4BOQA

Structure of otud2 otu domain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
KRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN THIOESTERASE OTU1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 55
structure length 175
sequence length 175
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4boqA00
4BOPA 4HXDB 4BOSA 5JZEA 3C0RA 4BOQA 3PSEA 3PRMA 3PHUA 3PRPA 4BOZA 3ZNHA 3BY4A 3PT2A 3PHXA 3PHWA 4BOUA 3TMPA
chains in the Genus database with same CATH superfamily
1TL9A 1XKGA 1PADA 2DC9A 3KWBX 4P6EA 1X9YA 2OP3A 1F2BA 3KFQA 2P0RA 1U9XA 1CVZA 2HWKA 2VHSA 1NL6A 4OVZB 3IOQA 3O1GA 4IP3A 2ATOA 4PI3A 2HHNA 1EWPA 1F2CA 1NPZA 2DC7A 1Q6KA 1YZBA 3PW3A 3USVA 4AXLA 1PE6A 2PNSA 6PADA 3TNXA 4P6GA 3S3RA 4QRXA 3AI8A 3RVVA 1CTEA 1BP4A 3D6SA 1KXRA 1ICFA 2DC6A 2VHFA 5F02A 2E02A 1AYVA 4YYRA 2J7QA 3HHAA 4MI7A 2H7JA 1PPPA 1F2AA 1PCIA 4MZSA 2B1NA 4YYVA 3QJ3A 2R6NA 4PP2E 2NQGA 2AUXA 4Q8GA 2G8EA 4QBBA 1QOLA 2AUZA 2P86A 1MDWA 3MTVA 3MTNA 2OZ2A 3PDFA 1GLOA 1NB3A 4RNAA 1PIPA 2F7DA 1VJVA 2Y6EA 4BOSA 4AXMA 1YK7A 4CDEB 1KHQA 3DF0A 1CQDA 2DJFB 4FIPA 2AU1A 2R9CA 2JRIA 3ZNHA 1A6RA 4BPVA 3IFUA 1Y4HA 2JQFR 3K24A 4FJCA 3QT4A 3BB7A 3BCNA 1AECA 4WURA 3F5VA 1PPDA 3OF9A 1U5IA 3M99A 2BDLA 3B21A 3NHEA 4QRVA 4BOQA 2BU3A 2FYEA 3N3KA 3H7DA 1JQPA 3IHPA 2YJBA 3WXGA 3OISA 5CHVA 1YK8A 2HH5A 3BBAA 4OW0A 3W30A 7PCKA 1QMYA 2GHUA 2AYOA 2P7UA 1ME3A 2PBHA 2UZJA 4BS6A 1MS6A 2YJCA 3RVWA 3OVXA 4D8IA 4CDCB 3PBHA 4XZXA 1EWMA 2NQIA 5EF4A 3P5XA 1YVBA 1SP4B 3N4CA 1AU4A 4QRGA 2AIMA 2YJ8A 4HXDB 1THEA 3CBJA 3C0RA 2BTWA 4A5UA 2JTCA 2XU5A 3CH2X 3HWNA 4WA6A 4YYSA 1SNKA 4X6JA 1EWLA 1PVJA 2FUDA 3E1ZB 1MEMA 1GMYA 4YV8A 5FPWA 1AU3A 4I05A 1NQCA 5E6JA 1S4VA 4M0WA 3MORA 4I04A 1MIRA 4I07A 4BOZA 3N3GA 5CVOB 2CIOA 1CV8A 3H8CA 2FTDA 3S3QA 4MM3B 2CB5A 2FRQA 1O0EA 3LXSA 3WXEA 3OQCA 2DCCA 2HD5A 1U9WA 3B79A 2FE8A 3H89A 1U9QX 1ZIVA 3MHHA 2DJGB 4ZTBA 4PADA 1EF7A 1KFXL 3KWZA 3RNVA 2IBIA 4DMYA 5CVNB 3PRMA 2JQGR 1PBHA 4N4ZA 1M6DA 1TLOA 4QH6A 2YJ2A 1QXPA 1EWOA 1AYUA 2O6XA 3WXFA 1GECE 2E03A 1AU0A 4MZOA 1DKIA 3TRKA 2DCBA 3H6SA 3PHXA 4YYQA 3TMPA 2FT2A 4RKXA 4PT5A 1MHWA 4IUMA 2E01A 4GUAA 5CHTA 3IV2A 4YVAA 3LFYA 2Y5BA 4XR7A 1U9VA 5EGWA 4D8BA 1BQIA 4CDDB 1F29A 1KHPA 3BOWA 4X6HA 4N8WA 2R9OA 3I06A 1CPJA 2AGAA 3BY4A 5JA7A 4ZUXU 4BOUA 1AU2A 1ATKA 4YYWA 3O0UA 