  2OP3 A;  1MHW A;  2AU1 A;  1NB5 A; 
#chains in the Genus database with same CATH topology
 2FT2 A;  3N3G A;  3K24 A;  2HXZ A;  4OW0 A;  2R9O A;  2YJB A;  3ZUA A;  2PAD A;  1AYU A;  2DCA A;  1YK7 A;  9PAP A;  1PVJ A;  2P0R A;  2VHS A;  3K9M A;  1CB5 A;  3N3K A;  4BOQ A;  1U9V A;  4YYW A;  4N8W A;  3OF9 A;  2J7Q C;  4BOS A;  4YYR A;  3V6E A;  2O6X A;  1X9Y A;  3BWK A;  3U8E A;  2FUD A;  4CDE B;  4IP3 A;  6PAD A;  3RNV A;  3LFY A;  2HHN A;  3MTV A;  4X6J A;  2Z84 A;  3GCB A;  3S3Q A;  2HWK A;  2P7U A;  3F75 A;  2WBF X;  5EF4 A;  1S4V A;  3HHI A;  2C0Y A;  2HD5 A;  1VSN A;  5J94 A;  1YAL A;  3PT2 A;  2NQI A;  4RY2 A;  3KFQ A;  4R3D A;  1MEG A;  1AEC A;  1DKI A;  1AIM A;  3KWB X;  2R9M A;  4AXL A;  4M0W A;  4YV8 A;  1PXV A;  2JTC A;  2JQG R;  8PCH A;  3BC3 A;  5CVN B;  3OIS A;  1KHQ A;  4DMY A;  1GLO A;  3PHW A;  1ITO A;  3HD3 A;  5JH3 A;  3C0R A;  3E9S A;  4REZ A;  2H7J A;  4PI3 A;  1PAD A;  1Q6K A;  2ACT A;  1KHP A;  4Q8G A;  1TLO A;  4MM3 B;  2R9C A;  4KLB A;  3QT4 A;  1HUC B;  1A6R A;  2PNS A;  3QSD A;  3E1Z B;  3USV A;  3CH2 X;  3MOR A;  1AU4 A;  3N4C A;  5F02 A;  2FTD A;  4WA6 A;  4RNA A;  3H7D A;  4FIP A;  3KSE A;  4W5C A;  5CHV A;  2XU3 A;  3PRM A;  2G7Y A;  3IV2 A;  4QBB A;  4P16 A;  3IEJ A;  4OEL A;  3TNX A;  1ZIV A;  1AYV A;  2F7D A;  1JQP A;  3KX1 A;  3I3T A;  1GMY A;  2YJ9 A;  4XZX A;  4BOZ A;  1MEM A;  4X6I A;  5KO3 A;  3BPM A;  4I05 A;  1O0E A;  4N79 A;  1ICF A;  1PPP A;  4N4Z A;  3OF8 A;  3KWZ A;  3IOQ A;  3PBH A;  3CBK A;  3RVX A;  2DOS A;  3QJ3 A;  4QRX A;  1KXR A;  3B21 A;  4FJC A;  1ME3 A;  2E00 A;  2JQF R;  2B1M A;  3WXG A;  3I06 A;  3KW9 A;  3H89 A;  1CSB B;  4CDF B;  4YYS A;  3BB7 A;  2B1N A;  3PHU A;  2XU1 A;  1CVZ A;  4G54 A;  2UZJ A;  2BU3 A;  1ZCM A;  2BTW A;  4K7C A;  3MP2 A;  1U9Q X;  1BP4 A;  1AU0 A;  2VHF A;  3HHA A;  5FPW A;  1AYW A;  1CPJ A;  1SNK A;  1TU6 A;  2CIO A;  4I04 A;  1NLJ A;  1YT7 A;  4DMX A;  3P5W A;  4BS5 A;  4CDD B;  1SP4 B;  5JZE A;  3O0U A;  3BY4 A;  1AU3 A;  4IUM A;  3K8U