4BOQA

Structure of otud2 otu domain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
b'KRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN THIOESTERASE OTU1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 175
sequence length 175
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4boqA00
3BY4A 3TMPA 3PHWA 5JZEA 3ZNHA 4BOUA 3PRPA 3PSEA 4BOZA 3PHUA 3PT2A 4BOQA 4BOPA 3PRMA 3C0RA 3PHXA 4BOSA 4HXDB
chains in the Genus database with same CATH superfamily
1S4VA 3B21A 4REZA 4Q8GA 4D8IA 2E03A 4XR7A 2YJBA 1YALA 2JTCA 3MJ5A 4P16A 1AU3A 2R9CA 1U5IA 2HXZA 4BOPA 4OVZA 4FK5A 3HWNA 1PPDA 3OF8A 2PADA 1YZBA 2Z84A 2NQIA 2R9NA 3PHUA 3PT2A 4I04A 2AIMA 3OF9A 4PP2E 4W5BA 1F29A 2FRQA 3IOQA 4CDCB 3D6SA 5EGWA 4YYUA 1DF0A 3BBAA 3MHSA 2G7YA 3ZUAA 2E02A 5E6JA 1YK7A 5FPWA 1VSNA 2AGAA 4OEMA 3H8CA 5EZSA 5A24A 1CJLA 4RY2A 2FRAA 3PRPA 4YYSA 4YYWA 1TU6A 4YV8A 4WURA 4CDDB 3PHWA 1QOLA 3TRKA 3IFUA 1NB3A 3KSEA 3OVXA 3W30A 2DC7A 5JH3A 1CS8A 2JQGR 3C0RA 1AIMA 3IEJA 1EWLA 2XU4A 2JQFR 3E1ZB 2IPPB 3IMAA 2Y5BA 3K9MA 3P5XA 2DZYA 2FE8A 9PAPA 3CH2X 1YT7A 2DOSA 2FYEA 4X6JA 7PCKA 1BQIA 2XU1A 4CDFB 2B1NA 3U8EA 4MM3B 3KW9A 1KHQA 1AU4A 3MHHA 3P5WA 4ZTBA 5CHVA 2E01A 4IUMA 2AYNA 3GCBA 3IV2A 4A5UA 2FT2A 3BC3A 3MTVA 3W31A 2YJ9A 5F02A 1NQCA 1TL9A 2H7JA 3F75A 4BPVA 3ERVA 5CVMA 3V6CA 2OULA 3HHIA 3H89A 3RVVA 3PBHA 3TMPA 4CDEB 1IWDA 1QMYA 1MDWA 1DKIA 1A6RA 2WBFX 1MS6A 2P86A 1CSBB 1F2CA 1GECE 2GFOA 1PE6A 4WA6A 4N8WA 2OP3A 3RVXA 2ARYA 3E9SA 4D8EA 4QRGA 2XU5A 4MI7A 5J94A 1M6DA 3CBKA 1EWMA 2DCBA 4QH6A 2VHFA 2DCAA 3HD3A 1PPPA 1CQDA 4KLBA 1F2BA 2NQAA 1PXVA 1CPJA 2F1GA 1KXRA 1AU0A 4XUIA 2DC6A 3LFYA 4BSQA 3CBJA 3PSEA 1PPNA 3OISA 2FO5A 2UZJA 1U9QX 2BDZA 1QDQA 4BS6A 4QBBA 4OELA 3S3QA 2G8JA 4X6IA 3S3RA 3RVWA 2ATOA 1ZCMA 1PCIA 4R3DA 3BB7A 1ICFA 3ZNHA 4BOZA 1AYWA 4MSXA 4PP1A 2DZZA 2J7QC 3K24A 3QSDA 1U9VA 1NB5A 1EF7A 1KHPA 4AXLA 4I07A 3USVA 3O0UA 2AUXA 1BGOA 1GCBA 1MIRA 3MORA 3OQCA 4BOSA 3M99A 2F7DA 2G6DA 1X9YA 1K3BB 4D8BA 2NQGA 3HHAA 1ME4A 3B79A 4HXDB 1ATKA 2VHSA 1CB5A 2HWKA 1Y08A 1NLJA 3P5VA 4FJCA 1CVZA 3IUTA 2J7QA 2P7UA 4HWYA 3BY4A 2HHNA 5CVOB 1Y4HA 2AUZA 2DC9A 1AU2A 2HH5A 1THEA 4YYVA 5JZEA 1F2AA 4RF1A 1CV8A 3O65A 2FUDA 2P0RA 1PVJA 2R9MA 2YJCA 3AI8A 3KX1A 1ITOA 4QRVA 4YYRA 3H8BA 3MP2A 3OVZA 3KWZA 2Y6EA 4M0WA 4CZWA 1EWPA 3WXGA 