3PNRA

Structure of pbicp-c in complex with falcipain-2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
MNYEEVIKKYRGEENFDHAAYDWRLHSGVTPVKDQKNCGSAWAFSSIGSVESQYAIRKNKLITLSEQELVDCSFKNYGCNGGLINNAFEDMIELGGICPDGDYPYVSDAPNLCNIDRCTEKYGIKNYLSVPDNKLKEALRFLGPISISVAVSDDFAFYKEGIFDGECGDQLNHAVMLVGFGMKEIVNPLTKKGEKHYYYIIKNSWGQQWGERGFINIETDESGLMRKCGLGTDAFIPLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Falcipain 2
publication title Structural basis for the regulation of cysteine-protease activity by a new class of protease inhibitors in Plasmodium.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 65
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3pnrA00
4PI3A 4YVAA 2AYOA 1CV8A 2FRQA 1TU6A 3KX1A 3OF9A 2F1GA 5J94A 1F29A 3BPFA 2P7UA 3MHHA 2P0RA 3QJ3A 1PPOA 2XU4A 5A24A 5K16A 2NQGA 3F5VA 4BPVA 1Q6KA 4XR7A 4QBBA 3F75A 4KLBA 2ARYA 2AS8A 1EWLA 2OZ2A 2XU1A 3TNXA 1KHPA 2YJCA 5EF4A 2NQIA 1AU2A 1TL9A 2HHNA 4FK5A 2P86A 5CHVA 3PDFA 2ACTA 4X6IA 1CB5A 3D6SA 2E00A 1AYUA 4X6HA 1AU3A 2FRAA 1MS6A 1PXVA 2AU1A 3BPMA 3RVVA 3U8EA 3BC3A 1PCIA 1U5IA 2VHFA 3I3TA 4YYWA 1VJVA 4MZOA 3KFQA 1PPPA 4N79A 1PPNA 1CS8A 3IEJA 2XU5A 3QSDA 2E03A 2DCCA 4CDEB 4G54A 1YVBA 2PADA 4YV8A 1S4VA 3OISA 2YJ2A 1U9WA 2YJ8A 2DZYA 2IBIA 1THEA 4CDCB 3KWZA 1F2BA 1GECE 4PP2E 1SP4B 4P6EA 1XKGA 2DC9A 1ME4A 3NHEA 4QRXA 1A6RA 3IUTA 2AUXA 2FUDA 2XU3A 4QRVA 2PNSA 2FQ9A 5CHTA 4YYRA 2DCBA 1ZCMA 5JA7A 4FJCA 1BY8A 2C0YA 2YJ9A 3OVXA 5CVMA 1YK8A 1PIPA 2B1MA 2DC8A 2GHUA 2Y5BA 1U9VA 3H6SA 1MDWA 1GLOA 1AU4A 1MHWA 3O0UA 3S3QA 3WXFA 2WBFX 1TLOA 3PW3A 1STFE 1BP4A 2BDLA 1AU0A 4YYUA 1EF7A 4AXLA 3OF8A 1QMYA 2DCDA 4PP1A 2IPPB 1POPA 1PPDA 2JQFR 1EWMA 4I05A 3KSEA 2R6NA 1CSBB 2G8EA 4I04A 3WXEA 4P6GA 3AI8A 3PNRA 4RY2A 4BQVA 1HUCB 1U9QX 2FTDA 1AIMA 4DMXA 1BGOA 2HD5A 2OP3A 3P5WA 3E1ZB 1NL6A 4K7CA 1NPZA 1EWPA 7PCKA 