3PNRA

Structure of pbicp-c in complex with falcipain-2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
MNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSAWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Falcipain 2
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 65
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pnrA00
2BDLA 1HUCB 1AYWA 2YJ2A 2DC6A 2NQDB 2HHNA 3O0UA 4G54A 3B79A 1U9VA 1F2BA 2DCAA 1KHQA 4N4ZA 1EWLA 3BWKA 1CS8A 1XKGA 4KLBA 4PP2E 1F2CA 4YYVA 3M99A 2JQFR 4X6IA 3IEJA 1CSBB 1CVZA 3U8EA 5CVNB 4RY2A 3RVXA 1PPPA 1NB5A 4AXMA 1EWOA 2Y6EA 3S3QA 7PCKA 1AYUA 1YALA 1AECA 1MEMA 4DMXA 3WXGA 1MDWA 1ZIVA 4FJCA 4FK5A 4YYSA 4Q8GA 3HD3A 1K3BB 3P5VA 2BDZA 1CTEA 3AI8A 1ME3A 3P5XA 1ICFA 1FH0A 1POPA 1O0EA 3ERVA 2R9OA 4I04A 4I07A 2AIMA 3DF0A 4HWYA 1U9WA 5J94A 1MEGA 1VSNA 1PE6A 3H8BA 3KW9A 1MS6A 1GECE 2WBFX 2DC7A 1GMYA 1GLOA 3IOQA 1PPOA 4QBBA 1KFXL 4BS6A 1AU2A 1X9YA 4X6HA 3P5WA 1U9XA 1PADA 3H6SA 1PPNA 4YV8A 1QXPA 4YYWA 1JQPA 9PAPA 4PP1A 2OULA 4Q8HA 3K9MA 1NLJA 3PNRA 3KWBX 2E03A 4W5CA 2P7UA 4CDCB 4WA6A 3V6EA 1EWPA 2AVWA 4X6JA 5CVMA 2R9FA 2F7DA 1M6DA 3F75A 3PW3A 3IV2A 1S4VA 1Y08A 1NL6A 3IMAA 3WXEA 1SP4B 4YYUA 6PADA 2DCCA 2FTDA 1NPZA 3K8UA 5EGWA 1DEUA 3N4CA 2NQGA 2E01A 3N3GA 2ACTA 3QT4A 2DC8A 3F5VA 4QRGA 2R9CA 4BQVA 4DMYA 3BPMA 3RVWA 2NQIA 1CB5A 4YVAA 3N3KA 3KSEA 5CHVA 4AXLA 1QMYA 1ZCMA 1AU4A 3CH3X 3HHIA 4ZUXU 1STFE 3KKUA 2FT2A 4BS5A 3D6SA 3H89A 3OVZA 4XR7A 2AYNA 2DCDA 3QJ3A 2R9NA 4CDEB 1TU6A 5A24A 5PADA 5JA7A 2G8JA 5CVOB 2AU1A 2AYOA 2FUDA 2XU5A 2PBHA 3H7DA 4BSQA 2DCBA 5CHTA 2E00A 1PXVA 3PBHA 2CB5A 1U5IA 4I05A 1A6RA 3QSDA 3OISA 2GHUA 1F2AA 1QDQA 4FIPA 2AUZA 2FQ9A 1Q6KA 3KX1A 2R6NA 1F29A 1BQIA 1KHPA 1MIRA 2DJGB 3CBKA 4N79A 2CIOA 1NQCA 3BC3A 5F02A 2R9MA 5JH3A 2ATOA 2AUXA 3P5UA 2DC9A 3LFYA 2HD5A 4YYRA 2PNSA 3CH2X 3IUTA 4OEMA 2IBIA 5K16A 2YJ8A 1Y4HA 2H7JA 2G6DA 2HH5A 2O6XA 4N8WA 2OP3A 2OZ2A 4BPVA 2B1NA 3USVA 3K24A 3WXFA 3LXSA 1TLOA 3HHAA 4PADA 1AIMA 3BPFA 2AS8A 1U9QX 2VHFA 1NB3A 2C0YA 3KWZA 1YK7A 1EF7A 3HWNA 1AYVA 2VHSA 3MORA 1YVBA 2E02A 2DJFB 2YJ9A 4W5BA 1YK8A 1PBHA 3IHPA 3H8CA 1GCBA 2IPPB 4YYQA 2HXZA 2PADA 4W4UA 1KXRA 4MZSA 3V6CA 2Y5BA 2FYEA 3CBJA 3E1ZB 1CQDA 4CZWA 1CJLA 5FPWA 2FRQA 3NHEA 3ZUAA 3OF9A 4XUIA 4CDFB 3O1GA 2B1MA 4QRVA 1AU3A 2GFOA 3TNXA 2YJBA 4OELA 3C9EA 1ATKA 2F1GA 2DZZA 3BCNA 3I06A 1ITOA 2FRAA 2FO5A 1PCIA 3PDFA 2PREA 4P6EA 3GCBA 4CDDB 2XU4A 1SNKA 1VJVA 1CPJA 4K7CA 4QH6A 2YJCA 4MZOA 4PI3A 2NQAA 4MSXA 1DF0A 2DZYA 2G7YA 1MHWA 5EF4A 3S3RA 2XU1A 4P6GA 2P0RA 3KFQA 3MHHA 2ARYA 1THEA 3OVXA 1BGOA 1ME4A 1AU0A 2JQGR 1YT7A 8PCHA 2G8EA 1IWDA 1PPDA 2P86A 3I3TA 1TL9A 1PIPA 3OF8A 1KFUL 4QRXA 1QOLA 1CV8A 3RVVA 3MHSA 1BP4A 2XU3A 1BY8A 3MTNA 1EWMA 3BOWA
