3PNRA

Structure of pbicp-c in complex with falcipain-2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
b'MNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSAWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 65
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pnrA00
1ZIVA 3ERVA 1PPPA 1U9WA 4N8WA 1O0EA 1M6DA 2DJFB 4QH6A 2DCCA 3ZUAA 1ITOA 1KHPA 3MHSA 4I04A 3NHEA 2FTDA 3KSEA 3K8UA 1F2CA 3BPFA 2E02A 1CQDA 1VJVA 1X9YA 3H8BA 3K9MA 1EF7A 2FT2A 5JH3A 2BDLA 3BWKA 4FJCA 2AS8A 2G8EA 3RVVA 4BQVA 4WA6A 2B1MA 8PCHA 3BC3A 3BOWA 1BQIA 2E00A 4BS5A 3QT4A 3D6SA 2PBHA 2GFOA 7PCKA 4G54A 3E1ZB 1A6RA 2OZ2A 4W4UA 4PP2E 2FUDA 5CVOB 1PXVA 1K3BB 4FIPA 3MHHA 3IUTA 2CB5A 4PI3A 4QBBA 1AECA 2PADA 3KX1A 1NB5A 3PBHA 1DEUA 3N3GA 4YYSA 2XU3A 2E03A 2IPPB 3IMAA 3IOQA 2R9MA 3USVA 3P5VA 4RY2A 3RVWA 3N4CA 1TL9A 2AIMA 4Q8GA 4DMYA 2FO5A 4DMXA 2R9FA 1ICFA 1CTEA 2PREA 1TLOA 1GCBA 2G6DA 4CDCB 2ARYA 3CH3X 1MHWA 2C0YA 3WXEA 3CBKA 1VSNA 3MORA 2YJBA 2NQGA 2FQ9A 4YYWA 4XUIA 4W5CA 1AIMA 1PCIA 3LFYA 1CJLA 1AU2A 1F29A 2DC8A 4CDDB 2G7YA 3KFQA 1XKGA 3V6CA 3KKUA 2DCDA 1PIPA 5CVNB 5K16A 2DZZA 2FRQA 1MIRA 1DF0A 4MSXA 1ZCMA 3S3QA 1PPDA 1MEGA 4OEMA 2DCAA 4QRVA 2HHNA 1YALA 4QRGA 2ATOA 3O1GA 1BGOA 1Y4HA 3HHIA 4MZSA 3PNRA 3IV2A 3I06A 5A24A 1MDWA 4YYUA 2AYOA 2YJCA 3TNXA 3O0UA 2FRAA 3OVZA 2NQAA 2AUXA 2VHSA 2AUZA 3P5WA 3F75A 3H89A 3K24A 3OVXA 4MZOA 3C9EA 3P5UA 1CB5A 1NPZA 1SP4B 3CBJA 1EWMA 3WXFA 4YYQA 1CV8A 5JA7A 3M99A 2AVWA 4W5BA 1IWDA 2P7UA 1U9VA 1AYUA 1NQCA 4X6HA 3QJ3A 5CHVA 2HD5A 1U9QX 2F7DA 1SNKA 2P86A 4ZUXU 1JQPA 2JQFR 1MS6A 4I07A 1NL6A 1U9XA 6PADA 2BDZA 1AU4A 1YT7A 1ME4A 1QOLA 2F1GA 2GHUA 3PW3A 1PADA 1BP4A 1AYVA 4PADA 3MTNA 9PAPA 1U5IA 3CH2X 3U8EA 3B79A 3HWNA 1MEMA 2R6NA 4AXMA 2DC9A 4FK5A 3KWBX 1AU3A 2OP3A 2YJ9A 3BPMA 4YV8A 2DZYA 4K7CA 2R9CA 3HHAA 2Y6EA 2ACTA 4QRXA 2DC6A 1QXPA 3H8CA 4X6IA 3LXSA 2B1NA 4YYVA 1PPNA 2WBFX 1PBHA 2FYEA 4P6GA 1CPJA 1EWOA 1KHQA 4N79A 4P6EA 2P0RA 2R9NA 5F02A 4CDEB 2XU5A 2XU4A 2IBIA 1CSBB 3PDFA 4CDFB 1EWPA 3P5XA 1CVZA 1YK8A 4YYRA 2JQGR 1YK7A 3I3TA 2XU1A 4I05A 3OISA 5EGWA 1KFXL 3KW9A 3F5VA 1KXRA 2DC7A 4OELA 3H6SA 1PPOA 1F2BA 1QDQA 1TU6A 1ME3A 3H7DA 2DCBA 3AI8A 3OF9A 3QSDA 2NQDB 5J94A 2AYNA 3BCNA 3DF0A 2O6XA 5CHTA 5EF4A 1KFUL 2E01A 2H7JA 1NLJA 1HUCB 3N3KA 4HWYA 1EWLA 2NQIA 3S3RA 4KLBA 1YVBA 5PADA 1GMYA 1STFE 1NB3A 1GLOA 1AU0A 4BS6A 1AYWA 1THEA 3WXGA 4AXLA 2YJ8A 2AU1A 4X6JA 1S4VA 2HH5A 3KWZA 4CZWA 1F2AA 3IHPA 1BY8A 2YJ2A 2VHFA 5FPWA 4N4ZA 5CVMA 4BSQA 3IEJA 4Q8HA 3HD3A 1FH0A 2Y5BA 4PP1A 1POPA 2CIOA 4XR7A 3GCBA 1QMYA 4BPVA 2PNSA 2OULA 2R9OA 2HXZA 2DJGB 2G8JA 4YVAA 3V6EA 1ATKA 1Q6KA 1CS8A 1Y08A 3RVXA 3OF8A 1PE6A 1GECE