1PE6A 3MORA 1YK7A 3HWNA 4CDDB 2NQAA 4YYVA 1ME3A 2DCAA 4YYSA 4QRGA 2AVWA 2YJBA 1QOLA 1AYWA 2DJGB 2R9FA 4X6JA 3CH3X 1JQPA 4XUIA 4MSXA 2DJFB 3IOQA 1KXRA 2VHSA 5JH3A 1PADA 1K3BB 3HD3A 3N3KA 3K24A 1ICFA 2BDZA 9PAPA 3IHPA 1GCBA 4MZSA 4N8WA 3H8CA 4FIPA 4W4UA 2FO5A 3HHIA 3KW9A 2G6DA 3I06A 1PBHA 2JQGR 3C9EA 2B1NA 1ATKA 3OVZA 3MHSA 2HH5A 2E02A 3RVWA 3V6CA 1MIRA 2CB5A 4Q8HA 4W5CA 4W5BA 1MEMA 1KFXL 4N4ZA 1X9YA 3DF0A 3ERVA 1NLJA 4YYQA 2FYEA 3ZUAA 4I07A 4BSQA 1Y4HA 1QDQA 4PADA 1ITOA 2DC7A 1EWOA 2DZZA 2FT2A 1U9XA 2F7DA 1CJLA 1CTEA 1FH0A 2HXZA 3M99A 3CBJA 3B79A 2G8JA 2G7YA 2NQDB 2R9CA 3IMAA 3KWBX 3BCNA 3K9MA 2OULA 3H8BA 1NQCA 2O6XA 4QH6A 3USVA 4WA6A 2R9OA 1NB5A 5F02A 4CDFB 4ZUXU 1KHQA 2AYNA 3P5XA 5EGWA 1QXPA 1BQIA 3LFYA 1GMYA 5PADA 2CIOA 1DEUA 3CBKA 4OELA 3V6EA 3S3RA 3K8UA 2E01A 3HHAA 4Q8GA 2AUZA 4BS5A 3MTNA 5FPWA 4BS6A 1M6DA 4DMYA 1VSNA 4OEMA 2Y6EA 1YALA 4HWYA 1CVZA 2R9NA 5CVNB 1O0EA 2H7JA 2DC6A 1F2CA 3H7DA 2AIMA 5CVOB 6PADA 3CH2X 1KFUL 3P5UA 1MEGA 3BOWA 3N4CA 2GFOA 3P5VA 3QT4A 3BWKA 3H89A 1F2AA 1ZIVA 2ATOA 1DF0A 1Y08A 3IV2A 1CQDA 2PREA 2PBHA 3PBHA 3WXGA 1AYVA 3LXSA 1IWDA 1SNKA 8PCHA 2R9MA 3O1GA 3RVXA 4CZWA 1AECA 3GCBA 1NB3A 3KKUA 1YT7A 1CPJA 3N3GA 4AXMA
chains in the Genus database with same CATH superfamily
4OVZA 4PI3A 2BTWA 4YVAA 2AYOA 3PHWA 1CV8A 2FRQA 3B21A 1TU6A 3KX1A 2UZJA 4D8IA 3OF9A 2F1GA 5J94A 1F29A 3BPFA 2P7UA 3MHHA 2P0RA 3QJ3A 1PPOA 2XU4A 5A24A 5K16A 2NQGA 3F5VA 4BPVA 1Q6KA 4XR7A 4QBBA 3F75A 4IUMA 4KLBA 2ARYA 2AS8A 3PT2A 3IFUA 1EWLA 2OZ2A 2XU1A 3TNXA 1KHPA 2YJCA 3RNVA 5EF4A 2NQIA 1AU2A 1TL9A 2HHNA 4FK5A 2P86A 5CHVA 3PDFA 2BU3A 2ACTA 4X6IA 1CB5A 3D6SA 2E00A 1AYUA 4X6HA 4RF1A 1AU3A 2FRAA 1MS6A 4OVZB 2BTWB 1PXVA 2AU1A 3BPMA 3RVVA 3U8EA 3BC3A 1PCIA 1U5IA 2VHFA 3I3TA 5KO3A 4YYWA 1VJVA 4MZOA 4R3DA 1YZBA 3KFQA 1PPPA 4N79A 1PPNA 1CS8A 3IEJA 2XU5A 