chains in the Genus database with same CATH superfamily
2BDLA 1HUCB 1AYWA 2YJ2A 2DC6A 2NQDB 2HHNA 3O0UA 4G54A 3BB7A 3B79A 1U9VA 1F2BA 2DCAA 1KHQA 3PRPA 4N4ZA 1EWLA 4OW0A 3BWKA 4MI7A 3TMPA 1CS8A 1XKGA 4KLBA 4PP2E 1F2CA 4YYVA 3M99A 2JQFR 4X6IA 3IEJA 1CSBB 4D8IA 1CVZA 3U8EA 5CVNB 4RY2A 3RVXA 1PPPA 1NB5A 4AXMA 1EWOA 2Y6EA 3S3QA 3MP2A 7PCKA 1AYUA 1YALA 1AECA 1MEMA 4DMXA 3WXGA 1MDWA 1ZIVA 4FJCA 4FK5A 4YYSA 4XZXA 5EZSA 4Q8GA 3HD3A 1K3BB 3P5VA 3RNVA 2BDZA 1CTEA 1YZBA 3AI8A 1ME3A 3P5XA 1ICFA 2JRIA 1FH0A 1POPA 1O0EA 3ERVA 2R9OA 3ZNHA 4I04A 4I07A 2AIMA 3DF0A 4HWYA 1U9WA 3PHWA 1MEGA 1VSNA 5J94A 1PE6A 2JTCA 3PHXA 3H8BA 3KW9A 1MS6A 1GECE 2WBFX 2DC7A 1GMYA 1GLOA 3IOQA 1PPOA 4QBBA 1KFXL 4RNAA 4R3DA 4BS6A 1PVJA 1AU2A 1X9YA 4P16A 4X6HA 4HXDB 3P5WA 1U9XA 1PADA 3H6SA 1PPNA 4YV8A 1QXPA 4YYWA 1JQPA 9PAPA 4PP1A 2OULA 4Q8HA 3K9MA 1NLJA 3PNRA 3KWBX 2E03A 4W5CA 3PT2A 2P7UA 4CDCB 4WA6A 3V6EA 1EWPA 2AVWA 4X6JA 5CVMA 2R9FA 2F7DA 2BTWB 4BOPA 4RF1A 1M6DA 3F75A 3PW3A 3PHUA 3IV2A 1S4VA 1Y08A 1NL6A 3IMAA 3WXEA 1SP4B 4YYUA 6PADA 1UKFA 2DCCA 2FTDA 1NPZA 3K8UA 5EGWA 1DEUA 3N4CA 2NQGA 2BTWA 2E01A 3N3GA 2ACTA 3QT4A 2DC8A 3F5VA 4QRGA 2R9CA 3O65A 4BQVA 4DMYA 3BPMA 2J7QA 3OQCA 3RVWA 4BOSA 2NQIA 1CB5A 3IFUA 4YVAA 2J7QC 3N3KA 3KSEA 5CHVA 4AXLA 1QMYA 1ZCMA 1AU4A 3CH3X 3HHIA 4PT5A 4ZUXU 1STFE 3KKUA 2FT2A 4BS5A 3D6SA 3H89A 3OVZA 4REZA 4XR7A 2AYNA 2DCDA 3QJ3A 2R9NA 4CDEB 1TU6A 5A24A 5PADA 5JA7A 2G8JA 5CVOB 2AU1A 2AYOA 2BU3A 2FUDA 2XU5A 5KO3A 4WURA 2PBHA 3H7DA 4RKXA 3TRKA 4BSQA 2DCBA 2Z84A 5CHTA 2E00A 1PXVA 3BBAA 3PBHA 4OVZB 4M0WA 2CB5A 1U5IA 4I05A 1A6RA 5E6JA 4BOUA 3QSDA 3OISA 5EZQA 4GUAA 2GHUA 1F2AA 1QDQA 2AGAA 4FIPA 2AUZA 2FQ9A 1Q6KA 3KX1A 2R6NA 1F29A 1BQIA 1KHPA 1MIRA 2UZJA 2DJGB 3CBKA 4N79A 4OVZA 2CIOA 1NQCA 3BC3A 5F02A 3B21A 2R9MA 5JH3A 1DKIA 2ATOA 2AUXA 3P5UA 2DC9A 3LFYA 4MM3B 2HD5A 3C0RA 4YYRA 2PNSA 3CH2X 3IUTA 4OEMA 2IBIA 5K16A 2YJ8A 1Y4HA 2H7JA 2G6DA 2HH5A 3PRMA 2O6XA 4N8WA 2OP3A 2OZ2A 4BPVA 2B1NA 3MJ5A 3K24A 3USVA 3WXFA 3LXSA 1TLOA 3HHAA 4RF0A 4PADA 1AIMA 4BOZA 3BPFA 2DOSA 2AS8A 1U9QX 2VHFA 1NB3A 2C0YA 3KWZA 1YK7A 1EF7A 3HWNA 1AYVA 2VHSA 3MORA 1YVBA 2E02A 2DJFB 3PSEA 2YJ9A 4W5BA 1YK8A 1PBHA 3IHPA 3H8CA 2HWKA 1GCBA 2IPPB 4YYQA 2HXZA 2PADA 