chains in the Genus database with same CATH superfamily
4RKXA 1ZIVA 3ERVA 2BTWB 4D8EA 1PPPA 3PHUA 1U9WA 5EZQA 4N8WA 1O0EA 1M6DA 2DJFB 4QH6A 2DCCA 3ZUAA 4REZA 1ITOA 1KHPA 3MHSA 4I04A 3NHEA 2FTDA 3KSEA 2JTCA 3K8UA 1F2CA 3BPFA 2E02A 1CQDA 1VJVA 1X9YA 3BY4A 3H8BA 5E6JA 3ZNHA 3K9MA 1EF7A 3BBAA 2FT2A 4BOUA 5JH3A 2BDLA 3BWKA 4FJCA 4MI7A 2AS8A 2G8EA 3RVVA 4BQVA 4WA6A 2B1MA 8PCHA 3BC3A 3BOWA 1BQIA 2E00A 2Z84A 4BS5A 3QT4A 3D6SA 3PRMA 2PBHA 4MM3B 2GFOA 7PCKA 4G54A 3E1ZB 1A6RA 2OZ2A 4W4UA 4PP2E 2FUDA 5CVOB 1PXVA 1K3BB 4FIPA 3MHHA 3IUTA 2CB5A 4PI3A 4QBBA 1AECA 2PADA 3KX1A 2J7QC 1NB5A 3PBHA 1DEUA 4BOZA 3N3GA 3BB7A 4YYSA 2XU3A 2E03A 3C0RA 2IPPB 3IMAA 3IOQA 2R9MA 1PVJA 3USVA 3P5VA 4RY2A 3RVWA 3N4CA 1TL9A 2AIMA 4Q8GA 2FE8A 4DMYA 2FO5A 4DMXA 2R9FA 1ICFA 1CTEA 2PREA 4M0WA 5EZSA 1TLOA 1GCBA 3PT2A 2G6DA 4CDCB 2ARYA 3CH3X 1MHWA 2C0YA 3WXEA 3CBKA 1VSNA 3MORA 2HWKA 2YJBA 2NQGA 4RF0A 2FQ9A 2UZJA 3TMPA 4YYWA 4XUIA 4W5CA 1AIMA 1PCIA 3LFYA 1CJLA 1AU2A 1F29A 2DC8A 4CDDB 2G7YA 4BOSA 3KFQA 1XKGA 3V6CA 3KKUA 2DCDA 1PIPA 5CVNB 5K16A 2DZZA 2FRQA 2BTWA 3B21A 1MIRA 1DF0A 4MSXA 1ZCMA 3S3QA 1PPDA 1MEGA 4OEMA 2DCAA 4QRVA 2JRIA 2HHNA 1YALA 4QRGA 2ATOA 3O1GA 1BGOA 1Y4HA 3HHIA 4MZSA 3PNRA 3IV2A 3I06A 5A24A 5JZEA 1MDWA 4YYUA 2AYOA 2YJCA 3TNXA 3O0UA 2FRAA 4OW0A 3OVZA 4WURA 4BOQA 2NQAA 2AUXA 2VHSA 2AUZA 3P5WA 3F75A 3H89A 4IUMA 3K24A 3OVXA 4MZOA 3C9EA 3P5UA 1CB5A 1NPZA 1SP4B 3CBJA 1EWMA 3WXFA 4YYQA 1CV8A 5JA7A 3M99A 2AVWA 4W5BA 1IWDA 2P7UA 1U9VA 1AYUA 1NQCA 4X6HA 3QJ3A 5CHVA 4A5UA 2HD5A 1U9QX 2F7DA 1SNKA 1DKIA 2P86A 4ZUXU 1JQPA 4HXDB 2JQFR 1MS6A 4I07A 1NL6A 4XZXA 1U9XA 4RF1A 6PADA 2BDZA 1AU4A 1YT7A 1ME4A 1QOLA 2AGAA 2F1GA 2GHUA 3PW3A 1PADA 1BP4A 1AYVA 4PADA 4PT5A 3MTNA 3W30A 9PAPA 5KO3A 1U5IA 3CH2X 3PHXA 3U8EA 3B79A 3HWNA 1MEMA 2R6NA 4AXMA 2DC9A 4FK5A 3KWBX 1AU3A 2OP3A 2YJ9A 4OVZB 3BPMA 4YV8A 2DOSA 2DZYA 4K7CA 2R9CA 4D8BA 3HHAA 2Y6EA 2ACTA 4QRXA 2DC6A 1QXPA 3H8CA 1UKFA 3LXSA 4X6IA 2B1NA 4YYVA 4P16A 1PPNA 2WBFX 2J7QA 1PBHA 2FYEA 4OVZA 4P6GA 1CPJA 1EWOA 1KHQA 4N79A 4P6EA 2P0RA 2R9NA 5F02A 4CDEB 2XU5A 2XU4A 1YZBA 2IBIA 1CSBB 3PDFA 4CDFB 1EWPA 3P5XA 1CVZA 1YK8A 4BOPA 4YYRA 3MJ5A 2JQGR 1YK7A 3I3TA 3MP2A 2XU1A 4I05A 3OISA 5EGWA 4GUAA 1KFXL 3O65A 3KW9A 4RNAA 3F5VA 1KXRA 2DC7A 4OELA 3H6SA 1PPOA 1F2BA 