1CTEA 2NQDB 2BTWB 2DJGB 4QRXA 3N3GA 2BU3A 4BOQA 3N4CA 1FH0A 3F5VA 1MHWA 3CH3X 2DCCA 2R9OA 3O1GA 4RNAA 4N4ZA 1TLOA 1POPA 2PNSA 1KFUL 6PADA 2GHUA 4DMYA 3PNRA 1YK8A 3BWKA 5CVNB 1GMYA 2AU1A 3PW3A 3RNVA 1PPOA 3MTNA 5PADA 1MEMA 4I05A 1NPZA 3LXSA 2PREA 3BCNA 2O6XA 1GLOA 2AVWA 3PRMA 1PBHA 1Q6KA 1HUCB 4K7CA 1STFE 1PADA 4MZSA 4PI3A 3V6EA 4MZOA 3KFQA 4ZUXU 4YYQA 4AXMA 1O0EA 1QXPA 4RKXA 4BS5A 3I3TA 2IBIA 1EWOA 3BOWA 1ZIVA 3QJ3A 1SNKA 1AECA 3I06A 2PBHA 2CB5A 4P6GA 3NHEA 2C0YA 4W4UA 3BPFA 5CHTA 3WXFA 4Q8HA 2HD5A 3TNXA 1VJVA 3H7DA 2DCDA 1AYUA 2BTWA 5EZQA 8PCHA 4OW0A 4OVZB 3DF0A 4G54A 3BPMA 4GUAA 4N79A 1BP4A 1NL6A 2R6NA 2JRIA 4PADA 1ME3A 2FTDA 2FQ9A 4FIPA 2XU3A 3P5UA 4XZXA 4RF0A 4W5CA 1KFXL 4X6HA 1BY8A 2DC8A 3KKUA 2ACTA 1DEUA 2OZ2A 2YJ8A 4IP3A 3K8UA 1U9WA 1XKGA 4BOUA 1AYVA 1YVBA 5EF4A 1UKFA 4YVAA 5KO3A 1MEGA 2AYOA 4P6EA 2E00A 2R9FA 2CIOA 2YJ2A 3QT4A 2BDLA 5JA7A 3KWBX 3WXEA 2AS8A 3IHPA 3H6SA 3PHXA 2DJFB 5K16A 4PT5A 4DMXA 4BQVA 1PIPA 3PDFA 1SP4B 1U9XA 3C9EA 1JQPA 2B1MA 2G8EA 3N3KA
chains in the Genus database with same CATH topology
4IUMA 4A5UA 3B21A 4D8BA 4RKXA 3MTVA 4REZA 3W31A 4D8IA 2JTCA 3MJ5A 4P16A 4HXDB 2HWKA 4BOPA 4OVZA 3TMPA 2J7QA 3BY4A 2Z84A 1DKIA 1YZBA 3PHUA 3PT2A 2BTWA 5EZQA 3E9SA 4OW0A 4OVZB 4D8EA 3BBAA 5JZEA 4RF1A 4GUAA 3O65A 4MI7A 1PVJA 2JRIA 5E6JA 4XZXA 2AGAA 4RF0A 3MP2A 4M0WA 3PRPA 4IP3A 2BTWB 4WURA 3PHWA 4BOUA 2BU3A 4BOQA 3TRKA 3IFUA 3W30A 1UKFA 5KO3A 3PSEA 3C0RA 4RNAA 2UZJA 4R3DA 3BB7A 3ZNHA 4BOZA 3RNVA 2FE8A 2J7QC 2DOSA 3PRMA 3PHXA 4MM3B 4PT5A 3OQCA 4ZTBA 5EZSA 4BOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY4 A;  3TMP A;  3PHW A;  5JZE A;  3ZNH A;  4BOU A;  3PRP A;  3PSE A;  4BOZ A;  3PHU A;  3PT2 A;  4BOQ A;  4BOP A;  3PRM A;  3C0R A;  3PHX A;  4BOS A;  4HXD B; 
#chains in the Genus database with same CATH topology
 1S4V A;  3B21 A;  4REZ A;  4Q8G A;  4D8I A;  2E03 A;  4XR7 A;  2YJB A;  1YAL A;  2JTC A;  3MJ5 A;  4P16 A;  1AU3 A;  2R9C A;  1U5I A;  2HXZ A;  4BOP A;  4OVZ A;  4FK5 A;  3HWN A;  1PPD A;  3OF8 A;  2PAD A;  1YZB A;  2Z84 A;  2NQI A;  2R9N A;  3PHU A;  3PT2 A;  4I04 A;  2AIM A;  3OF9 A;  4PP2 E;  4W5B A;  1F29 A;  2FRQ A;  3IOQ A;  4CDC B;  3D6S A;  5EGW A;  4YYU A;  1DF0 A;  3BBA A;  3MHS A;  2G7Y A;  3ZUA A;  2E02 A;  5E6J A;  1YK7 A;  5FPW A;  1VSN