4W4UA 1KXRA 4MZSA 3V6CA 2Y5BA 2FYEA 3CBJA 3E1ZB 1CQDA 4CZWA 1CJLA 4IUMA 2FRQA 3NHEA 4ZTBA 5FPWA 3ZUAA 4IP3A 3OF9A 4XUIA 4CDFB 4D8BA 3O1GA 2B1MA 4QRVA 1AU3A 2GFOA 3TNXA 2YJBA 3W31A 4OELA 3C9EA 1ATKA 2F1GA 4D8EA 2DZZA 3BCNA 3I06A 1ITOA 2FRAA 2FO5A 1PCIA 3PDFA 2PREA 4P6EA 3GCBA 4CDDB 2XU4A 1SNKA 1VJVA 1CPJA 4K7CA 4QH6A 3W30A 2YJCA 4MZOA 4PI3A 2NQAA 4MSXA 1DF0A 2DZYA 4A5UA 2G7YA 1MHWA 5EF4A 3S3RA 2XU1A 4P6GA 2P0RA 3KFQA 3MHHA 3BY4A 2ARYA 1THEA 3OVXA 3E9SA 1BGOA 1ME4A 1AU0A 2JQGR 1YT7A 8PCHA 5JZEA 2G8EA 1IWDA 1PPDA 2P86A 3I3TA 1TL9A 1PIPA 3OF8A 1KFUL 4QRXA 1QOLA 1CV8A 3RVVA 3MTVA 3MHSA 2FE8A 1BP4A 2XU3A 1BY8A 3MTNA 1EWMA 3BOWA 4BOQA
chains in the Genus database with same CATH topology
2BDLA 1HUCB 1AYWA 2YJ2A 2DC6A 2NQDB 2HHNA 3O0UA 4G54A 3B79A 1U9VA 1F2BA 2DCAA 1KHQA 4N4ZA 1EWLA 1E2TA 3BWKA 1CS8A 1XKGA 4KLBA 4PP2E 1F2CA 4YYVA 3M99A 2JQFR 4X6IA 3IEJA 1CSBB 1CVZA 3U8EA 5CVNB 4RY2A 3RVXA 1PPPA 1NB5A 4AXMA 1EWOA 2Y6EA 3S3QA 1W6FA 7PCKA 1AYUA 1YALA 1AECA 1MEMA 4DMXA 3WXGA 1MDWA 1ZIVA 4FJCA 4FK5A 4YYSA 4Q8GA 3HD3A 1K3BB 3P5VA 2BDZA 1CTEA 3AI8A 1ME3A 3P5XA 1ICFA 1FH0A 1POPA 1O0EA 3ERVA 2R9OA 4NV7A 4I04A 4I07A 2AIMA 3DF0A 4HWYA 1U9WA 5J94A 1MEGA 1VSNA 1PE6A 3H8BA 3KW9A 1MS6A 1GECE 2WBFX 2DC7A 4BGFA 1GMYA 1GLOA 3IOQA 1PPOA 4QBBA 1KFXL 4BS6A 1AU2A 1X9YA 4X6HA 3P5WA 1U9XA 1PADA 3H6SA 1PPNA 4YV8A 1QXPA 4YYWA 1JQPA 9PAPA 2BSZA 4PP1A 2OULA 4Q8HA 3K9MA 1NLJA 3PNRA 3KWBX 2E03A 4W5CA 2P7UA 4CDCB 4WA6A 3V6EA 1EWPA 2AVWA 4X6JA 5CVMA 2R9FA 2F7DA 1M6DA 3F75A 3PW3A 3IV2A 1S4VA 1Y08A 1NL6A 3IMAA 3WXEA 1SP4B 4YYUA 6PADA 2DCCA 2FTDA 1NPZA 3K8UA 5EGWA 1DEUA 1W4TA 3N4CA 2NQGA 2E01A 3N3GA 2ACTA 3QT4A 2DC8A 3F5VA 4QRGA 2R9CA 4BQVA 4DMYA 3BPMA 3RVWA 2NQIA 1CB5A 4YVAA 3N3KA 3KSEA 5CHVA 4AXLA 1QMYA 1ZCMA 1AU4A 3CH3X 3HHIA 4ZUXU 1STFE 3KKUA 2FT2A 4BS5A 3D6SA 3H89A 3OVZA 4XR7A 2AYNA 2DCDA 3QJ3A 2R9NA 4CDEB 1TU6A 5A24A 5PADA 5JA7A 2G8JA 5CVOB 2AU1A 2AYOA 2FUDA 2XU5A 2PBHA 3H7DA 4BSQA 2DCBA 5CHTA 2E00A 1PXVA 3PBHA 2CB5A 1U5IA 4I05A 1A6RA 4NV8A 3QSDA 3OISA 2GHUA 1F2AA 1QDQA 4FIPA 2AUZA 2FQ9A 1Q6KA 3KX1A 2R6NA 1F29A 1BQIA 1KHPA 1MIRA 2DJGB 3CBKA 4N79A 2CIOA 1NQCA 3BC3A 5F02A 2R9MA 5JH3A 2ATOA 2AUXA 3P5UA 2DC9A 3LFYA 2HD5A 4YYRA 2PNSA 3CH2X 3IUTA 4OEMA 2IBIA 5K16A 2YJ8A 1Y4HA 2H7JA 2G6DA 2HH5A 2O6XA 4N8WA 2OP3A 2OZ2A 4BPVA 2B1NA 3USVA 3K24A 3WXFA 3LXSA 1TLOA 3HHAA 4PADA 1AIMA 3BPFA 2AS8A 1U9QX 2VHFA 1NB3A 2C0YA 3KWZA 1YK7A 4C5PA 1EF7A 3HWNA 1AYVA 2VHSA 3MORA 1YVBA 2E02A 2DJFB 