3PNRA

Structure of pbicp-c in complex with falcipain-2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
b'MNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSAWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pnrA00
5JA7A 4BS5A 3S3QA 2XU1A 1MEMA 1YK7A 3N3KA 3OVXA 4CZWA 3K8UA 3PNRA 2G6DA 2FRAA 1KXRA 3KKUA 1QMYA 2AYOA 5CVOB 1YK8A 2GHUA 1EWLA 4QH6A 3OVZA 2IPPB 2DJGB 3IEJA 3LXSA 1DEUA 2WBFX 3H8BA 1BY8A 4YYWA 2AUXA 1CPJA 3DF0A 4K7CA 1S4VA 2R9MA 1PBHA 2B1NA 3KFQA 1MS6A 1MDWA 2R6NA 2VHSA 1EWPA 4OELA 2R9CA 1KFUL 1AIMA 1PCIA 3V6EA 2G8JA 1PADA 1CV8A 1SP4B 2FQ9A 4I04A 4X6HA 2ATOA 3M99A 4W5CA 3HWNA 1ITOA 2ARYA 3B79A 3KWBX 8PCHA 3IOQA 3IMAA 1MEGA 2E01A 2NQAA 2O6XA 5A24A 1KFXL 2P0RA 2DJFB 1VSNA 2HH5A 4AXLA 2FRQA 3I3TA 3MHSA 4YYRA 9PAPA 2DC7A 1F2CA 1IWDA 4X6IA 4W5BA 1CQDA 1XKGA 5EF4A 1AYWA 5CVMA 2Y5BA 4BSQA 3BOWA 1BP4A 4N4ZA 1ICFA 3CBJA 4I05A 2HHNA 2F1GA 4DMYA 2NQGA 1JQPA 4BS6A 2YJ8A 3BPFA 1PPDA 1AECA 4KLBA 3LFYA 4BQVA 3H7DA 3V6CA 1GLOA 2YJCA 3NHEA 4W4UA 2YJ2A 5JH3A 1Y4HA 2B1MA 4N8WA 1HUCB 1POPA 2NQIA 1NB3A 4WA6A 2DC9A 3P5VA 2XU3A 1Q6KA 3QSDA 4PP2E 2G7YA 3IHPA 5CHTA 1QDQA 5K16A 5CHVA 3AI8A 1AU0A 2PBHA 2F7DA 3O1GA 3HHAA 4FJCA 3USVA 4QBBA 1CS8A 2GFOA 3OISA 1ME4A 1U9WA 1MHWA 1NL6A 2YJBA 1QXPA 2DCDA 2P7UA 2FO5A 1SNKA 2AU1A 3CH3X 1FH0A 2FT2A 4QRVA 2FYEA 1ZCMA 4CDFB 3S3RA 3CBKA 2PADA 3ZUAA 4AXMA 3CH2X 3PW3A 1U5IA 2DCCA 2R9FA 4CDCB 3P5UA 3KWZA 2DC6A 3P5XA 2E03A 2JQGR 1PPPA 4QRGA 3MTNA 4FIPA 2Y6EA 4MSXA 1ATKA 4G54A 3D6SA 4P6EA 3N4CA 4XR7A 1DF0A 1CB5A 3E1ZB 1A6RA 3QJ3A 2DZYA 2AUZA 3C9EA 3K9MA 1PE6A 3N3GA 1U9VA 3U8EA 1YVBA 2AS8A 1MIRA 1M6DA 3HD3A 3F5VA 2DCBA 2G8EA 4DMXA 2PNSA 2VHFA 4MZSA 3F75A 1AU3A 5CVNB 4YVAA 1U9XA 3RVVA 3PDFA 3ERVA 3KSEA 1EWMA 3RVXA 1CVZA 2NQDB 3KW9A 4PI3A 4QRXA 3MORA 3K24A 2YJ9A 3H89A 2DC8A 6PADA 2R9NA 7PCKA 1NLJA 1NB5A 4Q8HA 3BC3A 1NQCA 1NPZA 3H6SA 2ACTA 3OF9A 1GCBA 1THEA 3PBHA 1KHPA 3WXEA 1O0EA 4YV8A 4RY2A 1PPNA 1CTEA 4OEMA 4CDEB 1PXVA 1F2BA 2H7JA 1BQIA 1ME3A 4PADA 3IUTA 1TU6A 2BDZA 2PREA 1X9YA 2OP3A 1AYUA 3BPMA 3GCBA 4XUIA 2R9OA 4HWYA 4FK5A 1PIPA 1AU4A 3KX1A 2DCAA 1QOLA 5F02A 3WXGA 1EWOA 1Y08A 2FTDA 2AVWA 2CB5A 3BCNA 1VJVA 1CSBB 1STFE 4X6JA 2HXZA 3I06A 4PP1A 1F29A 3BWKA 3QT4A 4MZOA 2IBIA 1U9QX 1YT7A 5FPWA 1F2AA 1AYVA 2BDLA 4I07A 4ZUXU 3OF8A 2C0YA 1TLOA 2JQFR 4CDDB 1GECE 4YYSA 1KHQA 4Q8GA 4N79A 3IV2A 2FUDA 1GMYA 1K3BB 3H8CA 5EGWA 2OZ2A 4YYUA 4P6GA 3WXFA 4YYVA 1AU2A 1PPOA 2E02A 3O0UA 3RVWA 2HD5A 2XU5A 3HHIA 3P5WA 1ZIVA 1BGOA 3TNXA 4BPVA 1YALA 2E00A 2DZZA 2XU4A 2OULA 2AIMA 2P86A 2AYNA 2CIOA 1EF7A 3MHHA 5J94A 4YYQA 1TL9A 5PADA 1CJLA