1QDQA 1TU6A 1ME3A 3H7DA 2DCBA 3AI8A 3OF9A 3QSDA 2NQDB 5J94A 2AYNA 3BCNA 3IFUA 3DF0A 2O6XA 5CHTA 5EF4A 1KFUL 2E01A 3RNVA 2H7JA 1NLJA 1HUCB 3N3KA 4HWYA 1EWLA 2NQIA 3S3RA 4KLBA 1YVBA 5PADA 1GMYA 1STFE 3MTVA 1NB3A 1GLOA 1AU0A 4BS6A 1AYWA 2BU3A 1THEA 3W31A 3WXGA 4AXLA 2YJ8A 2AU1A 4X6JA 1S4VA 4R3DA 2HH5A 3KWZA 4CZWA 1F2AA 3IHPA 1BY8A 2YJ2A 2VHFA 5FPWA 4N4ZA 4D8IA 5CVMA 4BSQA 4ZTBA 3IEJA 4Q8HA 3PRPA 3HD3A 1FH0A 2Y5BA 4PP1A 1POPA 2CIOA 4XR7A 3GCBA 3PHWA 4IP3A 1QMYA 4BPVA 3TRKA 2PNSA 2OULA 2R9OA 2HXZA 2DJGB 2G8JA 3OQCA 4YVAA 3V6EA 1ATKA 1Q6KA 3E9SA 1CS8A 1Y08A 3RVXA 3PSEA 3OF8A 1PE6A 1GECE
chains in the Genus database with same CATH topology
1ZIVA 3ERVA 1PPPA 1U9WA 4N8WA 1O0EA 1M6DA 2DJFB 4QH6A 2DCCA 3ZUAA 1ITOA 1KHPA 3MHSA 4I04A 3NHEA 2FTDA 3KSEA 3K8UA 1F2CA 3BPFA 2E02A 1CQDA 1VJVA 1X9YA 3H8BA 3K9MA 1EF7A 2FT2A 5JH3A 2BDLA 3BWKA 4FJCA 2AS8A 2G8EA 3RVVA 4BQVA 4WA6A 2B1MA 8PCHA 3BC3A 3BOWA 1BQIA 2E00A 4BS5A 3QT4A 3D6SA 2PBHA 2GFOA 7PCKA 4G54A 3E1ZB 1A6RA 2OZ2A 4W4UA 4PP2E 2FUDA 5CVOB 1PXVA 1K3BB 4FIPA 3MHHA 3IUTA 1W4TA 2CB5A 4PI3A 1E2TA 4QBBA 1AECA 2PADA 3KX1A 1NB5A 3PBHA 1DEUA 3N3GA 4YYSA 2XU3A 2E03A 2IPPB 3IMAA 3IOQA 2R9MA 3USVA 3P5VA 4RY2A 3RVWA 3N4CA 1TL9A 2AIMA 4Q8GA 1W6FA 4DMYA 2FO5A 4DMXA 2R9FA 3LTWA 1ICFA 1CTEA 2PREA 1TLOA 1GCBA 2G6DA 4CDCB 2ARYA 3CH3X 1MHWA 2C0YA 3WXEA 3CBKA 1VSNA 3MORA 2YJBA 2NQGA 2FQ9A 4YYWA 4XUIA 4W5CA 1AIMA 1PCIA 3LFYA 1CJLA 1AU2A 1F29A 2DC8A 4CDDB 2G7YA 3KFQA 1XKGA 3V6CA 3KKUA 2DCDA 1PIPA 5CVNB 5K16A 2DZZA 2FRQA 1W5RA 4B55A 1MIRA 1DF0A 4MSXA 1ZCMA 3S3QA 1PPDA 1MEGA 4OEMA 2DCAA 4QRVA 2HHNA 1YALA 4QRGA 2ATOA 3O1GA 1BGOA 1Y4HA 3HHIA 4MZSA 3PNRA 3IV2A 3I06A 5A24A 1MDWA 4YYUA 2AYOA 2YJCA 3TNXA 3O0UA 2FRAA 3OVZA 2NQAA 2AUXA 2VHSA 2AUZA 3P5WA 3F75A 3H89A 3K24A 3OVXA 4MZOA 3C9EA 3P5UA 1GX3A 1CB5A 1NPZA 1SP4B 3CBJA 1EWMA 2BSZA 3WXFA 4YYQA 1CV8A 5JA7A 3M99A 2AVWA 4W5BA 1IWDA 2P7UA 1U9VA 1AYUA 1NQCA 4X6HA 3QJ3A 5CHVA 2HD5A 1U9QX 2F7DA 1SNKA 2P86A 4ZUXU 1JQPA 2JQFR 1MS6A 4I07A 1NL6A 1U9XA 6PADA 2BDZA 1AU4A 1YT7A 1ME4A 1QOLA 2F1GA 2GHUA 3PW3A 1PADA 1BP4A 1AYVA 4PADA 3MTNA 9PAPA 1U5IA 3CH2X 3U8EA 3B79A 3HWNA 1MEMA 2R6NA 4AXMA 2DC9A 4FK5A 3KWBX 1AU3A 2OP3A 2YJ9A 4GUZA 3BPMA 4YV8A 2DZYA 4K7CA 2R9CA 3D9WA 3HHAA 2Y6EA 2ACTA 4QRXA 2DC6A 1QXPA 3H8CA 4X6IA 3LXSA 2B1NA 4YYVA 1PPNA 2WBFX 1PBHA 2FYEA 4P6GA 1CPJA 1EWOA 1KHQA 4N79A 4P6EA 2P0RA 2R9NA 5F02A 4CDEB 2XU5A 2XU4A 2IBIA 1CSBB 3PDFA 4CDFB 1EWPA 3P5XA 1CVZA 1YK8A 4YYRA 2JQGR 