2YJ9A 2VFCA 4W5BA 1YK8A 1PBHA 3IHPA 1GX3A 3H8CA 1W5RA 1GCBA 2IPPB 4YYQA 2HXZA 2PADA 4W4UA 1KXRA 4MZSA 3V6CA 2Y5BA 2FYEA 3CBJA 3E1ZB 4B55A 1CQDA 4CZWA 1CJLA 5FPWA 2FRQA 3NHEA 3ZUAA 3OF9A 4XUIA 4CDFB 3O1GA 2B1MA 2VFBA 4QRVA 1AU3A 2GFOA 3TNXA 2YJBA 4OELA 3C9EA 1ATKA 2F1GA 2DZZA 3BCNA 3I06A 1ITOA 2FRAA 2FO5A 1PCIA 3PDFA 2PREA 4P6EA 3GCBA 3LTWA 4CDDB 2XU4A 1SNKA 1VJVA 1CPJA 4GUZA 4K7CA 4QH6A 2YJCA 4MZOA 4PI3A 2NQAA 4MSXA 1DF0A 2DZYA 2G7YA 1MHWA 5EF4A 3S3RA 2XU1A 4P6GA 2P0RA 3KFQA 3MHHA 2ARYA 1THEA 3OVXA 1BGOA 1ME4A 3D9WA 1AU0A 2JQGR 1YT7A 8PCHA 2G8EA 1IWDA 1PPDA 2P86A 3I3TA 1TL9A 1PIPA 3OF8A 1KFUL 4QRXA 1QOLA 1CV8A 3RVVA 3MHSA 1BP4A 2XU3A 1BY8A 3MTNA 1EWMA 3BOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDL A;  1HUC B;  1AYW A;  2YJ2 A;  2DC6 A;  2NQD B;  2HHN A;  3O0U A;  4G54 A;  3B79 A;  1U9V A;  1F2B A;  2DCA A;  1KHQ A;  4N4Z A;  1EWL A;  3BWK A;  1CS8 A;  1XKG A;  4KLB A;  4PP2 E;  1F2C A;  4YYV A;  3M99 A;  2JQF R;  4X6I A;  3IEJ A;  1CSB B;  1CVZ A;  3U8E A;  5CVN B;  4RY2 A;  3RVX A;  1PPP A;  1NB5 A;  4AXM A;  1EWO A;  2Y6E A;  3S3Q A;  7PCK A;  1AYU A;  1YAL A;  1AEC A;  1MEM A;  4DMX A;  3WXG A;  1MDW A;  1ZIV A;  4FJC A;  4FK5 A;  4YYS A;  4Q8G A;  3HD3 A;  1K3B B;  3P5V A;  2BDZ A;  1CTE A;  3AI8 A;  1ME3 A;  3P5X A;  1ICF A;  1FH0 A;  1POP A;  1O0E A;  3ERV A;  2R9O A;  4I04 A;  4I07 A;  2AIM A;  3DF0 A;  4HWY A;  1U9W A;  5J94 A;  1MEG A;  1VSN A;  1PE6 A;  3H8B A;  3KW9 A;  1MS6 A;  1GEC E;  2WBF X;  2DC7 A;  1GMY A;  1GLO A;  3IOQ A;  1PPO A;  4QBB A;  1KFX L;  4BS6 A;  1AU2 A;  1X9Y A;  4X6H A;  3P5W A;  1U9X A;  1PAD A;  3H6S A;  1PPN A;  4YV8 A;  1QXP A;  4YYW A;  1JQP A;  9PAP A;  4PP1 A;  2OUL A;  4Q8H A;  3K9M A;  1NLJ A;  3PNR A;  3KWB X;  2E03 A;  4W5C A;  2P7U A;  4CDC B;  4WA6 A;  3V6E A;  1EWP A;  2AVW A;  4X6J A;  5CVM A;  2R9F A;  2F7D A;  1M6D A;  3F75 A;  3PW3 A;  3IV2 A;  1S4V A;  1Y08 A;  1NL6 A;  3IMA A;  3WXE A;  1SP4 B;  4YYU A;  6PAD A;  2DCC A;  2FTD A;  1NPZ A;  3K8U A;  5EGW A;  1DEU A;  3N4C A;  2NQG A;  2E01 A;  3N3G A;  2ACT A;  3QT4 A;  2DC8 A;  3F5V A;  4QRG A;  2R9C A;  4BQV A;  4DMY A;  3BPM A;  3RVW A;  2NQI A;  1CB5 A;  4YVA A;  3N3K A;  3KSE A;  5CHV A;  4AXL A;  1QMY A;  1ZCM A;  1AU4 A;  3CH3 X;  3HHI A;  4ZUX U;  1STF E;  3KKU A;  2FT2 A;  4BS5 A;  3D6S A;  3H89 A;  3OVZ A;  4XR7 A;  2AYN A;  2DCD A;  3QJ3 A;  2R9N A;  4CDE B;  1TU6 A;  5A24 A;  5PAD A;  5JA7 A;  2G8J A;  