chains in the Genus database with same CATH superfamily
3ZNHA 5JA7A 4BS5A 4OVZB 3S3QA 2XU1A 1MEMA 1YK7A 3N3KA 4IUMA 3OVXA 4CZWA 3K8UA 3PNRA 2G6DA 2FRAA 1KXRA 4BOPA 3KKUA 1QMYA 2AYOA 5CVOB 1YK8A 4XZXA 2GHUA 3PHXA 3B21A 1EWLA 4QH6A 3IFUA 4RF0A 2JTCA 3OVZA 2IPPB 2DJGB 3IEJA 3LXSA 4IP3A 1DEUA 2WBFX 3H8BA 1BY8A 4YYWA 1PVJA 2AUXA 1CPJA 3DF0A 4K7CA 1S4VA 2R9MA 1PBHA 2B1NA 3KFQA 1MS6A 4MM3B 1MDWA 2R6NA 2VHSA 1EWPA 4OELA 2R9CA 1KFUL 1AIMA 2DOSA 1PCIA 4D8EA 2G8JA 3V6EA 1PADA 1CV8A 2Z84A 1SP4B 2FQ9A 4I04A 4X6HA 2ATOA 3M99A 4W5CA 3HWNA 4RNAA 1ITOA 2ARYA 3B79A 3KWBX 8PCHA 3IOQA 3IMAA 1MEGA 2E01A 2NQAA 2O6XA 5A24A 1KFXL 2P0RA 2DJFB 1VSNA 2HH5A 4AXLA 2FRQA 3I3TA 3MHSA 3PRMA 3O65A 4YYRA 9PAPA 2DC7A 1F2CA 1IWDA 3MP2A 4X6IA 2BTWB 4W5BA 1CQDA 4PT5A 1XKGA 3PHWA 5EF4A 1AYWA 5CVMA 4HXDB 2Y5BA 4RKXA 4BSQA 3BOWA 1BP4A 4D8IA 4N4ZA 3PSEA 3E9SA 1ICFA 3CBJA 4I05A 2HHNA 2F1GA 4DMYA 2NQGA 3BY4A 1JQPA 4BS6A 2YJ8A 3BPFA 1PPDA 1AECA 4D8BA 4KLBA 3LFYA 4BQVA 3H7DA 3V6CA 1GLOA 2YJCA 3NHEA 4W4UA 2J7QA 2YJ2A 5JH3A 1Y4HA 2B1MA 4N8WA 1HUCB 1POPA 2NQIA 1NB3A 4MI7A 4WA6A 2DC9A 3P5VA 2XU3A 4OVZA 1Q6KA 3QSDA 4PP2E 2G7YA 3IHPA 5CHTA 1QDQA 5K16A 5CHVA 3MJ5A 3AI8A 1AU0A 2PBHA 2F7DA 3O1GA 3HHAA 4FJCA 3USVA 4QBBA 1CS8A 2GFOA 3OISA 1ME4A 1U9WA 1MHWA 1NL6A 2YJBA 1QXPA 2DCDA 2P7UA 5JZEA 2FO5A 3TRKA 1SNKA 2AU1A 3CH3X 1FH0A 2FT2A 4A5UA 2JRIA 4QRVA 2FYEA 1ZCMA 4CDFB 3S3RA 3CBKA 2PADA 3ZUAA 4AXMA 3CH2X 3PW3A 1U5IA 3PHUA 2DCCA 2R9FA 4CDCB 3P5UA 3KWZA 4P16A 2DC6A 3P5XA 2E03A 2JQGR 1PPPA 2BU3A 4QRGA 3MTNA 4FIPA 2Y6EA 4MSXA 1ATKA 4G54A 3D6SA 4P6EA 3N4CA 4XR7A 1DF0A 1CB5A 5EZQA 3E1ZB 1A6RA 3QJ3A 5KO3A 2DZYA 2AUZA 3C9EA 3K9MA 1PE6A 3N3GA 1U9VA 3U8EA 1YVBA 4GUAA 2AS8A 2UZJA 1MIRA 1M6DA 3HD3A 3F5VA 2DCBA 2G8EA 3BB7A 4OW0A 4DMXA 2PNSA 2VHFA 4MZSA 3F75A 1AU3A 5CVNB 4YVAA 1U9XA 3PRPA 3RVVA 3PDFA 3RNVA 3ERVA 3KSEA 1EWMA 3RVXA 1CVZA 2NQDB 3KW9A 4PI3A 4QRXA 3MORA 3K24A 2YJ9A 4RF1A 3C0RA 3H89A 2DC8A 6PADA 2R9NA 4ZTBA 7PCKA 1NLJA 3TMPA 4Q8HA 1NB5A 4M0WA 3BC3A 1NQCA 1NPZA 3H6SA 2ACTA 3OF9A 4BOSA 1GCBA 1THEA 3PBHA 2AGAA 1KHPA 3WXEA 1O0EA 4YV8A 4RY2A 1PPNA 1CTEA 4OEMA 4CDEB 1PXVA 1F2BA 2H7JA 5EZSA 1BQIA 1ME3A 4PADA 3IUTA 1TU6A 2BDZA 2PREA 1X9YA 2OP3A 3W30A 2HWKA 1AYUA 3BPMA 4R3DA 3GCBA 4XUIA 2BTWA 2R9OA 4HWYA 4FK5A 1PIPA 1AU4A 3KX1A 2DCAA 4BOUA 1QOLA 5F02A 3WXGA 