1YK7A 3I3TA 2XU1A 4I05A 3OISA 5EGWA 1KFXL 3KW9A 4NV7A 3F5VA 1KXRA 2DC7A 4OELA 3H6SA 1PPOA 1F2BA 1QDQA 1TU6A 1ME3A 3H7DA 2DCBA 3AI8A 3OF9A 3QSDA 2NQDB 5J94A 2AYNA 3BCNA 3DF0A 2O6XA 5CHTA 5EF4A 1KFUL 2E01A 2H7JA 1NLJA 1HUCB 3N3KA 4HWYA 1EWLA 2NQIA 3S3RA 4KLBA 1YVBA 5PADA 1GMYA 1STFE 1NB3A 1GLOA 1AU0A 4BS6A 1AYWA 1THEA 3WXGA 4AXLA 2VFBA 2YJ8A 2AU1A 4X6JA 1S4VA 4C5PA 2HH5A 3KWZA 4CZWA 1F2AA 3IHPA 1BY8A 2YJ2A 2VHFA 5FPWA 4BGFA 4N4ZA 5CVMA 4BSQA 3IEJA 4Q8HA 3HD3A 1FH0A 2Y5BA 4PP1A 1POPA 2CIOA 4XR7A 3GCBA 1QMYA 4BPVA 2PNSA 4NV8A 2OULA 2VFCA 2R9OA 2HXZA 2DJGB 2G8JA 4YVAA 3V6EA 1ATKA 1Q6KA 1CS8A 1Y08A 3RVXA 3OF8A 1PE6A 1GECE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZIV A;  3ERV A;  1PPP A;  1U9W A;  4N8W A;  1O0E A;  1M6D A;  2DJF B;  4QH6 A;  2DCC A;  3ZUA A;  1ITO A;  1KHP A;  3MHS A;  4I04 A;  3NHE A;  2FTD A;  3KSE A;  3K8U A;  1F2C A;  3BPF A;  2E02 A;  1CQD A;  1VJV A;  1X9Y A;  3H8B A;  3K9M A;  1EF7 A;  2FT2 A;  5JH3 A;  2BDL A;  3BWK A;  4FJC A;  2AS8 A;  2G8E A;  3RVV A;  4BQV A;  4WA6 A;  2B1M A;  8PCH A;  3BC3 A;  3BOW A;  1BQI A;  2E00 A;  4BS5 A;  3QT4 A;  3D6S A;  2PBH A;  2GFO A;  7PCK A;  4G54 A;  3E1Z B;  1A6R A;  2OZ2 A;  4W4U A;  4PP2 E;  2FUD A;  5CVO B;  1PXV A;  1K3B B;  4FIP A;  3MHH A;  3IUT A;  2CB5 A;  4PI3 A;  4QBB A;  1AEC A;  2PAD A;  3KX1 A;  1NB5 A;  3PBH A;  1DEU A;  3N3G A;  4YYS A;  2XU3 A;  2E03 A;  2IPP B;  3IMA A;  3IOQ A;  2R9M A;  3USV A;  3P5V A;  4RY2 A;  3RVW A;  3N4C A;  1TL9 A;  2AIM A;  4Q8G A;  4DMY A;  2FO5 A;  4DMX A;  2R9F A;  1ICF A;  1CTE A;  2PRE A;  1TLO A;  1GCB A;  2G6D A;  4CDC B;  2ARY A;  3CH3 X;  1MHW A;  2C0Y A;  3WXE A;  3CBK A;  1VSN A;  3MOR A;  2YJB A;  2NQG A;  2FQ9 A;  4YYW A;  4XUI A;  4W5C A;  1AIM A;  1PCI A;  3LFY A;  1CJL A;  1AU2 A;  1F29 A;  2DC8 A;  4CDD B;  2G7Y A;  3KFQ A;  1XKG A;  3V6C A;  3KKU A;  2DCD A;  1PIP A;  5CVN B;  5K16 A;  2DZZ A;  2FRQ A;  1MIR A;  1DF0 A;  4MSX A;  1ZCM A;  3S3Q A;  1PPD A;  1MEG A;  4OEM A;  2DCA A;  4QRV A;  2HHN A;  1YAL A;  4QRG A;  2ATO A;  3O1G A;  1BGO A;  1Y4H A;  3HHI A;  4MZS A;  3PNR A;  3IV2 A;  3I06 A;  5A24 A;  1MDW A;  4YYU A;  2AYO A;  2YJC A;  3TNX A;  3O0U A;  2FRA A;  3OVZ A;  2NQA A;  2AUX A;  2VHS A;  2AUZ A;  3P5W A;  3F75 A;  3H89 A;  3K24 A;  3OVX A;  4MZO A;  3C9E A;  3P5U A;  1CB5 A;  1NPZ A;  1SP4 B;  3CBJ A;  1EWM A;  3WXF A;  4YYQ A;  1CV8 A;  5JA7 A;  3M99 A;  2AVW A;  4W5B A;  1IWD