2PREA 2Z84A 3P5WA 2AS8A 3KW9A 1POPA 1GCBA 1AIMA 4BS5A 1HUCB 4BQVA 4YYUA 2ARYA 3ERVA 1NLJA 1ITOA 3GCBA 4Q8HA 2G7YA 3BPMA 4G54A 2NQAA 2GFOA 3V6EA 1PPNA 3OVZA 5KO3A 3P5VA 1DF0A 2BTWB 3K8UA 3BWKA 4W5BA 2AVWA 2DC8A 2YJ9A 5A24A 3PRPA 3V6CA 4KLBA 1QDQA 5EZSA 4PP1A 3C9EA 4OVZA 5EZQA 1BGOA 3HD3A 1CS8A 2R9FA 5J94A 5JZEA 1FH0A 4BSQA 2E00A 4RF1A 2XU3A 8PCHA 3KKUA 1PPOA 2IPPB 4REZA 4W4UA 3H8BA 1TU6A 3F75A 3OF8A 3O65A 3BPFA 4DMXA 2AYNA 2FRAA 5JH3A 3CBKA 3K9MA 4RY2A 3PT2A 2WBFX 4FK5A 1UKFA 2R9NA 3QSDA 2R9MA 2G6DA 4RF0A 1KFUL 3BC3A 2B1MA 2DZYA 2DOSA 1CB5A 4X6IA 3MJ5A 2C0YA 1CSBB 3PHUA 3PNRA 2OULA 4W5CA 5CVMA 3RVXA 3IMAA 4P16A 1NB5A 4MSXA 4N79A 4D8EA 2FQ9A 2PADA 3HHIA 1MEGA 1AYWA 2XU1A 3KSEA 3CH3X 3P5UA 1YALA 3I3TA 4CZWA 1K3BB 3PSEA 2DZZA 1IWDA 4OELA 3PHWA 1ME4A 2J7QC 2F1GA 2G8JA 1STFE 1YT7A 1VSNA 3U8EA 3IUTA 4R3DA 1DEUA 2ACTA 5K16A 1Y08A 4HWYA 4CDFB 5PADA 2DCAA 4OEMA 1PXVA 3MHSA 9PAPA 2HXZA 3IEJA 3ZUAA 3MP2A 4K7CA 2NQDB 1CJLA 2DCDA 3W31A 1BY8A 4XUIA 4BOPA 1ZCMA 2XU4A 2FO5A 2BDZA 3KX1A 3E9SA
chains in the Genus database with same CATH topology
4ZTBA 4REZA 3B21A 3RNVA 4BOQA 3O65A 2BU3A 3PRMA 2HWKA 4OVZB 3PT2A 4IP3A 1UKFA 4RF0A 3BBAA 4OW0A 1DKIA 3W30A 3PHXA 3TRKA 3TMPA 1YZBA 2DOSA 4RKXA 4PT5A 4IUMA 3MJ5A 4GUAA 2UZJA 3PHUA 4D8IA 4XZXA 4P16A 4D8BA 4D8EA 2J7QA 4MI7A 4HXDB 3C0RA 2BTWA 2AGAA 3BY4A 4A5UA 2JTCA 4BOUA 1PVJA 2Z84A 3PSEA 5E6JA 3PHWA 4M0WA 2J7QC 5KO3A 3MTVA 4BOZA 4R3DA 2BTWB 4RNAA 4BOSA 3PRPA 4MM3B 3MP2A 5EZSA 3W31A 4OVZA 5EZQA 3OQCA 2JRIA 3ZNHA 4BOPA 3IFUA 5JZEA 2FE8A 3BB7A 4RF1A 4WURA 3E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOP A;  4HXD B;  4BOS A;  5JZE A;  3C0R A;  4BOQ A;  3PSE A;  3PRM A;  3PHU A;  3PRP A;  4BOZ A;  3ZNH A;  3BY4 A;  3PT2 A;  3PHX A;  3PHW A;  4BOU A;  3TMP A; 
#chains in the Genus database with same CATH topology
 1TL9 A;  1XKG A;  1PAD A;  2DC9 A;  3KWB X;  4P6E A;  1X9Y A;  2OP3 A;  1F2B A;  3KFQ A;  2P0R A;  1U9X A;  1CVZ A;  2HWK A;  2VHS A;  1NL6 A;  4OVZ B;  3IOQ A;  3O1G A;  4IP3 A;  2ATO A;  4PI3 A;  2HHN A;  1EWP A;  1F2C A;  1NPZ A;  2DC7 A;  1Q6K A;  1YZB A;  3PW3 A;  3USV A;  4AXL A;  1PE6 A;  2PNS A;  6PAD A;  3TNX A;  4P6G A;  3S3R A;  4QRX A;  3AI8 A;  3RVV A;  1CTE A;  1BP4 A;  3D6S A;  1KXR A;  1ICF A;  2DC6 A;  2VHF A;  5F02 A;  2E02 