1EWOA 1Y08A 2FTDA 2AVWA 2CB5A 3BCNA 1VJVA 1CSBB 1STFE 4X6JA 1YZBA 2HXZA 3I06A 4PP1A 1F29A 3BWKA 3QT4A 4MZOA 2IBIA 1U9QX 1YT7A 2FE8A 5FPWA 3PT2A 1F2AA 1AYVA 2BDLA 1DKIA 4I07A 3BBAA 4ZUXU 3OF8A 4REZA 2C0YA 1TLOA 2JQFR 4CDDB 1GECE 4YYSA 4WURA 1KHQA 4N79A 4Q8GA 3IV2A 2FUDA 1GMYA 1K3BB 3H8CA 3MTVA 5EGWA 1UKFA 2OZ2A 4YYUA 4P6GA 4BOQA 3WXFA 4YYVA 1AU2A 1PPOA 2E02A 3OQCA 3W31A 3O0UA 3RVWA 2HD5A 2XU5A 3HHIA 3P5WA 2J7QC 1ZIVA 1BGOA 3TNXA 4BPVA 1YALA 5E6JA 2E00A 2DZZA 2XU4A 2OULA 2AIMA 2P86A 4BOZA 2AYNA 2CIOA 1EF7A 3MHHA 5J94A 4YYQA 1TL9A 5PADA 1CJLA
chains in the Genus database with same CATH topology
5JA7A 4BS5A 3S3QA 2XU1A 1MEMA 1YK7A 3N3KA 3OVXA 4CZWA 3K8UA 3PNRA 2G6DA 2FRAA 1KXRA 3KKUA 1QMYA 2AYOA 5CVOB 1YK8A 2GHUA 1EWLA 4QH6A 3OVZA 2IPPB 2DJGB 3IEJA 1W6FA 3LXSA 1DEUA 2WBFX 3H8BA 1BY8A 4YYWA 2AUXA 3DF0A 1CPJA 4K7CA 1S4VA 2R9MA 1PBHA 2B1NA 3KFQA 1MS6A 1MDWA 2R6NA 2VHSA 1EWPA 4OELA 2R9CA 1KFUL 1AIMA 1PCIA 2G8JA 3V6EA 1PADA 1CV8A 1SP4B 2FQ9A 4I04A 4X6HA 2ATOA 3M99A 4W5CA 3HWNA 1ITOA 2ARYA 3B79A 3KWBX 8PCHA 4C5PA 3IOQA 3IMAA 1MEGA 2E01A 2NQAA 2O6XA 5A24A 1KFXL 2P0RA 2DJFB 1VSNA 2HH5A 4AXLA 2FRQA 4BGFA 3I3TA 3MHSA 4YYRA 9PAPA 2DC7A 4B55A 1F2CA 1IWDA 4X6IA 4W5BA 1CQDA 1XKGA 5EF4A 1AYWA 5CVMA 2Y5BA 4BSQA 3BOWA 1BP4A 4N4ZA 1ICFA 3CBJA 4I05A 2HHNA 2F1GA 4DMYA 2NQGA 1JQPA 4BS6A 2YJ8A 3BPFA 1PPDA 1AECA 4KLBA 3LFYA 4BQVA 3H7DA 3V6CA 1GLOA 2YJCA 3NHEA 4W4UA 4GUZA 2YJ2A 5JH3A 1Y4HA 2B1MA 4N8WA 1HUCB 1POPA 2NQIA 1NB3A 4NV7A 4WA6A 2DC9A 1W5RA 3P5VA 2XU3A 1Q6KA 3QSDA 4PP2E 2G7YA 3IHPA 5CHTA 1QDQA 5K16A 5CHVA 3AI8A 1AU0A 2PBHA 2F7DA 3O1GA 3HHAA 4FJCA 3USVA 4QBBA 1CS8A 2GFOA 3OISA 1ME4A 1U9WA 1MHWA 1NL6A 2YJBA 1QXPA 2DCDA 2P7UA 2FO5A 1W4TA 1SNKA 2AU1A 3CH3X 1FH0A 2FT2A 3D9WA 4QRVA 2FYEA 1ZCMA 4CDFB 3S3RA 3CBKA 2PADA 3ZUAA 4AXMA 3CH2X 3PW3A 1U5IA 2DCCA 2R9FA 4CDCB 3P5UA 3KWZA 2DC6A 3P5XA 2E03A 2JQGR 1PPPA 4QRGA 3MTNA 4FIPA 2Y6EA 4MSXA 1ATKA 4G54A 3D6SA 4P6EA 3N4CA 4XR7A 1DF0A 1CB5A 3E1ZB 1A6RA 3QJ3A 2BSZA 2DZYA 2AUZA 3C9EA 3K9MA 1PE6A 3N3GA 1U9VA 3U8EA 1YVBA 2AS8A 1MIRA 1M6DA 3HD3A 3F5VA 2DCBA 2G8EA 4DMXA 2PNSA 3LTWA 2VHFA 4MZSA 3F75A 1AU3A 5CVNB 4YVAA 1U9XA 3RVVA 3PDFA 3ERVA 3KSEA 1EWMA 3RVXA 1CVZA 2NQDB 3KW9A 4PI3A 4QRXA 3MORA 3K24A 2YJ9A 3H89A 2DC8A 6PADA 2VFCA 2R9NA 7PCKA 1NLJA 1NB5A 4Q8HA 3BC3A 1NQCA 1NPZA 3H6SA 2ACTA 3OF9A 4NV8A 1GCBA 1THEA 3PBHA 1KHPA 3WXEA 1O0EA 4YV8A 4RY2A 1PPNA 1CTEA 4OEMA 4CDEB 1PXVA 1F2BA 2H7JA 1BQIA 1ME3A 4PADA 