5CVO B;  2AU1 A;  2AYO A;  2FUD A;  2XU5 A;  2PBH A;  3H7D A;  4BSQ A;  2DCB A;  5CHT A;  2E00 A;  1PXV A;  3PBH A;  2CB5 A;  1U5I A;  4I05 A;  1A6R A;  3QSD A;  3OIS A;  2GHU A;  1F2A A;  1QDQ A;  4FIP A;  2AUZ A;  2FQ9 A;  1Q6K A;  3KX1 A;  2R6N A;  1F29 A;  1BQI A;  1KHP A;  1MIR A;  2DJG B;  3CBK A;  4N79 A;  2CIO A;  1NQC A;  3BC3 A;  5F02 A;  2R9M A;  5JH3 A;  2ATO A;  2AUX A;  3P5U A;  2DC9 A;  3LFY A;  2HD5 A;  4YYR A;  2PNS A;  3CH2 X;  3IUT A;  4OEM A;  2IBI A;  5K16 A;  2YJ8 A;  1Y4H A;  2H7J A;  2G6D A;  2HH5 A;  2O6X A;  4N8W A;  2OP3 A;  2OZ2 A;  4BPV A;  2B1N A;  3USV A;  3K24 A;  3WXF A;  3LXS A;  1TLO A;  3HHA A;  4PAD A;  1AIM A;  3BPF A;  2AS8 A;  1U9Q X;  2VHF A;  1NB3 A;  2C0Y A;  3KWZ A;  1YK7 A;  1EF7 A;  3HWN A;  1AYV A;  2VHS A;  3MOR A;  1YVB A;  2E02 A;  2DJF B;  2YJ9 A;  4W5B A;  1YK8 A;  1PBH A;  3IHP A;  3H8C A;  1GCB A;  2IPP B;  4YYQ A;  2HXZ A;  2PAD A;  4W4U A;  1KXR A;  4MZS A;  3V6C A;  2Y5B A;  2FYE A;  3CBJ A;  3E1Z B;  1CQD A;  4CZW A;  1CJL A;  5FPW A;  2FRQ A;  3NHE A;  3ZUA A;  3OF9 A;  4XUI A;  4CDF B;  3O1G A;  2B1M A;  4QRV A;  1AU3 A;  2GFO A;  3TNX A;  2YJB A;  4OEL A;  3C9E A;  1ATK A;  2F1G A;  2DZZ A;  3BCN A;  3I06 A;  1ITO A;  2FRA A;  2FO5 A;  1PCI A;  3PDF A;  2PRE A;  4P6E A;  3GCB A;  4CDD B;  2XU4 A;  1SNK A;  1VJV A;  1CPJ A;  4K7C A;  4QH6 A;  2YJC A;  4MZO A;  4PI3 A;  2NQA A;  4MSX A;  1DF0 A;  2DZY A;  2G7Y A;  1MHW A;  5EF4 A;  3S3R A;  2XU1 A;  4P6G A;  2P0R A;  3KFQ A;  3MHH A;  2ARY A;  1THE A;  3OVX A;  1BGO A;  1ME4 A;  1AU0 A;  2JQG R;  1YT7 A;  8PCH A;  2G8E A;  1IWD A;  1PPD A;  2P86 A;  3I3T A;  1TL9 A;  1PIP A;  3OF8 A;  1KFU L;  4QRX A;  1QOL A;  1CV8 A;  3RVV A;  3MHS A;  1BP4 A;  2XU3 A;  1BY8 A;  3MTN A;  1EWM A;  3BOW A; 
#chains in the Genus database with same CATH topology
 2BDL A;  1HUC B;  1AYW A;  2YJ2 A;  2DC6 A;  2NQD B;  2HHN A;  3O0U A;  4G54 A;  3BB7 A;  3B79 A;  1U9V A;  1F2B A;  2DCA A;  1KHQ A;  3PRP A;  4N4Z A;  1EWL A;  4OW0 A;  3BWK A;  4MI7 A;  3TMP A;  1CS8 A;  1XKG A;  4KLB A;  4PP2 E;  1F2C A;  4YYV A;  3M99 A;  2JQF R;  4X6I A;  3IEJ A;  1CSB B;  4D8I A;  1CVZ A;  3U8E A;  5CVN B;  4RY2 A;  3RVX A;  1PPP A;  1NB5 A;  4AXM A;  1EWO A;  2Y6E A;  3S3Q A;  3MP2 A;  7PCK A;  1AYU A;  1YAL A;  1AEC A;  1MEM A;  4DMX A;  3WXG A;  1MDW A;  1ZIV A;  4FJC A;  4FK5 A;  4YYS A;  4XZX A;  5EZS A;  4Q8G A;  3HD3 A;  1K3B B;  3P5V A;  3RNV A;  2BDZ A;  