A;  1AYV A;  4YYR A;  2J7Q A;  3HHA A;  4MI7 A;  2H7J A;  1PPP A;  1F2A A;  1PCI A;  4MZS A;  2B1N A;  4YYV A;  3QJ3 A;  2R6N A;  4PP2 E;  2NQG A;  2AUX A;  4Q8G A;  2G8E A;  4QBB A;  1QOL A;  2AUZ A;  2P86 A;  1MDW A;  3MTV A;  3MTN A;  2OZ2 A;  3PDF A;  1GLO A;  1NB3 A;  4RNA A;  1PIP A;  2F7D A;  1VJV A;  2Y6E A;  4BOS A;  4AXM A;  1YK7 A;  4CDE B;  1KHQ A;  3DF0 A;  1CQD A;  2DJF B;  4FIP A;  2AU1 A;  2R9C A;  2JRI A;  3ZNH A;  1A6R A;  4BPV A;  3IFU A;  1Y4H A;  2JQF R;  3K24 A;  4FJC A;  3QT4 A;  3BB7 A;  3BCN A;  1AEC A;  4WUR A;  3F5V A;  1PPD A;  3OF9 A;  1U5I A;  3M99 A;  2BDL A;  3B21 A;  3NHE A;  4QRV A;  4BOQ A;  2BU3 A;  2FYE A;  3N3K A;  3H7D A;  1JQP A;  3IHP A;  2YJB A;  3WXG A;  3OIS A;  5CHV A;  1YK8 A;  2HH5 A;  3BBA A;  4OW0 A;  3W30 A;  7PCK A;  1QMY A;  2GHU A;  2AYO A;  2P7U A;  1ME3 A;  2PBH A;  2UZJ A;  4BS6 A;  1MS6 A;  2YJC A;  3RVW A;  3OVX A;  4D8I A;  4CDC B;  3PBH A;  4XZX A;  1EWM A;  2NQI A;  5EF4 A;  3P5X A;  1YVB A;  1SP4 B;  3N4C A;  1AU4 A;  4QRG A;  2AIM A;  2YJ8 A;  4HXD B;  1THE A;  3CBJ A;  3C0R A;  2BTW A;  4A5U A;  2JTC A;  2XU5 A;  3CH2 X;  3HWN A;  4WA6 A;  4YYS A;  1SNK A;  4X6J A;  1EWL A;  1PVJ A;  2FUD A;  3E1Z B;  1MEM A;  1GMY A;  4YV8 A;  5FPW A;  1AU3 A;  4I05 A;  1NQC A;  5E6J A;  1S4V A;  4M0W A;  3MOR A;  4I04 A;  1MIR A;  4I07 A;  4BOZ A;  3N3G A;  5CVO B;  2CIO A;  1CV8 A;  3H8C A;  2FTD A;  3S3Q A;  4MM3 B;  2CB5 A;  2FRQ A;  1O0E A;  3LXS A;  3WXE A;  3OQC A;  2DCC A;  2HD5 A;  1U9W A;  3B79 A;  2FE8 A;  3H89 A;  1U9Q X;  1ZIV A;  3MHH A;  2DJG B;  4ZTB A;  4PAD A;  1EF7 A;  1KFX L;  3KWZ A;  3RNV A;  2IBI A;  4DMY A;  5CVN B;  3PRM A;  2JQG R;  1PBH A;  4N4Z A;  1M6D A;  1TLO A;  4QH6 A;  2YJ2 A;  1QXP A;  1EWO A;  1AYU A;  2O6X A;  3WXF A;  1GEC E;  2E03 A;  1AU0 A;  4MZO A;  1DKI A;  3TRK A;  2DCB A;  3H6S A;  3PHX A;  4YYQ A;  3TMP A;  2FT2 A;  4RKX A;  4PT5 A;  1MHW A;  4IUM A;  2E01 A;  4GUA A;  5CHT A;  3IV2 A;  4YVA A;  3LFY A;  2Y5B A;  4XR7 A;  1U9V A;  5EGW A;  4D8B A;  1BQI A;  4CDD B;  1F29 A;  1KHP A;  3BOW A;  4X6H A;  4N8W A;  2R9O A;  3I06 A;  1CPJ A;  2AGA A;  3BY4 A;  5JA7 A;  4ZUX U;  4BOU A;  1AU2 A;  1ATK A;  4YYW A;  3O0U A;  2PRE A;  2Z84 A;  3P5W A;  2AS8 A;  3KW9 A;  1POP A;  1GCB A;  1AIM