3IUTA 1TU6A 2BDZA 2PREA 1X9YA 2OP3A 1AYUA 3BPMA 3GCBA 4XUIA 2R9OA 4HWYA 4FK5A 1PIPA 1AU4A 3KX1A 2DCAA 1QOLA 5F02A 3WXGA 1EWOA 1Y08A 2FTDA 2AVWA 2CB5A 3BCNA 1VJVA 1CSBB 1STFE 4X6JA 2HXZA 3I06A 4PP1A 1F29A 3BWKA 3QT4A 4MZOA 2IBIA 1U9QX 1YT7A 5FPWA 1F2AA 1AYVA 2BDLA 4I07A 4ZUXU 3OF8A 2C0YA 1GX3A 1TLOA 2JQFR 4CDDB 1GECE 4YYSA 1KHQA 4Q8GA 4N79A 3IV2A 2FUDA 1GMYA 1K3BB 3H8CA 5EGWA 2OZ2A 4YYUA 4P6GA 3WXFA 4YYVA 1AU2A 1PPOA 2E02A 3O0UA 3RVWA 2HD5A 2XU5A 3HHIA 3P5WA 1ZIVA 1BGOA 3TNXA 4BPVA 1YALA 2E00A 2VFBA 2DZZA 2XU4A 2OULA 2AIMA 2P86A 1E2TA 2AYNA 2CIOA 1EF7A 3MHHA 5J94A 4YYQA 1TL9A 5PADA 1CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JA7 A;  4BS5 A;  3S3Q A;  2XU1 A;  1MEM A;  1YK7 A;  3N3K A;  3OVX A;  4CZW A;  3K8U A;  3PNR A;  2G6D A;  2FRA A;  1KXR A;  3KKU A;  1QMY A;  2AYO A;  5CVO B;  1YK8 A;  2GHU A;  1EWL A;  4QH6 A;  3OVZ A;  2IPP B;  2DJG B;  3IEJ A;  3LXS A;  1DEU A;  2WBF X;  3H8B A;  1BY8 A;  4YYW A;  2AUX A;  1CPJ A;  3DF0 A;  4K7C A;  1S4V A;  2R9M A;  1PBH A;  2B1N A;  3KFQ A;  1MS6 A;  1MDW A;  2R6N A;  2VHS A;  1EWP A;  4OEL A;  2R9C A;  1KFU L;  1AIM A;  1PCI A;  3V6E A;  2G8J A;  1PAD A;  1CV8 A;  1SP4 B;  2FQ9 A;  4I04 A;  4X6H A;  2ATO A;  3M99 A;  4W5C A;  3HWN A;  1ITO A;  2ARY A;  3B79 A;  3KWB X;  8PCH A;  3IOQ A;  3IMA A;  1MEG A;  2E01 A;  2NQA A;  2O6X A;  5A24 A;  1KFX L;  2P0R A;  2DJF B;  1VSN A;  2HH5 A;  4AXL A;  2FRQ A;  3I3T A;  3MHS A;  4YYR A;  9PAP A;  2DC7 A;  1F2C A;  1IWD A;  4X6I A;  4W5B A;  1CQD A;  1XKG A;  5EF4 A;  1AYW A;  5CVM A;  2Y5B A;  4BSQ A;  3BOW A;  1BP4 A;  4N4Z A;  1ICF A;  3CBJ A;  4I05 A;  2HHN A;  2F1G A;  4DMY A;  2NQG A;  1JQP A;  4BS6 A;  2YJ8 A;  3BPF A;  1PPD A;  1AEC A;  4KLB A;  3LFY A;  4BQV A;  3H7D A;  3V6C A;  1GLO A;  2YJC A;  3NHE A;  4W4U A;  2YJ2 A;  5JH3 A;  1Y4H A;  2B1M A;  4N8W A;  1HUC B;  1POP A;  2NQI A;  1NB3 A;  4WA6 A;  2DC9 A;  3P5V A;  2XU3 A;  1Q6K A;  3QSD A;  4PP2 E;  2G7Y A;  3IHP A;  5CHT A;  1QDQ A;  5K16 A;  5CHV A;  3AI8 A;  1AU0 A;  2PBH A;  2F7D A;  3O1G A;  3HHA A;  4FJC A;  3USV A;  4QBB A;  1CS8 A;  2GFO A;  3OIS A;  1ME4 A;  1U9W A;  1MHW A;  1NL6 A;  2YJB A;  1QXP A;  2DCD A;  2P7U A;  2FO5 A;  1SNK A;  2AU1 A;  3CH3 X;  1FH0 A;  2FT2 A;  4QRV A;  2FYE A;  1ZCM A;  4CDF B;  3S3R A;  3CBK A;  2PAD A;  3ZUA A;  4AXM A;  3CH2 X;  3PW3 A;  1U5I A;  2DCC A;  2R9F A;  4CDC B;  3P5U A;  3KWZ A;  2DC6 A;  3P5X A;  2E03 A;  