4BOQA

Structure of otud2 otu domain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
175
structure length
175
Chain Sequence
KRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UBIQUITIN THIOESTERASE OTU1
publication title Otu Deubiquitinases Reveal Mechanisms of Linkage Specificity and Enable Ubiquitin Chain Restriction Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 175
sequence length 175
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4boqA00
3PRMA 3PRPA 4BOSA 5JZEA 3PHWA 3BY4A 4BOQA 3PT2A 3PHUA 3ZNHA 3TMPA 4BOUA 4HXDB 4BOPA 3PSEA 4BOZA 3PHXA 3C0RA
chains in the Genus database with same CATH superfamily
1KHQA 4DMXA 1EWOA 2R9FA 5A24A 4FK5A 3I3TA 1CJLA 3OVZA 3RNVA 3BC3A 5EZQA 2H7JA 2P7UA 4OELA 1MDWA 3H89A 1AECA 4I04A 2YJ9A 3W31A 1ICFA 3PNRA 5J94A 1HUCB 2P86A 3S3QA 4YYRA 1Q6KA 1CV8A 1PIPA 2UZJA 3PW3A 1JQPA 2AYOA 3P5UA 2FO5A 1PPDA 2NQAA 1BQIA 3BPFA 2E03A 4XZXA 2O6XA 4D8IA 4WA6A 2R9NA 2ARYA 2VHSA 2R9OA 2G7YA 3B21A 2AVWA 1QDQA 1QMYA 4P16A 3USVA 3U8EA 1MHWA 3B79A 2DJFB 4YYSA 1MS6A 4OEMA 3KW9A 3CH2X 3PHUA 2AUZA 3M99A 1SP4B 3S3RA 4HWYA 1U9XA 5CVMA 5EF4A 3N3KA 1ITOA 2XU5A 3V6CA 3HWNA 1AU4A 1MIRA 3W30A 3NHEA 1M6DA 1PE6A 2AYNA 4I07A 4N4ZA 3MTVA 2B1NA 2DJGB 1NPZA 3BB7A 3P5VA 2HXZA 1DF0A 2HWKA 4W5CA 1DKIA 3N4CA 3O65A 3HHAA 1FH0A 1U9QX 3C9EA 4CZWA 1F2CA 1PPNA 2DC6A 4MZSA 2F7DA 4PT5A 3CH3X 3HHIA 1PADA 1TL9A 6PADA 3MHSA 1F2AA 4GUAA 8PCHA 4MZOA 1YK7A 3O1GA 4YVAA 3F5VA 4N79A 2BTWB 3KSEA 1CQDA 3WXEA 2G6DA 4XR7A 3H8BA 2BTWA 2HD5A 4WURA 5CHVA 2AS8A 4AXLA 3BY4A 1PBHA 2PREA 2YJCA 1GCBA 1IWDA 1U9WA 3PRMA 4BS6A 3MTNA 2PADA 4BQVA 1EF7A 3RVXA 4BS5A 3PHXA 1VJVA 3BOWA 2CB5A 2G8JA 5E6JA 1ZCMA 3KKUA 1NB5A 2DCAA 3RVVA 3O0UA 2XU4A 4AXMA 2B1MA 4BPVA 2E00A 3IFUA 2WBFX 4YYQA 2J7QC 1NQCA 1SNKA 1AU0A 3BCNA 4YYVA 2FT2A 2Z84A 1AYUA 3K24A 1A6RA 4X6HA 4FJCA 1TLOA 1TU6A 3ERVA 1EWLA 1ATKA 3MHHA 1Y4HA 3F75A 1CB5A 4OVZB 3ZNHA 2HH5A 3D6SA 4OVZA 3KWBX 4IUMA 2FE8A 4BOUA 1EWMA 2JRIA 2OULA 1YZBA 3C0RA 5CHTA 4KLBA 5JZEA 5EGWA 1X9YA 4X6IA 2ACTA 4ZUXU 1GLOA 3KX1A 4G54A 1YVBA 7PCKA 3WXFA 2R9CA 2C0YA 9PAPA 1NB3A 2FQ9A 4REZA 1QOLA 2IBIA 2DZZA 4RF0A 2G8EA 3KWZA 1STFE 3CBKA 4Q8GA 1CPJA 5CVNB 1DEUA 2NQIA 2JQGR 2XU1A 4RNAA 2YJ8A 3OISA 5K16A 4IP3A 1YALA 3CBJA 4QH6A 3PBHA 3MP2A 1AU3A 2BU3A 3LXSA 4W4UA 2OP3A 2E02A 4YYWA 2FRQA 4DMYA 4RF1A 3E9SA 1PXVA 4X6JA 