A;  4BS5 A;  1HUC B;  4BQV A;  4YYU A;  2ARY A;  3ERV A;  1NLJ A;  1ITO A;  3GCB A;  4Q8H A;  2G7Y A;  3BPM A;  4G54 A;  2NQA A;  2GFO A;  3V6E A;  1PPN A;  3OVZ A;  5KO3 A;  3P5V A;  1DF0 A;  2BTW B;  3K8U A;  3BWK A;  4W5B A;  2AVW A;  2DC8 A;  2YJ9 A;  5A24 A;  3PRP A;  3V6C A;  4KLB A;  1QDQ A;  5EZS A;  4PP1 A;  3C9E A;  4OVZ A;  5EZQ A;  1BGO A;  3HD3 A;  1CS8 A;  2R9F A;  5J94 A;  5JZE A;  1FH0 A;  4BSQ A;  2E00 A;  4RF1 A;  2XU3 A;  8PCH A;  3KKU A;  1PPO A;  2IPP B;  4REZ A;  4W4U A;  3H8B A;  1TU6 A;  3F75 A;  3OF8 A;  3O65 A;  3BPF A;  4DMX A;  2AYN A;  2FRA A;  5JH3 A;  3CBK A;  3K9M A;  4RY2 A;  3PT2 A;  2WBF X;  4FK5 A;  1UKF A;  2R9N A;  3QSD A;  2R9M A;  2G6D A;  4RF0 A;  1KFU L;  3BC3 A;  2B1M A;  2DZY A;  2DOS A;  1CB5 A;  4X6I A;  3MJ5 A;  2C0Y A;  1CSB B;  3PHU A;  3PNR A;  2OUL A;  4W5C A;  5CVM A;  3RVX A;  3IMA A;  4P16 A;  1NB5 A;  4MSX A;  4N79 A;  4D8E A;  2FQ9 A;  2PAD A;  3HHI A;  1MEG A;  1AYW A;  2XU1 A;  3KSE A;  3CH3 X;  3P5U A;  1YAL A;  3I3T A;  4CZW A;  1K3B B;  3PSE A;  2DZZ A;  1IWD A;  4OEL A;  3PHW A;  1ME4 A;  2J7Q C;  2F1G A;  2G8J A;  1STF E;  1YT7 A;  1VSN A;  3U8E A;  3IUT A;  4R3D A;  1DEU A;  2ACT A;  5K16 A;  1Y08 A;  4HWY A;  4CDF B;  5PAD A;  2DCA A;  4OEM A;  1PXV A;  3MHS A;  9PAP A;  2HXZ A;  3IEJ A;  3ZUA A;  3MP2 A;  4K7C A;  2NQD B;  1CJL A;  2DCD A;  3W31 A;  1BY8 A;  4XUI A;  4BOP A;  1ZCM A;  2XU4 A;  2FO5 A;  2BDZ A;  3KX1 A;  3E9S A; 
#chains in the Genus database with same CATH homology
 4ZTB A;  4REZ A;  3B21 A;  3RNV A;  4BOQ A;  3O65 A;  2BU3 A;  3PRM A;  2HWK A;  4OVZ B;  3PT2 A;  4IP3 A;  1UKF A;  4RF0 A;  3BBA A;  4OW0 A;  1DKI A;  3W30 A;  3PHX A;  3TRK A;  3TMP A;  1YZB A;  2DOS A;  4RKX A;  4PT5 A;  4IUM A;  3MJ5 A;  4GUA A;  2UZJ A;  3PHU A;  4D8I A;  4XZX A;  4P16 A;  4D8B A;  4D8E A;  2J7Q A;  4MI7 A;  4HXD B;  3C0R A;  2BTW A;  2AGA A;  3BY4 A;  4A5U A;  2JTC A;  4BOU A;  1PVJ A;  2Z84 A;  3PSE A;  5E6J A;  3PHW A;  4M0W A;  2J7Q C;  5KO3 A;  3MTV A;  4BOZ A;  4R3D A;  2BTW B;  4RNA A;  4BOS A;  3PRP A;  4MM3 B;  3MP2 A;  5EZS A;  3W31 A;  4OVZ A;  5EZQ A;  3OQC A;  2JRI A;  3ZNH A;  4BOP A;  3IFU A;  5JZE A;  2FE8 A;  3BB7 A;  4RF1 A;  4WUR A;  3E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...