2JQG R;  1PPP A;  4QRG A;  3MTN A;  4FIP A;  2Y6E A;  4MSX A;  1ATK A;  4G54 A;  3D6S A;  4P6E A;  3N4C A;  4XR7 A;  1DF0 A;  1CB5 A;  3E1Z B;  1A6R A;  3QJ3 A;  2DZY A;  2AUZ A;  3C9E A;  3K9M A;  1PE6 A;  3N3G A;  1U9V A;  3U8E A;  1YVB A;  2AS8 A;  1MIR A;  1M6D A;  3HD3 A;  3F5V A;  2DCB A;  2G8E A;  4DMX A;  2PNS A;  2VHF A;  4MZS A;  3F75 A;  1AU3 A;  5CVN B;  4YVA A;  1U9X A;  3RVV A;  3PDF A;  3ERV A;  3KSE A;  1EWM A;  3RVX A;  1CVZ A;  2NQD B;  3KW9 A;  4PI3 A;  4QRX A;  3MOR A;  3K24 A;  2YJ9 A;  3H89 A;  2DC8 A;  6PAD A;  2R9N A;  7PCK A;  1NLJ A;  1NB5 A;  4Q8H A;  3BC3 A;  1NQC A;  1NPZ A;  3H6S A;  2ACT A;  3OF9 A;  1GCB A;  1THE A;  3PBH A;  1KHP A;  3WXE A;  1O0E A;  4YV8 A;  4RY2 A;  1PPN A;  1CTE A;  4OEM A;  4CDE B;  1PXV A;  1F2B A;  2H7J A;  1BQI A;  1ME3 A;  4PAD A;  3IUT A;  1TU6 A;  2BDZ A;  2PRE A;  1X9Y A;  2OP3 A;  1AYU A;  3BPM A;  3GCB A;  4XUI A;  2R9O A;  4HWY A;  4FK5 A;  1PIP A;  1AU4 A;  3KX1 A;  2DCA A;  1QOL A;  5F02 A;  3WXG A;  1EWO A;  1Y08 A;  2FTD A;  2AVW A;  2CB5 A;  3BCN A;  1VJV A;  1CSB B;  1STF E;  4X6J A;  2HXZ A;  3I06 A;  4PP1 A;  1F29 A;  3BWK A;  3QT4 A;  4MZO A;  2IBI A;  1U9Q X;  1YT7 A;  5FPW A;  1F2A A;  1AYV A;  2BDL A;  4I07 A;  4ZUX U;  3OF8 A;  2C0Y A;  1TLO A;  2JQF R;  4CDD B;  1GEC E;  4YYS A;  1KHQ A;  4Q8G A;  4N79 A;  3IV2 A;  2FUD A;  1GMY A;  1K3B B;  3H8C A;  5EGW A;  2OZ2 A;  4YYU A;  4P6G A;  3WXF A;  4YYV A;  1AU2 A;  1PPO A;  2E02 A;  3O0U A;  3RVW A;  2HD5 A;  2XU5 A;  3HHI A;  3P5W A;  1ZIV A;  1BGO A;  3TNX A;  4BPV A;  1YAL A;  2E00 A;  2DZZ A;  2XU4 A;  2OUL A;  2AIM A;  2P86 A;  2AYN A;  2CIO A;  1EF7 A;  3MHH A;  5J94 A;  4YYQ A;  1TL9 A;  5PAD A;  1CJL A; 
#chains in the Genus database with same CATH topology
 3ZNH A;  5JA7 A;  4BS5 A;  4OVZ B;  3S3Q A;  2XU1 A;  1MEM A;  1YK7 A;  3N3K A;  4IUM A;  3OVX A;  4CZW A;  3K8U A;  3PNR A;  2G6D A;  2FRA A;  1KXR A;  4BOP A;  3KKU A;  1QMY A;  2AYO A;  5CVO B;  1YK8 A;  4XZX A;  2GHU A;  3PHX A;  3B21 A;  1EWL A;  4QH6 A;  3IFU A;  4RF0 A;  2JTC A;  3OVZ A;  2IPP B;  2DJG B;  3IEJ A;  3LXS A;  4IP3 A;  1DEU A;  2WBF X;  3H8B A;  1BY8 A;  4YYW A;  1PVJ A;  2AUX A;  1CPJ A;  3DF0 A;  4K7C A;  1S4V A;  2R9M A;  1PBH A;  2B1N A;  3KFQ A;  1MS6 A;  4MM3 B;  1MDW A;  2R6N A;  2VHS A;  1EWP A;  4OEL A;  2R9C A;  1KFU L;  1AIM A;  2DOS A;  1PCI A;  4D8E A;  2G8J A;  3V6E A;  1PAD A;  1CV8 A;  2Z84 