2IPPB 4BSQA 1F29A 3PDFA 2J7QA 1GECE 1K3BB 3IEJA 4BOZA 4MM3B 2CIOA 4P6GA 1MEMA 2YJ2A 2FTDA 1U9VA 2FUDA 3I06A 1YT7A 3H7DA 1NL6A 5F02A 3QJ3A 4CDDB 3WXGA 1CSBB 1YK8A 4BOPA 2DCDA 2PBHA 4PP2E 3DF0A 4N8WA 1AYWA 3K8UA 4MI7A 1GMYA 1ZIVA 3OVXA 5JA7A 4QRXA 3TRKA 4BOQA 2R6NA 3MJ5A 4CDFB 2DC7A 1BP4A 2BDZA 1BY8A 4FIPA 1PPOA 3HD3A 3K9MA 3E1ZB 3RVWA 4W5BA 2P0RA 3PSEA 3IOQA 4XUIA 4M0WA 3OF9A 4QBBA 1NLJA 1S4VA 1EWPA 2NQDB 3P5WA 2Y6EA 3IV2A 2AU1A 2VHFA 4BOSA 4D8EA 2DCCA 4CDEB 3BWKA 1PVJA 2DOSA 4PP1A 2FRAA 1F2BA 4RY2A 2F1GA 1AIMA 3MORA 4D8BA 4QRGA 3BBAA 4A5UA 3OQCA 2DC9A 4QRVA 4CDCB 2HHNA 4P6EA 2JTCA 3P5XA 1VSNA 2AUXA 2YJBA 4PADA 2ATOA 1CS8A 1CTEA 3N3GA 2FYEA 1BGOA 1UKFA 3OF8A 3IMAA 1PCIA 5CVOB 1AU2A 2AIMA 4RKXA 4HXDB 1XKGA 4Q8HA 1ME3A 3PHWA 5EZSA 3H6SA 1KHPA 1POPA 4YYUA 4K7CA 3AI8A 4I05A 3IUTA 3LFYA 1O0EA 3ZUAA 4ZTBA 5JH3A 5KO3A 3PT2A 1KFUL 2NQGA 3TNXA 1AYVA 3V6EA 2AGAA 1MEGA 3TMPA 1U5IA 4R3DA 2PNSA 2Y5BA 2DZYA 3QSDA 1CVZA 2GHUA 5FPWA 1ME4A 3GCBA 2BDLA 3H8CA 2GFOA 4MSXA 1KFXL 1KXRA 3BPMA 4OW0A 1QXPA 2JQFR 1PPPA 2XU3A 2DCBA 3IHPA 4YV8A 1Y08A 1THEA 4PI3A 2DC8A 3KFQA 2R9MA 3PRPA 2OZ2A 5PADA 3QT4A 2E01A
chains in the Genus database with same CATH topology
4M0WA 4PT5A 4GUAA 3RNVA 5EZQA 4RNAA 4BOSA 4D8EA 4IP3A 2BTWB 1PVJA 2DOSA 3W31A 2BTWA 3MP2A 4WURA 2BU3A 2UZJA 3BY4A 4D8BA 3BBAA 4A5UA 3OQCA 4RF1A 3E9SA 3PRMA 2JTCA 4XZXA 2J7QA 3PHXA 4D8IA 1UKFA 4BOZA 4MM3B 5E6JA 3B21A 4P16A 4RKXA 4HXDB 3PHWA 5EZSA 3IFUA 2J7QC 2Z84A 3PHUA 4ZTBA 5KO3A 3PT2A 4BOPA 2AGAA 4OVZB 3ZNHA 3TMPA 4R3DA 4OVZA 4MI7A 4IUMA 2FE8A 3W30A 4BOUA 2JRIA 1YZBA 3C0RA 3TRKA 4BOQA 5JZEA 3MTVA 3MJ5A 3BB7A 4OW0A 2HWKA 1DKIA 3O65A 3PRPA 4REZA 4RF0A 3PSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRM A;  3PRP A;  4BOS A;  5JZE A;  3PHW A;  3BY4 A;  4BOQ A;  3PT2 A;  3PHU A;  3ZNH A;  3TMP A;  4BOU A;  4HXD B;  4BOP A;  3PSE A;  4BOZ A;  3PHX A;  3C0R A; 
#chains in the Genus database with same CATH topology
 1KHQ A;  4DMX A;  1EWO A;  2R9F A;  5A24 A;  4FK5 A;  3I3T A;  1CJL A;  3OVZ A;  3RNV A;  3BC3 A;  5EZQ A;  2H7J A;  2P7U A;  4OEL A;  1MDW A;  3H89 A;  1AEC A;  4I04 A;  2YJ9 A;  3W31 A;  1ICF A;  3PNR A;  5J94 A;  1HUC B;  2P86 A;  3S3Q A;  4YYR A;  1Q6K A;  1CV8 A;  1PIP A;  2UZJ A;  3PW3 A;  1JQP A;  2AYO A;  3P5U A;  2FO5 A;  1PPD A;  2NQA A;  1BQI A;  3BPF A;  2E03 