1CTE A;  1YZB A;  3AI8 A;  1ME3 A;  3P5X A;  1ICF A;  2JRI A;  1FH0 A;  1POP A;  1O0E A;  3ERV A;  2R9O A;  3ZNH A;  4I04 A;  4I07 A;  2AIM A;  3DF0 A;  4HWY A;  1U9W A;  3PHW A;  1MEG A;  1VSN A;  5J94 A;  1PE6 A;  2JTC A;  3PHX A;  3H8B A;  3KW9 A;  1MS6 A;  1GEC E;  2WBF X;  2DC7 A;  1GMY A;  1GLO A;  3IOQ A;  1PPO A;  4QBB A;  1KFX L;  4RNA A;  4R3D A;  4BS6 A;  1PVJ A;  1AU2 A;  1X9Y A;  4P16 A;  4X6H A;  4HXD B;  3P5W A;  1U9X A;  1PAD A;  3H6S A;  1PPN A;  4YV8 A;  1QXP A;  4YYW A;  1JQP A;  9PAP A;  4PP1 A;  2OUL A;  4Q8H A;  3K9M A;  1NLJ A;  3PNR A;  3KWB X;  2E03 A;  4W5C A;  3PT2 A;  2P7U A;  4CDC B;  4WA6 A;  3V6E A;  1EWP A;  2AVW A;  4X6J A;  5CVM A;  2R9F A;  2F7D A;  2BTW B;  4BOP A;  4RF1 A;  1M6D A;  3F75 A;  3PW3 A;  3PHU A;  3IV2 A;  1S4V A;  1Y08 A;  1NL6 A;  3IMA A;  3WXE A;  1SP4 B;  4YYU A;  6PAD A;  1UKF A;  2DCC A;  2FTD A;  1NPZ A;  3K8U A;  5EGW A;  1DEU A;  3N4C A;  2NQG A;  2BTW A;  2E01 A;  3N3G A;  2ACT A;  3QT4 A;  2DC8 A;  3F5V A;  4QRG A;  2R9C A;  3O65 A;  4BQV A;  4DMY A;  3BPM A;  2J7Q A;  3OQC A;  3RVW A;  4BOS A;  2NQI A;  1CB5 A;  3IFU A;  4YVA A;  2J7Q C;  3N3K A;  3KSE A;  5CHV A;  4AXL A;  1QMY A;  1ZCM A;  1AU4 A;  3CH3 X;  3HHI A;  4PT5 A;  4ZUX U;  1STF E;  3KKU A;  2FT2 A;  4BS5 A;  3D6S A;  3H89 A;  3OVZ A;  4REZ A;  4XR7 A;  2AYN A;  2DCD A;  3QJ3 A;  2R9N A;  4CDE B;  1TU6 A;  5A24 A;  5PAD A;  5JA7 A;  2G8J A;  5CVO B;  2AU1 A;  2AYO A;  2BU3 A;  2FUD A;  2XU5 A;  5KO3 A;  4WUR A;  2PBH A;  3H7D A;  4RKX A;  3TRK A;  4BSQ A;  2DCB A;  2Z84 A;  5CHT A;  2E00 A;  1PXV A;  3BBA A;  3PBH A;  4OVZ B;  4M0W A;  2CB5 A;  1U5I A;  4I05 A;  1A6R A;  5E6J A;  4BOU A;  3QSD A;  3OIS A;  5EZQ A;  4GUA A;  2GHU A;  1F2A A;  1QDQ A;  2AGA A;  4FIP A;  2AUZ A;  2FQ9 A;  1Q6K A;  3KX1 A;  2R6N A;  1F29 A;  1BQI A;  1KHP A;  1MIR A;  2UZJ A;  2DJG B;  3CBK A;  4N79 A;  4OVZ A;  2CIO A;  1NQC A;  3BC3 A;  5F02 A;  3B21 A;  2R9M A;  5JH3 A;  1DKI A;  2ATO A;  2AUX A;  3P5U A;  2DC9 A;  3LFY A;  4MM3 B;  2HD5 A;  3C0R A;  4YYR A;  2PNS A;  3CH2 X;  3IUT A;  4OEM A;  2IBI A;  5K16 A;  2YJ8 A;  1Y4H A;  2H7J A;  2G6D A;  2HH5 A;  3PRM A;  2O6X A;  4N8W A;  2OP3 A;  2OZ2 A;  4BPV A;  2B1N A;  3MJ5 A;  3K24 A;  3USV A;  3WXF A;  3LXS A;  1TLO A;  3HHA A;  4RF0 A;  4PAD A;  1AIM A;  4BOZ A;  3BPF A;  2DOS A;  2AS8 A;  1U9Q X;  2VHF A;  1NB3 A;  2C0Y A;  3KWZ A;  1YK7 A;  1EF7 A;  3HWN A;  1AYV A;  2VHS