A;  1SP4 B;  2FQ9 A;  4I04 A;  4X6H A;  2ATO A;  3M99 A;  4W5C A;  3HWN A;  4RNA A;  1ITO A;  2ARY A;  3B79 A;  3KWB X;  8PCH A;  3IOQ A;  3IMA A;  1MEG A;  2E01 A;  2NQA A;  2O6X A;  5A24 A;  1KFX L;  2P0R A;  2DJF B;  1VSN A;  2HH5 A;  4AXL A;  2FRQ A;  3I3T A;  3MHS A;  3PRM A;  3O65 A;  4YYR A;  9PAP A;  2DC7 A;  1F2C A;  1IWD A;  3MP2 A;  4X6I A;  2BTW B;  4W5B A;  1CQD A;  4PT5 A;  1XKG A;  3PHW A;  5EF4 A;  1AYW A;  5CVM A;  4HXD B;  2Y5B A;  4RKX A;  4BSQ A;  3BOW A;  1BP4 A;  4D8I A;  4N4Z A;  3PSE A;  3E9S A;  1ICF A;  3CBJ A;  4I05 A;  2HHN A;  2F1G A;  4DMY A;  2NQG A;  3BY4 A;  1JQP A;  4BS6 A;  2YJ8 A;  3BPF A;  1PPD A;  1AEC A;  4D8B A;  4KLB A;  3LFY A;  4BQV A;  3H7D A;  3V6C A;  1GLO A;  2YJC A;  3NHE A;  4W4U A;  2J7Q A;  2YJ2 A;  5JH3 A;  1Y4H A;  2B1M A;  4N8W A;  1HUC B;  1POP A;  2NQI A;  1NB3 A;  4MI7 A;  4WA6 A;  2DC9 A;  3P5V A;  2XU3 A;  4OVZ A;  1Q6K A;  3QSD A;  4PP2 E;  2G7Y A;  3IHP A;  5CHT A;  1QDQ A;  5K16 A;  5CHV A;  3MJ5 A;  3AI8 A;  1AU0 A;  2PBH A;  2F7D A;  3O1G A;  3HHA A;  4FJC A;  3USV A;  4QBB A;  1CS8 A;  2GFO A;  3OIS A;  1ME4 A;  1U9W A;  1MHW A;  1NL6 A;  2YJB A;  1QXP A;  2DCD A;  2P7U A;  5JZE A;  2FO5 A;  3TRK A;  1SNK A;  2AU1 A;  3CH3 X;  1FH0 A;  2FT2 A;  4A5U A;  2JRI A;  4QRV A;  2FYE A;  1ZCM A;  4CDF B;  3S3R A;  3CBK A;  2PAD A;  3ZUA A;  4AXM A;  3CH2 X;  3PW3 A;  1U5I A;  3PHU A;  2DCC A;  2R9F A;  4CDC B;  3P5U A;  3KWZ A;  4P16 A;  2DC6 A;  3P5X A;  2E03 A;  2JQG R;  1PPP A;  2BU3 A;  4QRG A;  3MTN A;  4FIP A;  2Y6E A;  4MSX A;  1ATK A;  4G54 A;  3D6S A;  4P6E A;  3N4C A;  4XR7 A;  1DF0 A;  1CB5 A;  5EZQ A;  3E1Z B;  1A6R A;  3QJ3 A;  5KO3 A;  2DZY A;  2AUZ A;  3C9E A;  3K9M A;  1PE6 A;  3N3G A;  1U9V A;  3U8E A;  1YVB A;  4GUA A;  2AS8 A;  2UZJ A;  1MIR A;  1M6D A;  3HD3 A;  3F5V A;  2DCB A;  2G8E A;  3BB7 A;  4OW0 A;  4DMX A;  2PNS A;  2VHF A;  4MZS A;  3F75 A;  1AU3 A;  5CVN B;  4YVA A;  1U9X A;  3PRP A;  3RVV A;  3PDF A;  3RNV A;  3ERV A;  3KSE A;  1EWM A;  3RVX A;  1CVZ A;  2NQD B;  3KW9 A;  4PI3 A;  4QRX A;  3MOR A;  3K24 A;  2YJ9 A;  4RF1 A;  3C0R A;  3H89 A;  2DC8 A;  6PAD A;  2R9N A;  4ZTB A;  7PCK A;  1NLJ A;  3TMP A;  4Q8H A;  1NB5 A;  4M0W A;  3BC3 A;  1NQC A;  1NPZ A;  3H6S A;  2ACT A;  3OF9 A;  4BOS A;  1GCB A;  1THE A;  3PBH A;  2AGA A;  1KHP A;  3WXE A;  1O0E A;  4YV8 A;  4RY2 A;  1PPN A;  1CTE A;  4OEM A;  4CDE B;  1PXV A;  1F2B A;  2H7J