A;  4XZX A;  2O6X A;  4D8I A;  4WA6 A;  2R9N A;  2ARY A;  2VHS A;  2R9O A;  2G7Y A;  3B21 A;  2AVW A;  1QDQ A;  1QMY A;  4P16 A;  3USV A;  3U8E A;  1MHW A;  3B79 A;  2DJF B;  4YYS A;  1MS6 A;  4OEM A;  3KW9 A;  3CH2 X;  3PHU A;  2AUZ A;  3M99 A;  1SP4 B;  3S3R A;  4HWY A;  1U9X A;  5CVM A;  5EF4 A;  3N3K A;  1ITO A;  2XU5 A;  3V6C A;  3HWN A;  1AU4 A;  1MIR A;  3W30 A;  3NHE A;  1M6D A;  1PE6 A;  2AYN A;  4I07 A;  4N4Z A;  3MTV A;  2B1N A;  2DJG B;  1NPZ A;  3BB7 A;  3P5V A;  2HXZ A;  1DF0 A;  2HWK A;  4W5C A;  1DKI A;  3N4C A;  3O65 A;  3HHA A;  1FH0 A;  1U9Q X;  3C9E A;  4CZW A;  1F2C A;  1PPN A;  2DC6 A;  4MZS A;  2F7D A;  4PT5 A;  3CH3 X;  3HHI A;  1PAD A;  1TL9 A;  6PAD A;  3MHS A;  1F2A A;  4GUA A;  8PCH A;  4MZO A;  1YK7 A;  3O1G A;  4YVA A;  3F5V A;  4N79 A;  2BTW B;  3KSE A;  1CQD A;  3WXE A;  2G6D A;  4XR7 A;  3H8B A;  2BTW A;  2HD5 A;  4WUR A;  5CHV A;  2AS8 A;  4AXL A;  3BY4 A;  1PBH A;  2PRE A;  2YJC A;  1GCB A;  1IWD A;  1U9W A;  3PRM A;  4BS6 A;  3MTN A;  2PAD A;  4BQV A;  1EF7 A;  3RVX A;  4BS5 A;  3PHX A;  1VJV A;  3BOW A;  2CB5 A;  2G8J A;  5E6J A;  1ZCM A;  3KKU A;  1NB5 A;  2DCA A;  3RVV A;  3O0U A;  2XU4 A;  4AXM A;  2B1M A;  4BPV A;  2E00 A;  3IFU A;  2WBF X;  4YYQ A;  2J7Q C;  1NQC A;  1SNK A;  1AU0 A;  3BCN A;  4YYV A;  2FT2 A;  2Z84 A;  1AYU A;  3K24 A;  1A6R A;  4X6H A;  4FJC A;  1TLO A;  1TU6 A;  3ERV A;  1EWL A;  1ATK A;  3MHH A;  1Y4H A;  3F75 A;  1CB5 A;  4OVZ B;  3ZNH A;  2HH5 A;  3D6S A;  4OVZ A;  3KWB X;  4IUM A;  2FE8 A;  4BOU A;  1EWM A;  2JRI A;  2OUL A;  1YZB A;  3C0R A;  5CHT A;  4KLB A;  5JZE A;  5EGW A;  1X9Y A;  4X6I A;  2ACT A;  4ZUX U;  1GLO A;  3KX1 A;  4G54 A;  1YVB A;  7PCK A;  3WXF A;  2R9C A;  2C0Y A;  9PAP A;  1NB3 A;  2FQ9 A;  4REZ A;  1QOL A;  2IBI A;  2DZZ A;  4RF0 A;  2G8E A;  3KWZ A;  1STF E;  3CBK A;  4Q8G A;  1CPJ A;  5CVN B;  1DEU A;  2NQI A;  2JQG R;  2XU1 A;  4RNA A;  2YJ8 A;  3OIS A;  5K16 A;  4IP3 A;  1YAL A;  3CBJ A;  4QH6 A;  3PBH A;  3MP2 A;  1AU3 A;  2BU3 A;  3LXS A;  4W4U A;  2OP3 A;  2E02 A;  4YYW A;  2FRQ A;  4DMY A;  4RF1 A;  3E9S A;  1PXV A;  4X6J A;  2IPP B;  4BSQ A;  1F29 A;  3PDF A;  2J7Q A;  1GEC E;  1K3B B;  3IEJ A;  4BOZ A;  4MM3 B;  2CIO A;  4P6G A;  1MEM A;  2YJ2 A;  2FTD A;  1U9V A;  2FUD A;  3I06 A;  1YT7 A;  3H7D A;  1NL6 A;  5F02 