A;  3MOR A;  1YVB A;  2E02 A;  2DJF B;  3PSE A;  2YJ9 A;  4W5B A;  1YK8 A;  1PBH A;  3IHP A;  3H8C A;  2HWK A;  1GCB A;  2IPP B;  4YYQ A;  2HXZ A;  2PAD A;  4W4U A;  1KXR A;  4MZS A;  3V6C A;  2Y5B A;  2FYE A;  3CBJ A;  3E1Z B;  1CQD A;  4CZW A;  1CJL A;  4IUM A;  2FRQ A;  3NHE A;  4ZTB A;  5FPW A;  3ZUA A;  4IP3 A;  3OF9 A;  4XUI A;  4CDF B;  4D8B A;  3O1G A;  2B1M A;  4QRV A;  1AU3 A;  2GFO A;  3TNX A;  2YJB A;  3W31 A;  4OEL A;  3C9E A;  1ATK A;  2F1G A;  4D8E A;  2DZZ A;  3BCN A;  3I06 A;  1ITO A;  2FRA A;  2FO5 A;  1PCI A;  3PDF A;  2PRE A;  4P6E A;  3GCB A;  4CDD B;  2XU4 A;  1SNK A;  1VJV A;  1CPJ A;  4K7C A;  4QH6 A;  3W30 A;  2YJC A;  4MZO A;  4PI3 A;  2NQA A;  4MSX A;  1DF0 A;  2DZY A;  4A5U A;  2G7Y A;  1MHW A;  5EF4 A;  3S3R A;  2XU1 A;  4P6G A;  2P0R A;  3KFQ A;  3MHH A;  3BY4 A;  2ARY A;  1THE A;  3OVX A;  3E9S A;  1BGO A;  1ME4 A;  1AU0 A;  2JQG R;  1YT7 A;  8PCH A;  5JZE A;  2G8E A;  1IWD A;  1PPD A;  2P86 A;  3I3T A;  1TL9 A;  1PIP A;  3OF8 A;  1KFU L;  4QRX A;  1QOL A;  1CV8 A;  3RVV A;  3MTV A;  3MHS A;  2FE8 A;  1BP4 A;  2XU3 A;  1BY8 A;  3MTN A;  1EWM A;  3BOW A;  4BOQ A; 
#chains in the Genus database with same CATH homology
 2BDL A;  1HUC B;  1AYW A;  2YJ2 A;  2DC6 A;  2NQD B;  2HHN A;  3O0U A;  4G54 A;  3B79 A;  1U9V A;  1F2B A;  2DCA A;  1KHQ A;  4N4Z A;  1EWL A;  1E2T A;  3BWK A;  1CS8 A;  1XKG A;  4KLB A;  4PP2 E;  1F2C A;  4YYV A;  3M99 A;  2JQF R;  4X6I A;  3IEJ A;  1CSB B;  1CVZ A;  3U8E A;  5CVN B;  4RY2 A;  3RVX A;  1PPP A;  1NB5 A;  4AXM A;  1EWO A;  2Y6E A;  3S3Q A;  1W6F A;  7PCK A;  1AYU A;  1YAL A;  1AEC A;  1MEM A;  4DMX A;  3WXG A;  1MDW A;  1ZIV A;  4FJC A;  4FK5 A;  4YYS A;  4Q8G A;  3HD3 A;  1K3B B;  3P5V A;  2BDZ A;  1CTE A;  3AI8 A;  1ME3 A;  3P5X A;  1ICF A;  1FH0 A;  1POP A;  1O0E A;  3ERV A;  2R9O A;  4NV7 A;  4I04 A;  4I07 A;  2AIM A;  3DF0 A;  4HWY A;  1U9W A;  5J94 A;  1MEG A;  1VSN A;  1PE6 A;  3H8B A;  3KW9 A;  1MS6 A;  1GEC E;  2WBF X;  2DC7 A;  4BGF A;  1GMY A;  1GLO A;  3IOQ A;  1PPO A;  4QBB A;  1KFX L;  4BS6 A;  1AU2 A;  1X9Y A;  4X6H A;  3P5W A;  1U9X A;  1PAD A;  3H6S A;  1PPN A;  4YV8 A;  1QXP A;  4YYW A;  1JQP A;  9PAP A;  2BSZ A;  4PP1 A;  2OUL A;  4Q8H A;  3K9M A;  1NLJ A;  3PNR A;  3KWB X;  2E03 A;  4W5C A;  2P7U A;  4CDC B;  4WA6 A;  3V6E A;  1EWP A;  2AVW A;  4X6J A;  5CVM A;  2R9F A;  2F7D A;  1M6D A;  3F75 A;  3PW3 A;  3IV2 A;  1S4V A;  1Y08 A;  1NL6 A;  3IMA A;  