A;  2P7U A;  1U9V A;  1AYU A;  1NQC A;  4X6H A;  3QJ3 A;  5CHV A;  2HD5 A;  1U9Q X;  2F7D A;  1SNK A;  2P86 A;  4ZUX U;  1JQP A;  2JQF R;  1MS6 A;  4I07 A;  1NL6 A;  1U9X A;  6PAD A;  2BDZ A;  1AU4 A;  1YT7 A;  1ME4 A;  1QOL A;  2F1G A;  2GHU A;  3PW3 A;  1PAD A;  1BP4 A;  1AYV A;  4PAD A;  3MTN A;  9PAP A;  1U5I A;  3CH2 X;  3U8E A;  3B79 A;  3HWN A;  1MEM A;  2R6N A;  4AXM A;  2DC9 A;  4FK5 A;  3KWB X;  1AU3 A;  2OP3 A;  2YJ9 A;  3BPM A;  4YV8 A;  2DZY A;  4K7C A;  2R9C A;  3HHA A;  2Y6E A;  2ACT A;  4QRX A;  2DC6 A;  1QXP A;  3H8C A;  4X6I A;  3LXS A;  2B1N A;  4YYV A;  1PPN A;  2WBF X;  1PBH A;  2FYE A;  4P6G A;  1CPJ A;  1EWO A;  1KHQ A;  4N79 A;  4P6E A;  2P0R A;  2R9N A;  5F02 A;  4CDE B;  2XU5 A;  2XU4 A;  2IBI A;  1CSB B;  3PDF A;  4CDF B;  1EWP A;  3P5X A;  1CVZ A;  1YK8 A;  4YYR A;  2JQG R;  1YK7 A;  3I3T A;  2XU1 A;  4I05 A;  3OIS A;  5EGW A;  1KFX L;  3KW9 A;  3F5V A;  1KXR A;  2DC7 A;  4OEL A;  3H6S A;  1PPO A;  1F2B A;  1QDQ A;  1TU6 A;  1ME3 A;  3H7D A;  2DCB A;  3AI8 A;  3OF9 A;  3QSD A;  2NQD B;  5J94 A;  2AYN A;  3BCN A;  3DF0 A;  2O6X A;  5CHT A;  5EF4 A;  1KFU L;  2E01 A;  2H7J A;  1NLJ A;  1HUC B;  3N3K A;  4HWY A;  1EWL A;  2NQI A;  3S3R A;  4KLB A;  1YVB A;  5PAD A;  1GMY A;  1STF E;  1NB3 A;  1GLO A;  1AU0 A;  4BS6 A;  1AYW A;  1THE A;  3WXG A;  4AXL A;  2YJ8 A;  2AU1 A;  4X6J A;  1S4V A;  2HH5 A;  3KWZ A;  4CZW A;  1F2A A;  3IHP A;  1BY8 A;  2YJ2 A;  2VHF A;  5FPW A;  4N4Z A;  5CVM A;  4BSQ A;  3IEJ A;  4Q8H A;  3HD3 A;  1FH0 A;  2Y5B A;  4PP1 A;  1POP A;  2CIO A;  4XR7 A;  3GCB A;  1QMY A;  4BPV A;  2PNS A;  2OUL A;  2R9O A;  2HXZ A;  2DJG B;  2G8J A;  4YVA A;  3V6E A;  1ATK A;  1Q6K A;  1CS8 A;  1Y08 A;  3RVX A;  3OF8 A;  1PE6 A;  1GEC E; 
#chains in the Genus database with same CATH topology
 4RKX A;  1ZIV A;  3ERV A;  2BTW B;  4D8E A;  1PPP A;  3PHU A;  1U9W A;  5EZQ A;  4N8W A;  1O0E A;  1M6D A;  2DJF B;  4QH6 A;  2DCC A;  3ZUA A;  4REZ A;  1ITO A;  1KHP A;  3MHS A;  4I04 A;  3NHE A;  2FTD A;  3KSE A;  2JTC A;  3K8U A;  1F2C A;  3BPF A;  2E02 A;  1CQD A;  1VJV A;  1X9Y A;  3BY4 A;  3H8B A;  5E6J A;  3ZNH A;  3K9M A;  1EF7 A;  3BBA A;  2FT2 A;  4BOU A;  5JH3 A;  2BDL A;  3BWK A;  4FJC A;  4MI7 A;  2AS8 A;  2G8E A;  3RVV A;  4BQV A;  4WA6 A;  2B1M A;  8PCH A;  3BC3 A;  3BOW A;  1BQI A;  2E00 A;  2Z84 A;  4BS5 A;  3QT4 A;  3D6S A;  3PRM A;  2PBH A;  4MM3 B;  2GFO A;  7PCK A;  4G54 A;  3E1Z B;  1A6R