A;  3RVW A;  1AU2 A;  3O1G A;  2ARY A;  2FO5 A;  1ATK A;  4XUI A;  4YVA A;  1DF0 A;  2E02 A;  3AI8 A;  3BBA A;  4X6H A;  1VJV A;  1EWO A;  2BTW B;  3HWN A;  2OZ2 A;  2G8J A;  4MZO A;  5JA7 A;  4I07 A;  2DC8 A;  1KFX L;  2FRA A;  1STF E;  2FRQ A;  2E03 A;  4QH6 A;  5EZS A;  2DCD A;  4PAD A;  1MDW A;  3DF0 A;  3BCN A;  3M99 A;  4MZS A;  4OVZ A;  2G8E A;  5CVO B;  3PDF A;  1NPZ A;  5PAD A;  4CZW A;  2ATO A;  1YVB A;  4XR7 A;  1PPN A;  2OUL A;  1PIP A;  3V6C A;  1MIR A;  3O65 A;  1EWP A;  4WUR A;  3PNR A;  4BS6 A;  4A5U A;  2DJG B;  4RKX A;  1CJL A;  1F2B A;  3P5U A;  5CHT A;  2Y6E A;  4BQV A;  4W5B A;  2R6N A;  1NQC A;  3C9E A;  4FK5 A;  2AVW A;  1CTE A;  4QRV A;  2Y5B A;  2DCB A;  2AYO A;  1BY8 A;  1PPD A;  1F29 A;  2AUZ A;  1U9X A;  3MTN A;  3S3R A;  3W31 A;  3D6S A;  2NQD B;  4HXD B;  3B79 A;  4OVZ B;  2XU5 A;  2GHU A;  1POP A;  1YZB A;  3OVZ A;  2BDZ A;  3MHS A;  2CB5 A;  5EZQ A;  3PW3 A;  1EF7 A;  2IBI A;  2R9F A;  2YJC A;  2FYE A;  1M6D A;  1THE A;  3PHX A;  2DJF B;  2F1G A;  4MSX A;  4HWY A;  3TRK A;  2DZZ A;  4MI7 A;  2DC6 A;  3PSE A;  3IUT A;  4PP1 A;  1XKG A;  2DCC A;  2HH5 A;  1FH0 A;  1U9W A;  2J7Q A;  4YYQ A;  1GEC E;  1CQD A;  3WXF A;  1PE6 A;  4YYU A;  2GFO A;  2NQA A;  5E6J A;  4CDC B;  1BQI A;  3RVV A;  1IWD A;  3OQC A;  1CV8 A;  2G6D A;  2FQ9 A;  1DEU A;  4BOP A;  4BSQ A;  2JRI A;  3MJ5 A;  2AS8 A;  2BDL A;  3W30 A;  4ZTB A;  7PCK A;  2DC9 A;  4PT5 A;  1QXP A;  3CBJ A;  2XU4 A;  1K3B B;  1GCB A;  4YYV A;  1MS6 A;  3BOW A;  3IHP A;  1PPO A;  1NB3 A;  4P6E A;  4P6G A;  4OEM A;  3H6S A;  4BPV A;  5EGW A;  3BPF A;  3H8B A;  2IPP B;  2R9N A;  2PRE A;  2AUX A;  1UKF A;  2YJ8 A;  3IFU A;  3H8C A;  1NL6 A;  2YJ2 A;  3PRP A;  2AIM A;  4BOU A;  1PCI A;  4RF1 A;  2AGA A;  4QRG A;  3MHH A;  1EWM A;  2FE8 A;  5K16 A;  3KKU A;  2AYN A;  4GUA A;  2P86 A;  3F5V A;  5CVM A;  3ZNH A;  1Y08 A;  1F2C A;  3ERV A;  1QOL A;  1YK8 A;  2NQG A;  1Y4H A;  4ZUX U;  2DC7 A;  3CH3 X;  1PBH A;  1BGO A;  3IMA A;  1F2A A;  4PP2 E;  4D8E A;  3OVX A;  4AXM A;  2PBH A;  3P5V A;  1U5I A;  5A24 A;  3P5X A;  3LXS A;  3NHE A;  1TL9 A;  1KFU L;  1QMY A;  1EWL A;  2DZY A;  4D8B A;  3TMP A;  3WXE A;  1ME4 A;  4D8I A;  1CS8 A;  4W4U A;  1QDQ A;  2E01 A;  4Q8H A;  2OP3 A;  1MHW A;  4RF0 A;  2AU1 A;  1NB5 A; 