A;  2AGA A;  4OEM A;  3H8C A;  5EZS A;  5A24 A;  1CJL A;  4RY2 A;  2FRA A;  3PRP A;  4YYS A;  4YYW A;  1TU6 A;  4YV8 A;  4WUR A;  4CDD B;  3PHW A;  1QOL A;  3TRK A;  3IFU A;  1NB3 A;  3KSE A;  3OVX A;  3W30 A;  2DC7 A;  5JH3 A;  1CS8 A;  2JQG R;  3C0R A;  1AIM A;  3IEJ A;  1EWL A;  2XU4 A;  2JQF R;  3E1Z B;  2IPP B;  3IMA A;  2Y5B A;  3K9M A;  3P5X A;  2DZY A;  2FE8 A;  9PAP A;  3CH2 X;  1YT7 A;  2DOS A;  2FYE A;  4X6J A;  7PCK A;  1BQI A;  2XU1 A;  4CDF B;  2B1N A;  3U8E A;  4MM3 B;  3KW9 A;  1KHQ A;  1AU4 A;  3MHH A;  3P5W A;  4ZTB A;  5CHV A;  2E01 A;  4IUM A;  2AYN A;  3GCB A;  3IV2 A;  4A5U A;  2FT2 A;  3BC3 A;  3MTV A;  3W31 A;  2YJ9 A;  5F02 A;  1NQC A;  1TL9 A;  2H7J A;  3F75 A;  4BPV A;  3ERV A;  5CVM A;  3V6C A;  2OUL A;  3HHI A;  3H89 A;  3RVV A;  3PBH A;  3TMP A;  4CDE B;  1IWD A;  1QMY A;  1MDW A;  1DKI A;  1A6R A;  2WBF X;  1MS6 A;  2P86 A;  1CSB B;  1F2C A;  1GEC E;  2GFO A;  1PE6 A;  4WA6 A;  4N8W A;  2OP3 A;  3RVX A;  2ARY A;  3E9S A;  4D8E A;  4QRG A;  2XU5 A;  4MI7 A;  5J94 A;  1M6D A;  3CBK A;  1EWM A;  2DCB A;  4QH6 A;  2VHF A;  2DCA A;  3HD3 A;  1PPP A;  1CQD A;  4KLB A;  1F2B A;  2NQA A;  1PXV A;  1CPJ A;  2F1G A;  1KXR A;  1AU0 A;  4XUI A;  2DC6 A;  3LFY A;  4BSQ A;  3CBJ A;  3PSE A;  1PPN A;  3OIS A;  2FO5 A;  2UZJ A;  1U9Q X;  2BDZ A;  1QDQ A;  4BS6 A;  4QBB A;  4OEL A;  3S3Q A;  2G8J A;  4X6I A;  3S3R A;  3RVW A;  2ATO A;  1ZCM A;  1PCI A;  4R3D A;  3BB7 A;  1ICF A;  3ZNH A;  4BOZ A;  1AYW A;  4MSX A;  4PP1 A;  2DZZ A;  2J7Q C;  3K24 A;  3QSD A;  1U9V A;  1NB5 A;  1EF7 A;  1KHP A;  4AXL A;  4I07 A;  3USV A;  3O0U A;  2AUX A;  1BGO A;  1GCB A;  1MIR A;  3MOR A;  3OQC A;  4BOS A;  3M99 A;  2F7D A;  2G6D A;  1X9Y A;  1K3B B;  4D8B A;  2NQG A;  3HHA A;  1ME4 A;  3B79 A;  4HXD B;  1ATK A;  2VHS A;  1CB5 A;  2HWK A;  1Y08 A;  1NLJ A;  3P5V A;  4FJC A;  1CVZ A;  3IUT A;  2J7Q A;  2P7U A;  4HWY A;  3BY4 A;  2HHN A;  5CVO B;  1Y4H A;  2AUZ A;  2DC9 A;  1AU2 A;  2HH5 A;  1THE A;  4YYV A;  5JZE A;  1F2A A;  4RF1 A;  1CV8 A;  3O65 A;  2FUD A;  2P0R A;  1PVJ A;  2R9M A;  2YJC A;  3AI8 A;  3KX1 A;  1ITO A;  4QRV A;  4YYR A;  3H8B A;  3MP2 A;  3OVZ A;  3KWZ A;  2Y6E A;  4M0W A;  4CZW A;  1EWP A;  3WXG A;  1CTE A;  2NQD B;  2BTW B;  2DJG B;  4QRX A;  3N3G A;  