A;  2OZ2 A;  4W4U A;  4PP2 E;  2FUD A;  5CVO B;  1PXV A;  1K3B B;  4FIP A;  3MHH A;  3IUT A;  2CB5 A;  4PI3 A;  4QBB A;  1AEC A;  2PAD A;  3KX1 A;  2J7Q C;  1NB5 A;  3PBH A;  1DEU A;  4BOZ A;  3N3G A;  3BB7 A;  4YYS A;  2XU3 A;  2E03 A;  3C0R A;  2IPP B;  3IMA A;  3IOQ A;  2R9M A;  1PVJ A;  3USV A;  3P5V A;  4RY2 A;  3RVW A;  3N4C A;  1TL9 A;  2AIM A;  4Q8G A;  2FE8 A;  4DMY A;  2FO5 A;  4DMX A;  2R9F A;  1ICF A;  1CTE A;  2PRE A;  4M0W A;  5EZS A;  1TLO A;  1GCB A;  3PT2 A;  2G6D A;  4CDC B;  2ARY A;  3CH3 X;  1MHW A;  2C0Y A;  3WXE A;  3CBK A;  1VSN A;  3MOR A;  2HWK A;  2YJB A;  2NQG A;  4RF0 A;  2FQ9 A;  2UZJ A;  3TMP A;  4YYW A;  4XUI A;  4W5C A;  1AIM A;  1PCI A;  3LFY A;  1CJL A;  1AU2 A;  1F29 A;  2DC8 A;  4CDD B;  2G7Y A;  4BOS A;  3KFQ A;  1XKG A;  3V6C A;  3KKU A;  2DCD A;  1PIP A;  5CVN B;  5K16 A;  2DZZ A;  2FRQ A;  2BTW A;  3B21 A;  1MIR A;  1DF0 A;  4MSX A;  1ZCM A;  3S3Q A;  1PPD A;  1MEG A;  4OEM A;  2DCA A;  4QRV A;  2JRI A;  2HHN A;  1YAL A;  4QRG A;  2ATO A;  3O1G A;  1BGO A;  1Y4H A;  3HHI A;  4MZS A;  3PNR A;  3IV2 A;  3I06 A;  5A24 A;  5JZE A;  1MDW A;  4YYU A;  2AYO A;  2YJC A;  3TNX A;  3O0U A;  2FRA A;  4OW0 A;  3OVZ A;  4WUR A;  4BOQ A;  2NQA A;  2AUX A;  2VHS A;  2AUZ A;  3P5W A;  3F75 A;  3H89 A;  4IUM A;  3K24 A;  3OVX A;  4MZO A;  3C9E A;  3P5U A;  1CB5 A;  1NPZ A;  1SP4 B;  3CBJ A;  1EWM A;  3WXF A;  4YYQ A;  1CV8 A;  5JA7 A;  3M99 A;  2AVW A;  4W5B A;  1IWD A;  2P7U A;  1U9V A;  1AYU A;  1NQC A;  4X6H A;  3QJ3 A;  5CHV A;  4A5U A;  2HD5 A;  1U9Q X;  2F7D A;  1SNK A;  1DKI A;  2P86 A;  4ZUX U;  1JQP A;  4HXD B;  2JQF R;  1MS6 A;  4I07 A;  1NL6 A;  4XZX A;  1U9X A;  4RF1 A;  6PAD A;  2BDZ A;  1AU4 A;  1YT7 A;  1ME4 A;  1QOL A;  2AGA A;  2F1G A;  2GHU A;  3PW3 A;  1PAD A;  1BP4 A;  1AYV A;  4PAD A;  4PT5 A;  3MTN A;  3W30 A;  9PAP A;  5KO3 A;  1U5I A;  3CH2 X;  3PHX A;  3U8E A;  3B79 A;  3HWN A;  1MEM A;  2R6N A;  4AXM A;  2DC9 A;  4FK5 A;  3KWB X;  1AU3 A;  2OP3 A;  2YJ9 A;  4OVZ B;  3BPM A;  4YV8 A;  2DOS A;  2DZY A;  4K7C A;  2R9C A;  4D8B A;  3HHA A;  2Y6E A;  2ACT A;  4QRX A;  2DC6 A;  1QXP A;  3H8C A;  1UKF A;  3LXS A;  4X6I A;  2B1N A;  4YYV A;  4P16 A;  1PPN A;  2WBF X;  2J7Q A;  1PBH A;  2FYE A;  4OVZ A;  4P6G A;  1CPJ A;  1EWO A;  1KHQ A;  4N79 A;  4P6E A;  2P0R A;  2R9N A;  5F02 A;  4CDE B;  2XU5 A;  2XU4 A;  1YZB A;  2IBI A;  1CSB B;  3PDF A;  4CDF B;  1EWP A;  3P5X A;  1CVZ A;  