3WXE A;  1SP4 B;  4YYU A;  6PAD A;  2DCC A;  2FTD A;  1NPZ A;  3K8U A;  5EGW A;  1DEU A;  1W4T A;  3N4C A;  2NQG A;  2E01 A;  3N3G A;  2ACT A;  3QT4 A;  2DC8 A;  3F5V A;  4QRG A;  2R9C A;  4BQV A;  4DMY A;  3BPM A;  3RVW A;  2NQI A;  1CB5 A;  4YVA A;  3N3K A;  3KSE A;  5CHV A;  4AXL A;  1QMY A;  1ZCM A;  1AU4 A;  3CH3 X;  3HHI A;  4ZUX U;  1STF E;  3KKU A;  2FT2 A;  4BS5 A;  3D6S A;  3H89 A;  3OVZ A;  4XR7 A;  2AYN A;  2DCD A;  3QJ3 A;  2R9N A;  4CDE B;  1TU6 A;  5A24 A;  5PAD A;  5JA7 A;  2G8J A;  5CVO B;  2AU1 A;  2AYO A;  2FUD A;  2XU5 A;  2PBH A;  3H7D A;  4BSQ A;  2DCB A;  5CHT A;  2E00 A;  1PXV A;  3PBH A;  2CB5 A;  1U5I A;  4I05 A;  1A6R A;  4NV8 A;  3QSD A;  3OIS A;  2GHU A;  1F2A A;  1QDQ A;  4FIP A;  2AUZ A;  2FQ9 A;  1Q6K A;  3KX1 A;  2R6N A;  1F29 A;  1BQI A;  1KHP A;  1MIR A;  2DJG B;  3CBK A;  4N79 A;  2CIO A;  1NQC A;  3BC3 A;  5F02 A;  2R9M A;  5JH3 A;  2ATO A;  2AUX A;  3P5U A;  2DC9 A;  3LFY A;  2HD5 A;  4YYR A;  2PNS A;  3CH2 X;  3IUT A;  4OEM A;  2IBI A;  5K16 A;  2YJ8 A;  1Y4H A;  2H7J A;  2G6D A;  2HH5 A;  2O6X A;  4N8W A;  2OP3 A;  2OZ2 A;  4BPV A;  2B1N A;  3USV A;  3K24 A;  3WXF A;  3LXS A;  1TLO A;  3HHA A;  4PAD A;  1AIM A;  3BPF A;  2AS8 A;  1U9Q X;  2VHF A;  1NB3 A;  2C0Y A;  3KWZ A;  1YK7 A;  4C5P A;  1EF7 A;  3HWN A;  1AYV A;  2VHS A;  3MOR A;  1YVB A;  2E02 A;  2DJF B;  2YJ9 A;  2VFC A;  4W5B A;  1YK8 A;  1PBH A;  3IHP A;  1GX3 A;  3H8C A;  1W5R A;  1GCB A;  2IPP B;  4YYQ A;  2HXZ A;  2PAD A;  4W4U A;  1KXR A;  4MZS A;  3V6C A;  2Y5B A;  2FYE A;  3CBJ A;  3E1Z B;  4B55 A;  1CQD A;  4CZW A;  1CJL A;  5FPW A;  2FRQ A;  3NHE A;  3ZUA A;  3OF9 A;  4XUI A;  4CDF B;  3O1G A;  2B1M A;  2VFB A;  4QRV A;  1AU3 A;  2GFO A;  3TNX A;  2YJB A;  4OEL A;  3C9E A;  1ATK A;  2F1G A;  2DZZ A;  3BCN A;  3I06 A;  1ITO A;  2FRA A;  2FO5 A;  1PCI A;  3PDF A;  2PRE A;  4P6E A;  3GCB A;  3LTW A;  4CDD B;  2XU4 A;  1SNK A;  1VJV A;  1CPJ A;  4GUZ A;  4K7C A;  4QH6 A;  2YJC A;  4MZO A;  4PI3 A;  2NQA A;  4MSX A;  1DF0 A;  2DZY A;  2G7Y A;  1MHW A;  5EF4 A;  3S3R A;  2XU1 A;  4P6G A;  2P0R A;  3KFQ A;  3MHH A;  2ARY A;  1THE A;  3OVX A;  1BGO A;  1ME4 A;  3D9W A;  1AU0 A;  2JQG R;  1YT7 A;  8PCH A;  2G8E A;  1IWD A;  1PPD A;  2P86 A;  3I3T A;  1TL9 A;  1PIP A;  3OF8 A;  1KFU L;  4QRX A;  1QOL A;  1CV8 A;  3RVV A;  3MHS A;  1BP4 A;  2XU3 A;  1BY8 A;  3MTN A;  1EWM A;  3BOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...