2BU3 A;  4BOQ A;  3N4C A;  1FH0 A;  3F5V A;  1MHW A;  3CH3 X;  2DCC A;  2R9O A;  3O1G A;  4RNA A;  4N4Z A;  1TLO A;  1POP A;  2PNS A;  1KFU L;  6PAD A;  2GHU A;  4DMY A;  3PNR A;  1YK8 A;  3BWK A;  5CVN B;  1GMY A;  2AU1 A;  3PW3 A;  3RNV A;  1PPO A;  3MTN A;  5PAD A;  1MEM A;  4I05 A;  1NPZ A;  3LXS A;  2PRE A;  3BCN A;  2O6X A;  1GLO A;  2AVW A;  3PRM A;  1PBH A;  1Q6K A;  1HUC B;  4K7C A;  1STF E;  1PAD A;  4MZS A;  4PI3 A;  3V6E A;  4MZO A;  3KFQ A;  4ZUX U;  4YYQ A;  4AXM A;  1O0E A;  1QXP A;  4RKX A;  4BS5 A;  3I3T A;  2IBI A;  1EWO A;  3BOW A;  1ZIV A;  3QJ3 A;  1SNK A;  1AEC A;  3I06 A;  2PBH A;  2CB5 A;  4P6G A;  3NHE A;  2C0Y A;  4W4U A;  3BPF A;  5CHT A;  3WXF A;  4Q8H A;  2HD5 A;  3TNX A;  1VJV A;  3H7D A;  2DCD A;  1AYU A;  2BTW A;  5EZQ A;  8PCH A;  4OW0 A;  4OVZ B;  3DF0 A;  4G54 A;  3BPM A;  4GUA A;  4N79 A;  1BP4 A;  1NL6 A;  2R6N A;  2JRI A;  4PAD A;  1ME3 A;  2FTD A;  2FQ9 A;  4FIP A;  2XU3 A;  3P5U A;  4XZX A;  4RF0 A;  4W5C A;  1KFX L;  4X6H A;  1BY8 A;  2DC8 A;  3KKU A;  2ACT A;  1DEU A;  2OZ2 A;  2YJ8 A;  4IP3 A;  3K8U A;  1U9W A;  1XKG A;  4BOU A;  1AYV A;  1YVB A;  5EF4 A;  1UKF A;  4YVA A;  5KO3 A;  1MEG A;  2AYO A;  4P6E A;  2E00 A;  2R9F A;  2CIO A;  2YJ2 A;  3QT4 A;  2BDL A;  5JA7 A;  3KWB X;  3WXE A;  2AS8 A;  3IHP A;  3H6S A;  3PHX A;  2DJF B;  5K16 A;  4PT5 A;  4DMX A;  4BQV A;  1PIP A;  3PDF A;  1SP4 B;  1U9X A;  3C9E A;  1JQP A;  2B1M A;  2G8E A;  3N3K A; 
#chains in the Genus database with same CATH homology
 4IUM A;  4A5U A;  3B21 A;  4D8B A;  4RKX A;  3MTV A;  4REZ A;  3W31 A;  4D8I A;  2JTC A;  3MJ5 A;  4P16 A;  4HXD B;  2HWK A;  4BOP A;  4OVZ A;  3TMP A;  2J7Q A;  3BY4 A;  2Z84 A;  1DKI A;  1YZB A;  3PHU A;  3PT2 A;  2BTW A;  5EZQ A;  3E9S A;  4OW0 A;  4OVZ B;  4D8E A;  3BBA A;  5JZE A;  4RF1 A;  4GUA A;  3O65 A;  4MI7 A;  1PVJ A;  2JRI A;  5E6J A;  4XZX A;  2AGA A;  4RF0 A;  3MP2 A;  4M0W A;  3PRP A;  4IP3 A;  2BTW B;  4WUR A;  3PHW A;  4BOU A;  2BU3 A;  4BOQ A;  3TRK A;  3IFU A;  3W30 A;  1UKF A;  5KO3 A;  3PSE A;  3C0R A;  4RNA A;  2UZJ A;  4R3D A;  3BB7 A;  3ZNH A;  4BOZ A;  3RNV A;  2FE8 A;  2J7Q C;  2DOS A;  3PRM A;  3PHX A;  4MM3 B;  4PT5 A;  3OQC A;  4ZTB A;  5EZS A;  4BOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...