1YK8 A;  4BOP A;  4YYR A;  3MJ5 A;  2JQG R;  1YK7 A;  3I3T A;  3MP2 A;  2XU1 A;  4I05 A;  3OIS A;  5EGW A;  4GUA A;  1KFX L;  3O65 A;  3KW9 A;  4RNA A;  3F5V A;  1KXR A;  2DC7 A;  4OEL A;  3H6S A;  1PPO A;  1F2B A;  1QDQ A;  1TU6 A;  1ME3 A;  3H7D A;  2DCB A;  3AI8 A;  3OF9 A;  3QSD A;  2NQD B;  5J94 A;  2AYN A;  3BCN A;  3IFU A;  3DF0 A;  2O6X A;  5CHT A;  5EF4 A;  1KFU L;  2E01 A;  3RNV A;  2H7J A;  1NLJ A;  1HUC B;  3N3K A;  4HWY A;  1EWL A;  2NQI A;  3S3R A;  4KLB A;  1YVB A;  5PAD A;  1GMY A;  1STF E;  3MTV A;  1NB3 A;  1GLO A;  1AU0 A;  4BS6 A;  1AYW A;  2BU3 A;  1THE A;  3W31 A;  3WXG A;  4AXL A;  2YJ8 A;  2AU1 A;  4X6J A;  1S4V A;  4R3D A;  2HH5 A;  3KWZ A;  4CZW A;  1F2A A;  3IHP A;  1BY8 A;  2YJ2 A;  2VHF A;  5FPW A;  4N4Z A;  4D8I A;  5CVM A;  4BSQ A;  4ZTB A;  3IEJ A;  4Q8H A;  3PRP A;  3HD3 A;  1FH0 A;  2Y5B A;  4PP1 A;  1POP A;  2CIO A;  4XR7 A;  3GCB A;  3PHW A;  4IP3 A;  1QMY A;  4BPV A;  3TRK A;  2PNS A;  2OUL A;  2R9O A;  2HXZ A;  2DJG B;  2G8J A;  3OQC A;  4YVA A;  3V6E A;  1ATK A;  1Q6K A;  3E9S A;  1CS8 A;  1Y08 A;  3RVX A;  3PSE A;  3OF8 A;  1PE6 A;  1GEC E; 
#chains in the Genus database with same CATH homology
 1ZIV A;  3ERV A;  1PPP A;  1U9W A;  4N8W A;  1O0E A;  1M6D A;  2DJF B;  4QH6 A;  2DCC A;  3ZUA A;  1ITO A;  1KHP A;  3MHS A;  4I04 A;  3NHE A;  2FTD A;  3KSE A;  3K8U A;  1F2C A;  3BPF A;  2E02 A;  1CQD A;  1VJV A;  1X9Y A;  3H8B A;  3K9M A;  1EF7 A;  2FT2 A;  5JH3 A;  2BDL A;  3BWK A;  4FJC A;  2AS8 A;  2G8E A;  3RVV A;  4BQV A;  4WA6 A;  2B1M A;  8PCH A;  3BC3 A;  3BOW A;  1BQI A;  2E00 A;  4BS5 A;  3QT4 A;  3D6S A;  2PBH A;  2GFO A;  7PCK A;  4G54 A;  3E1Z B;  1A6R A;  2OZ2 A;  4W4U A;  4PP2 E;  2FUD A;  5CVO B;  1PXV A;  1K3B B;  4FIP A;  3MHH A;  3IUT A;  1W4T A;  2CB5 A;  4PI3 A;  1E2T A;  4QBB A;  1AEC A;  2PAD A;  3KX1 A;  1NB5 A;  3PBH A;  1DEU A;  3N3G A;  4YYS A;  2XU3 A;  2E03 A;  2IPP B;  3IMA A;  3IOQ A;  2R9M A;  3USV A;  3P5V A;  4RY2 A;  3RVW A;  3N4C A;  1TL9 A;  2AIM A;  4Q8G A;  1W6F A;  4DMY A;  2FO5 A;  4DMX A;  2R9F A;  3LTW A;  1ICF A;  1CTE A;  2PRE A;  1TLO A;  1GCB A;  2G6D A;  4CDC B;  2ARY A;  3CH3 X;  1MHW A;  2C0Y A;  3WXE A;  3CBK A;  1VSN A;  3MOR A;  2YJB A;  2NQG A;  2FQ9 A;  4YYW A;  4XUI A;  4W5C A;  1AIM A;  1PCI A;  3LFY A;  1CJL A;  1AU2 A;  1F29 A;  2DC8 A;  4CDD B;  2G7Y A;  3KFQ A;  1XKG A;  3V6C A;  3KKU A;  2DCD A;  1PIP A;  5CVN B;  5K16 A;  2DZZ A;  