A;  3QJ3 A;  4CDD B;  3WXG A;  1CSB B;  1YK8 A;  4BOP A;  2DCD A;  2PBH A;  4PP2 E;  3DF0 A;  4N8W A;  1AYW A;  3K8U A;  4MI7 A;  1GMY A;  1ZIV A;  3OVX A;  5JA7 A;  4QRX A;  3TRK A;  4BOQ A;  2R6N A;  3MJ5 A;  4CDF B;  2DC7 A;  1BP4 A;  2BDZ A;  1BY8 A;  4FIP A;  1PPO A;  3HD3 A;  3K9M A;  3E1Z B;  3RVW A;  4W5B A;  2P0R A;  3PSE A;  3IOQ A;  4XUI A;  4M0W A;  3OF9 A;  4QBB A;  1NLJ A;  1S4V A;  1EWP A;  2NQD B;  3P5W A;  2Y6E A;  3IV2 A;  2AU1 A;  2VHF A;  4BOS A;  4D8E A;  2DCC A;  4CDE B;  3BWK A;  1PVJ A;  2DOS A;  4PP1 A;  2FRA A;  1F2B A;  4RY2 A;  2F1G A;  1AIM A;  3MOR A;  4D8B A;  4QRG A;  3BBA A;  4A5U A;  3OQC A;  2DC9 A;  4QRV A;  4CDC B;  2HHN A;  4P6E A;  2JTC A;  3P5X A;  1VSN A;  2AUX A;  2YJB A;  4PAD A;  2ATO A;  1CS8 A;  1CTE A;  3N3G A;  2FYE A;  1BGO A;  1UKF A;  3OF8 A;  3IMA A;  1PCI A;  5CVO B;  1AU2 A;  2AIM A;  4RKX A;  4HXD B;  1XKG A;  4Q8H A;  1ME3 A;  3PHW A;  5EZS A;  3H6S A;  1KHP A;  1POP A;  4YYU A;  4K7C A;  3AI8 A;  4I05 A;  3IUT A;  3LFY A;  1O0E A;  3ZUA A;  4ZTB A;  5JH3 A;  5KO3 A;  3PT2 A;  1KFU L;  2NQG A;  3TNX A;  1AYV A;  3V6E A;  2AGA A;  1MEG A;  3TMP A;  1U5I A;  4R3D A;  2PNS A;  2Y5B A;  2DZY A;  3QSD A;  1CVZ A;  2GHU A;  5FPW A;  1ME4 A;  3GCB A;  2BDL A;  3H8C A;  2GFO A;  4MSX A;  1KFX L;  1KXR A;  3BPM A;  4OW0 A;  1QXP A;  2JQF R;  1PPP A;  2XU3 A;  2DCB A;  3IHP A;  4YV8 A;  1Y08 A;  1THE A;  4PI3 A;  2DC8 A;  3KFQ A;  2R9M A;  3PRP A;  2OZ2 A;  5PAD A;  3QT4 A;  2E01 A; 
#chains in the Genus database with same CATH homology
 4M0W A;  4PT5 A;  4GUA A;  3RNV A;  5EZQ A;  4RNA A;  4BOS A;  4D8E A;  4IP3 A;  2BTW B;  1PVJ A;  2DOS A;  3W31 A;  2BTW A;  3MP2 A;  4WUR A;  2BU3 A;  2UZJ A;  3BY4 A;  4D8B A;  3BBA A;  4A5U A;  3OQC A;  4RF1 A;  3E9S A;  3PRM A;  2JTC A;  4XZX A;  2J7Q A;  3PHX A;  4D8I A;  1UKF A;  4BOZ A;  4MM3 B;  5E6J A;  3B21 A;  4P16 A;  4RKX A;  4HXD B;  3PHW A;  5EZS A;  3IFU A;  2J7Q C;  2Z84 A;  3PHU A;  4ZTB A;  5KO3 A;  3PT2 A;  4BOP A;  2AGA A;  4OVZ B;  3ZNH A;  3TMP A;  4R3D A;  4OVZ A;  4MI7 A;  4IUM A;  2FE8 A;  3W30 A;  4BOU A;  2JRI A;  1YZB A;  3C0R A;  3TRK A;  4BOQ A;  5JZE A;  3MTV A;  3MJ5 A;  3BB7 A;  4OW0 A;  2HWK A;  1DKI A;  3O65 A;  3PRP A;  4REZ A;  4RF0 A;  3PSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...