3QSDA 2E03A 2DCCA 4CDEB 4G54A 2J7QC 1YVBA 2PADA 4YV8A 1S4VA 3OISA 2YJ2A 3PRPA 1U9WA 2YJ8A 2DZYA 2IBIA 1THEA 4CDCB 3KWZA 3MJ5A 3W31A 1F2BA 4BOQA 1GECE 4PP2E 1SP4B 4P6EA 1XKGA 2DC9A 1ME4A 3NHEA 3TRKA 4QRXA 4GUAA 1A6RA 3IUTA 2AUXA 2FUDA 2XU3A 4QRVA 2PNSA 3W30A 2FQ9A 5CHTA 4YYRA 2DCBA 1ZCMA 2FE8A 5JA7A 4FJCA 1DKIA 1BY8A 2C0YA 2YJ9A 3OVXA 5CVMA 1YK8A 1PIPA 2B1MA 2DC8A 2GHUA 2Y5BA 1U9VA 3H6SA 1MDWA 1GLOA 1AU4A 1MHWA 3O0UA 3S3QA 3WXFA 2WBFX 4IP3A 1TLOA 3PW3A 1STFE 1BP4A 2BDLA 1AU0A 4YYUA 1EF7A 4AXLA 3OF8A 1QMYA 2DCDA 4PP1A 2IPPB 1POPA 1PPDA 3TMPA 2JQFR 1EWMA 4I05A 3KSEA 2R6NA 1CSBB 2G8EA 3PRMA 4I04A 4M0WA 4P6GA 3WXEA 3AI8A 3PNRA 4RY2A 4BQVA 1HUCB 2HWKA 4D8EA 1U9QX 2FTDA 1AIMA 4DMXA 1BGOA 2DOSA 2HD5A 2OP3A 3P5WA 3E1ZB 2AGAA 1NL6A 2JTCA 4K7CA 1NPZA 1EWPA 7PCKA 1PE6A 3MORA 1YK7A 4ZTBA 3HWNA 5EZQA 4CDDB 2NQAA 4YYVA 1ME3A 2DCAA 4YYSA 4QRGA 2AVWA 2YJBA 1QOLA 1AYWA 2DJGB 2R9FA 4X6JA 2Z84A 3CH3X 4BOSA 1JQPA 4P16A 4XUIA 4MSXA 2DJFB 3IOQA 1KXRA 2VHSA 5JH3A 1PADA 1K3BB 3HD3A 4WURA 3N3KA 3K24A 1ICFA 2BDZA 9PAPA 3IHPA 1GCBA 4MZSA 4N8WA 3H8CA 4FIPA 4W4UA 4REZA 2FO5A 3HHIA 3KW9A 4BOPA 2G6DA 3I06A 1PBHA 4RKXA 2JQGR 3C9EA 2B1NA 1ATKA 3OVZA 3MHSA 2HH5A 2E02A 3RVWA 3V6CA 1MIRA 2CB5A 4Q8HA 4W5CA 4RF0A 1MEMA 4W5BA 2JRIA 1KFXL 4N4ZA 1X9YA 3BY4A 4HXDB 3DF0A 3E9SA 3ERVA 1NLJA 4YYQA 2FYEA 3ZUAA 4D8BA 4I07A 4BSQA 1Y4HA 1QDQA 3PHXA 4PADA 1ITOA 2DC7A 4XZXA 1EWOA 2DZZA 2FT2A 3ZNHA 1U9XA 2F7DA 1CJLA 1CTEA 1FH0A 2HXZA 3M99A 4MM3B 3CBJA 3B79A 2G8JA 2G7YA 2NQDB 2R9CA 3IMAA 4OW0A 3KWBX 3BCNA 3K9MA 5JZEA 2OULA 3H8BA 1NQCA 2O6XA 4QH6A 3USVA 4WA6A 4BOZA 2R9OA 1NB5A 5EZSA 3PHUA 3OQCA 5F02A 3BBAA 4CDFB 4ZUXU 1KHQA 2AYNA 3P5XA 5EGWA 1QXPA 1BQIA 3LFYA 1GMYA 4BOUA 5PADA 3MTVA 5E6JA 2CIOA 1DEUA 3CBKA 4OELA 3V6EA 3S3RA 3K8UA 2E01A 3HHAA 4Q8GA 2AUZA 4BS5A 3MTNA 5FPWA 4BS6A 1M6DA 4DMYA 