A;  5EZS A;  1BQI A;  1ME3 A;  4PAD A;  3IUT A;  1TU6 A;  2BDZ A;  2PRE A;  1X9Y A;  2OP3 A;  3W30 A;  2HWK A;  1AYU A;  3BPM A;  4R3D A;  3GCB A;  4XUI A;  2BTW A;  2R9O A;  4HWY A;  4FK5 A;  1PIP A;  1AU4 A;  3KX1 A;  2DCA A;  4BOU A;  1QOL A;  5F02 A;  3WXG A;  1EWO A;  1Y08 A;  2FTD A;  2AVW A;  2CB5 A;  3BCN A;  1VJV A;  1CSB B;  1STF E;  4X6J A;  1YZB A;  2HXZ A;  3I06 A;  4PP1 A;  1F29 A;  3BWK A;  3QT4 A;  4MZO A;  2IBI A;  1U9Q X;  1YT7 A;  2FE8 A;  5FPW A;  3PT2 A;  1F2A A;  1AYV A;  2BDL A;  1DKI A;  4I07 A;  3BBA A;  4ZUX U;  3OF8 A;  4REZ A;  2C0Y A;  1TLO A;  2JQF R;  4CDD B;  1GEC E;  4YYS A;  4WUR A;  1KHQ A;  4N79 A;  4Q8G A;  3IV2 A;  2FUD A;  1GMY A;  1K3B B;  3H8C A;  3MTV A;  5EGW A;  1UKF A;  2OZ2 A;  4YYU A;  4P6G A;  4BOQ A;  3WXF A;  4YYV A;  1AU2 A;  1PPO A;  2E02 A;  3OQC A;  3W31 A;  3O0U A;  3RVW A;  2HD5 A;  2XU5 A;  3HHI A;  3P5W A;  2J7Q C;  1ZIV A;  1BGO A;  3TNX A;  4BPV A;  1YAL A;  5E6J A;  2E00 A;  2DZZ A;  2XU4 A;  2OUL A;  2AIM A;  2P86 A;  4BOZ A;  2AYN A;  2CIO A;  1EF7 A;  3MHH A;  5J94 A;  4YYQ A;  1TL9 A;  5PAD A;  1CJL A; 
#chains in the Genus database with same CATH homology
 5JA7 A;  4BS5 A;  3S3Q A;  2XU1 A;  1MEM A;  1YK7 A;  3N3K A;  3OVX A;  4CZW A;  3K8U A;  3PNR A;  2G6D A;  2FRA A;  1KXR A;  3KKU A;  1QMY A;  2AYO A;  5CVO B;  1YK8 A;  2GHU A;  1EWL A;  4QH6 A;  3OVZ A;  2IPP B;  2DJG B;  3IEJ A;  1W6F A;  3LXS A;  1DEU A;  2WBF X;  3H8B A;  1BY8 A;  4YYW A;  2AUX A;  3DF0 A;  1CPJ A;  4K7C A;  1S4V A;  2R9M A;  1PBH A;  2B1N A;  3KFQ A;  1MS6 A;  1MDW A;  2R6N A;  2VHS A;  1EWP A;  4OEL A;  2R9C A;  1KFU L;  1AIM A;  1PCI A;  2G8J A;  3V6E A;  1PAD A;  1CV8 A;  1SP4 B;  2FQ9 A;  4I04 A;  4X6H A;  2ATO A;  3M99 A;  4W5C A;  3HWN A;  1ITO A;  2ARY A;  3B79 A;  3KWB X;  8PCH A;  4C5P A;  3IOQ A;  3IMA A;  1MEG A;  2E01 A;  2NQA A;  2O6X A;  5A24 A;  1KFX L;  2P0R A;  2DJF B;  1VSN A;  2HH5 A;  4AXL A;  2FRQ A;  4BGF A;  3I3T A;  3MHS A;  4YYR A;  9PAP A;  2DC7 A;  4B55 A;  1F2C A;  1IWD A;  4X6I A;  4W5B A;  1CQD A;  1XKG A;  5EF4 A;  1AYW A;  5CVM A;  2Y5B A;  4BSQ A;  3BOW A;  1BP4 A;  4N4Z A;  1ICF A;  3CBJ A;  4I05 A;  2HHN A;  2F1G A;  4DMY A;  2NQG A;  1JQP A;  4BS6 A;  2YJ8 A;  3BPF A;  1PPD A;  1AEC A;  4KLB A;  3LFY A;  4BQV A;  3H7D A;  3V6C A;  1GLO A;  2YJC A;  3NHE A;  4W4U A;  4GUZ A;  2YJ2 A;  5JH3 A;  1Y4H A;  2B1M A;  4N8W A;  1HUC B;  1POP A;  2NQI