#chains in the Genus database with same CATH homology
 2FT2 A;  3N3G A;  3K24 A;  2HXZ A;  2R9O A;  2YJB A;  3ZUA A;  2PAD A;  1AYU A;  2DCA A;  1YK7 A;  9PAP A;  2P0R A;  2VHS A;  3K9M A;  1CB5 A;  3N3K A;  1U9V A;  4YYW A;  4N8W A;  3OF9 A;  2VFB A;  4YYR A;  3V6E A;  2O6X A;  1X9Y A;  3BWK A;  3U8E A;  2FUD A;  4CDE B;  6PAD A;  3LFY A;  2HHN A;  4B55 A;  4X6J A;  3GCB A;  3S3Q A;  2P7U A;  3F75 A;  2WBF X;  5EF4 A;  1S4V A;  3HHI A;  2C0Y A;  2HD5 A;  1VSN A;  5J94 A;  1YAL A;  2NQI A;  4RY2 A;  3KFQ A;  1MEG A;  1AEC A;  1AIM A;  3KWB X;  2R9M A;  4AXL A;  4YV8 A;  1PXV A;  2JQG R;  8PCH A;  3BC3 A;  5CVN B;  3OIS A;  1KHQ A;  1W5R A;  4DMY A;  1GLO A;  1ITO A;  5JH3 A;  3HD3 A;  2H7J A;  4PI3 A;  1PAD A;  1Q6K A;  2ACT A;  1KHP A;  4Q8G A;  1TLO A;  2R9C A;  4KLB A;  3QT4 A;  1HUC B;  1A6R A;  2PNS A;  3QSD A;  3E1Z B;  3USV A;  3CH2 X;  3MOR A;  1AU4 A;  3N4C A;  5F02 A;  2FTD A;  4WA6 A;  3H7D A;  4FIP A;  3KSE A;  4W5C A;  5CHV A;  2XU3 A;  2G7Y A;  3IV2 A;  4QBB A;  3IEJ A;  4OEL A;  3TNX A;  1ZIV A;  1AYV A;  2F7D A;  1JQP A;  3KX1 A;  3I3T A;  1GMY A;  2YJ9 A;  1MEM A;  4X6I A;  3BPM A;  4I05 A;  1O0E A;  4N79 A;  1ICF A;  1PPP A;  4N4Z A;  3OF8 A;  3KWZ A;  3IOQ A;  3PBH A;  3CBK A;  3RVX A;  3QJ3 A;  4QRX A;  1KXR A;  4FJC A;  1ME3 A;  2E00 A;  2JQF R;  2B1M A;  3WXG A;  3I06 A;  3KW9 A;  3H89 A;  1CSB B;  4CDF B;  4YYS A;  2B1N A;  2XU1 A;  1CVZ A;  4G54 A;  1ZCM A;  4K7C A;  1U9Q X;  1BP4 A;  1AU0 A;  2VHF A;  3HHA A;  5FPW A;  1AYW A;  1CPJ A;  1SNK A;  1TU6 A;  2CIO A;  4I04 A;  1NLJ A;  1YT7 A;  4DMX A;  3P5W A;  4BS5 A;  4CDD B;  1SP4 B;  3O0U A;  1AU3 A;  3K8U A;  3RVW A;  1AU2 A;  3O1G A;  2ARY A;  2FO5 A;  1ATK A;  4XUI A;  4YVA