2FRQ A;  1W5R A;  4B55 A;  1MIR A;  1DF0 A;  4MSX A;  1ZCM A;  3S3Q A;  1PPD A;  1MEG A;  4OEM A;  2DCA A;  4QRV A;  2HHN A;  1YAL A;  4QRG A;  2ATO A;  3O1G A;  1BGO A;  1Y4H A;  3HHI A;  4MZS A;  3PNR A;  3IV2 A;  3I06 A;  5A24 A;  1MDW A;  4YYU A;  2AYO A;  2YJC A;  3TNX A;  3O0U A;  2FRA A;  3OVZ A;  2NQA A;  2AUX A;  2VHS A;  2AUZ A;  3P5W A;  3F75 A;  3H89 A;  3K24 A;  3OVX A;  4MZO A;  3C9E A;  3P5U A;  1GX3 A;  1CB5 A;  1NPZ A;  1SP4 B;  3CBJ A;  1EWM A;  2BSZ A;  3WXF A;  4YYQ A;  1CV8 A;  5JA7 A;  3M99 A;  2AVW A;  4W5B A;  1IWD A;  2P7U A;  1U9V A;  1AYU A;  1NQC A;  4X6H A;  3QJ3 A;  5CHV A;  2HD5 A;  1U9Q X;  2F7D A;  1SNK A;  2P86 A;  4ZUX U;  1JQP A;  2JQF R;  1MS6 A;  4I07 A;  1NL6 A;  1U9X A;  6PAD A;  2BDZ A;  1AU4 A;  1YT7 A;  1ME4 A;  1QOL A;  2F1G A;  2GHU A;  3PW3 A;  1PAD A;  1BP4 A;  1AYV A;  4PAD A;  3MTN A;  9PAP A;  1U5I A;  3CH2 X;  3U8E A;  3B79 A;  3HWN A;  1MEM A;  2R6N A;  4AXM A;  2DC9 A;  4FK5 A;  3KWB X;  1AU3 A;  2OP3 A;  2YJ9 A;  4GUZ A;  3BPM A;  4YV8 A;  2DZY A;  4K7C A;  2R9C A;  3D9W A;  3HHA A;  2Y6E A;  2ACT A;  4QRX A;  2DC6 A;  1QXP A;  3H8C A;  4X6I A;  3LXS A;  2B1N A;  4YYV A;  1PPN A;  2WBF X;  1PBH A;  2FYE A;  4P6G A;  1CPJ A;  1EWO A;  1KHQ A;  4N79 A;  4P6E A;  2P0R A;  2R9N A;  5F02 A;  4CDE B;  2XU5 A;  2XU4 A;  2IBI A;  1CSB B;  3PDF A;  4CDF B;  1EWP A;  3P5X A;  1CVZ A;  1YK8 A;  4YYR A;  2JQG R;  1YK7 A;  3I3T A;  2XU1 A;  4I05 A;  3OIS A;  5EGW A;  1KFX L;  3KW9 A;  4NV7 A;  3F5V A;  1KXR A;  2DC7 A;  4OEL A;  3H6S A;  1PPO A;  1F2B A;  1QDQ A;  1TU6 A;  1ME3 A;  3H7D A;  2DCB A;  3AI8 A;  3OF9 A;  3QSD A;  2NQD B;  5J94 A;  2AYN A;  3BCN A;  3DF0 A;  2O6X A;  5CHT A;  5EF4 A;  1KFU L;  2E01 A;  2H7J A;  1NLJ A;  1HUC B;  3N3K A;  4HWY A;  1EWL A;  2NQI A;  3S3R A;  4KLB A;  1YVB A;  5PAD A;  1GMY A;  1STF E;  1NB3 A;  1GLO A;  1AU0 A;  4BS6 A;  1AYW A;  1THE A;  3WXG A;  4AXL A;  2VFB A;  2YJ8 A;  2AU1 A;  4X6J A;  1S4V A;  4C5P A;  2HH5 A;  3KWZ A;  4CZW A;  1F2A A;  3IHP A;  1BY8 A;  2YJ2 A;  2VHF A;  5FPW A;  4BGF A;  4N4Z A;  5CVM A;  4BSQ A;  3IEJ A;  4Q8H A;  3HD3 A;  1FH0 A;  2Y5B A;  4PP1 A;  1POP A;  2CIO A;  4XR7 A;  3GCB A;  1QMY A;  4BPV A;  2PNS A;  4NV8 A;  2OUL A;  2VFC A;  2R9O A;  2HXZ A;  2DJG B;  2G8J A;  4YVA A;  3V6E A;  1ATK A;  1Q6K A;  1CS8 A;  1Y08 A;  3RVX A;  3OF8 A;  1PE6 A;  1GEC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...