A;  1NB3 A;  4NV7 A;  4WA6 A;  2DC9 A;  1W5R A;  3P5V A;  2XU3 A;  1Q6K A;  3QSD A;  4PP2 E;  2G7Y A;  3IHP A;  5CHT A;  1QDQ A;  5K16 A;  5CHV A;  3AI8 A;  1AU0 A;  2PBH A;  2F7D A;  3O1G A;  3HHA A;  4FJC A;  3USV A;  4QBB A;  1CS8 A;  2GFO A;  3OIS A;  1ME4 A;  1U9W A;  1MHW A;  1NL6 A;  2YJB A;  1QXP A;  2DCD A;  2P7U A;  2FO5 A;  1W4T A;  1SNK A;  2AU1 A;  3CH3 X;  1FH0 A;  2FT2 A;  3D9W A;  4QRV A;  2FYE A;  1ZCM A;  4CDF B;  3S3R A;  3CBK A;  2PAD A;  3ZUA A;  4AXM A;  3CH2 X;  3PW3 A;  1U5I A;  2DCC A;  2R9F A;  4CDC B;  3P5U A;  3KWZ A;  2DC6 A;  3P5X A;  2E03 A;  2JQG R;  1PPP A;  4QRG A;  3MTN A;  4FIP A;  2Y6E A;  4MSX A;  1ATK A;  4G54 A;  3D6S A;  4P6E A;  3N4C A;  4XR7 A;  1DF0 A;  1CB5 A;  3E1Z B;  1A6R A;  3QJ3 A;  2BSZ A;  2DZY A;  2AUZ A;  3C9E A;  3K9M A;  1PE6 A;  3N3G A;  1U9V A;  3U8E A;  1YVB A;  2AS8 A;  1MIR A;  1M6D A;  3HD3 A;  3F5V A;  2DCB A;  2G8E A;  4DMX A;  2PNS A;  3LTW A;  2VHF A;  4MZS A;  3F75 A;  1AU3 A;  5CVN B;  4YVA A;  1U9X A;  3RVV A;  3PDF A;  3ERV A;  3KSE A;  1EWM A;  3RVX A;  1CVZ A;  2NQD B;  3KW9 A;  4PI3 A;  4QRX A;  3MOR A;  3K24 A;  2YJ9 A;  3H89 A;  2DC8 A;  6PAD A;  2VFC A;  2R9N A;  7PCK A;  1NLJ A;  1NB5 A;  4Q8H A;  3BC3 A;  1NQC A;  1NPZ A;  3H6S A;  2ACT A;  3OF9 A;  4NV8 A;  1GCB A;  1THE A;  3PBH A;  1KHP A;  3WXE A;  1O0E A;  4YV8 A;  4RY2 A;  1PPN A;  1CTE A;  4OEM A;  4CDE B;  1PXV A;  1F2B A;  2H7J A;  1BQI A;  1ME3 A;  4PAD A;  3IUT A;  1TU6 A;  2BDZ A;  2PRE A;  1X9Y A;  2OP3 A;  1AYU A;  3BPM A;  3GCB A;  4XUI A;  2R9O A;  4HWY A;  4FK5 A;  1PIP A;  1AU4 A;  3KX1 A;  2DCA A;  1QOL A;  5F02 A;  3WXG A;  1EWO A;  1Y08 A;  2FTD A;  2AVW A;  2CB5 A;  3BCN A;  1VJV A;  1CSB B;  1STF E;  4X6J A;  2HXZ A;  3I06 A;  4PP1 A;  1F29 A;  3BWK A;  3QT4 A;  4MZO A;  2IBI A;  1U9Q X;  1YT7 A;  5FPW A;  1F2A A;  1AYV A;  2BDL A;  4I07 A;  4ZUX U;  3OF8 A;  2C0Y A;  1GX3 A;  1TLO A;  2JQF R;  4CDD B;  1GEC E;  4YYS A;  1KHQ A;  4Q8G A;  4N79 A;  3IV2 A;  2FUD A;  1GMY A;  1K3B B;  3H8C A;  5EGW A;  2OZ2 A;  4YYU A;  4P6G A;  3WXF A;  4YYV A;  1AU2 A;  1PPO A;  2E02 A;  3O0U A;  3RVW A;  2HD5 A;  2XU5 A;  3HHI A;  3P5W A;  1ZIV A;  1BGO A;  3TNX A;  4BPV A;  1YAL A;  2E00 A;  2VFB A;  2DZZ A;  2XU4 A;  2OUL A;  2AIM A;  2P86 A;  1E2T A;  2AYN A;  2CIO A;  1EF7 A;  3MHH A;  5J94 A;  4YYQ A;  1TL9 A;  5PAD A;  1CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...