A;  1DF0 A;  2E02 A;  3AI8 A;  4X6H A;  1VJV A;  1EWO A;  3HWN A;  2OZ2 A;  2G8J A;  3D9W A;  1E2T A;  4MZO A;  5JA7 A;  4NV8 A;  4I07 A;  2DC8 A;  1KFX L;  1GX3 A;  2FRA A;  1STF E;  2FRQ A;  2E03 A;  4QH6 A;  2DCD A;  4PAD A;  1MDW A;  3DF0 A;  4C5P A;  3BCN A;  3M99 A;  4MZS A;  2G8E A;  5CVO B;  3PDF A;  1NPZ A;  5PAD A;  4CZW A;  2ATO A;  1YVB A;  4XR7 A;  1PPN A;  2OUL A;  1PIP A;  3V6C A;  1MIR A;  1EWP A;  3PNR A;  4BS6 A;  2DJG B;  1CJL A;  1F2B A;  3P5U A;  5CHT A;  2Y6E A;  4BQV A;  4W5B A;  2R6N A;  1NQC A;  3C9E A;  4FK5 A;  2AVW A;  4GUZ A;  1CTE A;  4QRV A;  2Y5B A;  2DCB A;  2AYO A;  1BY8 A;  1PPD A;  1F29 A;  2AUZ A;  1U9X A;  3MTN A;  3S3R A;  3D6S A;  2NQD B;  3B79 A;  2XU5 A;  2GHU A;  1POP A;  2BDZ A;  3OVZ A;  2CB5 A;  3MHS A;  3PW3 A;  1EF7 A;  2IBI A;  2R9F A;  2YJC A;  2FYE A;  1M6D A;  1THE A;  2DJF B;  2F1G A;  4MSX A;  4HWY A;  2BSZ A;  2DZZ A;  2DC6 A;  4BGF A;  3IUT A;  4PP1 A;  1XKG A;  2DCC A;  2HH5 A;  1FH0 A;  1U9W A;  4YYQ A;  1GEC E;  1CQD A;  3WXF A;  1PE6 A;  4YYU A;  2GFO A;  2NQA A;  4CDC B;  1BQI A;  3RVV A;  1IWD A;  1CV8 A;  2G6D A;  2FQ9 A;  1DEU A;  2VFC A;  4BSQ A;  2AS8 A;  2BDL A;  4NV7 A;  7PCK A;  2DC9 A;  1QXP A;  3CBJ A;  2XU4 A;  1K3B B;  1GCB A;  4YYV A;  1MS6 A;  3BOW A;  3IHP A;  1PPO A;  1NB3 A;  4P6E A;  4P6G A;  4OEM A;  3LTW A;  3H6S A;  4BPV A;  5EGW A;  3BPF A;  3H8B A;  2IPP B;  2R9N A;  2PRE A;  2AUX A;  2YJ8 A;  3H8C A;  1NL6 A;  2YJ2 A;  2AIM A;  1PCI A;  4QRG A;  1W4T A;  3MHH A;  1EWM A;  5K16 A;  3KKU A;  2AYN A;  2P86 A;  3F5V A;  5CVM A;  1Y08 A;  1F2C A;  3ERV A;  1QOL A;  1YK8 A;  2NQG A;  1Y4H A;  4ZUX U;  2DC7 A;  3CH3 X;  1PBH A;  1BGO A;  3IMA A;  1F2A A;  4PP2 E;  3OVX A;  4AXM A;  2PBH A;  3P5V A;  1U5I A;  5A24 A;  3P5X A;  3LXS A;  3NHE A;  1TL9 A;  1KFU L;  1QMY A;  1EWL A;  2DZY A;  1W6F A;  3WXE A;  1ME4 A;  1CS8 A;  4W4U A;  1QDQ A;  2E01 A;  4Q8H A;  2OP3 A;  1MHW A;  2AU1 A;  1NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...