3MP2A 1VSNA 4OEMA 2Y6EA 1YALA 4HWYA 1CVZA 2R9NA 5CVNB 1O0EA 2H7JA 2DC6A 4MI7A 1F2CA 3H7DA 2AIMA 5CVOB 6PADA 3CH2X 1KFUL 3P5UA 1MEGA 3BOWA 3N4CA 2GFOA 3P5VA 3QT4A 1PVJA 3BWKA 3H89A 3BB7A 1F2AA 1ZIVA 2ATOA 1DF0A 4A5UA 2J7QA 1Y08A 3IV2A 1CQDA 2PREA 2PBHA 3PBHA 3WXGA 3PSEA 1UKFA 1AYVA 4PT5A 3LXSA 3O65A 1IWDA 1SNKA 8PCHA 2R9MA 3O1GA 3RVXA 4CZWA 1AECA 3GCBA 4RNAA 1NB3A 3KKUA 1YT7A 1CPJA 3C0RA 3N3GA 4AXMA
chains in the Genus database with same CATH topology
4PI3A 4YVAA 2AYOA 1CV8A 2FRQA 1TU6A 3KX1A 3OF9A 2F1GA 5J94A 1F29A 3BPFA 2P7UA 3MHHA 2P0RA 3QJ3A 4B55A 1PPOA 2XU4A 5A24A 5K16A 2NQGA 3F5VA 4BPVA 1Q6KA 4XR7A 4QBBA 3F75A 3D9WA 2BSZA 4KLBA 2ARYA 2AS8A 1EWLA 2OZ2A 2XU1A 3TNXA 1KHPA 2YJCA 5EF4A 1W6FA 2NQIA 1AU2A 1TL9A 2HHNA 4FK5A 2P86A 5CHVA 3PDFA 2ACTA 4X6IA 1CB5A 3D6SA 2E00A 1AYUA 4X6HA 1AU3A 2FRAA 1MS6A 1PXVA 2AU1A 3BPMA 3RVVA 3U8EA 3BC3A 1PCIA 1U5IA 2VHFA 3I3TA 4YYWA 1VJVA 4MZOA 3KFQA 1PPPA 4N79A 1PPNA 1CS8A 3IEJA 2XU5A 3QSDA 2E03A 2DCCA 4CDEB 4G54A 1YVBA 2PADA 4YV8A 1S4VA 3OISA 2YJ2A 1U9WA 4GUZA 2YJ8A 2DZYA 2IBIA 1THEA 4CDCB 3KWZA 4NV8A 2VFCA 1F2BA 1GECE 4PP2E 1SP4B 4P6EA 1XKGA 2DC9A 1ME4A 3NHEA 4QRXA 1A6RA 3IUTA 2AUXA 1W4TA 2FUDA 2XU3A 4QRVA 2PNSA 2FQ9A 5CHTA 4YYRA 2DCBA 1ZCMA 5JA7A 4FJCA 1BY8A 2C0YA 2YJ9A 3OVXA 5CVMA 1YK8A 1PIPA 2B1MA 2DC8A 2GHUA 2Y5BA 1U9VA 3H6SA 1MDWA 1GLOA 1AU4A 1MHWA 3O0UA 3S3QA 3WXFA 2WBFX 1TLOA 3PW3A 1STFE 1BP4A 2BDLA 1AU0A 4YYUA 1EF7A 4AXLA 3OF8A 1QMYA 2DCDA 4PP1A 2IPPB 1POPA 1PPDA 3LTWA 2JQFR 1EWMA 4I05A 3KSEA 4BGFA 2R6NA 1CSBB 2G8EA 4I04A 4NV7A 3WXEA 4P6GA 3AI8A 3PNRA 4RY2A 4BQVA 1HUCB 1U9QX 2FTDA 1AIMA 4DMXA 1BGOA 2HD5A 2OP3A 3P5WA 3E1ZB 1NL6A 4K7CA 1NPZA 1EWPA 7PCKA 1PE6A 3MORA 1YK7A 3HWNA 4CDDB 2NQAA 4YYVA 1ME3A 2DCAA 4YYSA 4QRGA 2AVWA 2YJBA 1QOLA 1AYWA 2DJGB 2R9FA 4X6JA 3CH3X 1JQPA 4XUIA 4MSXA 2DJFB 3IOQA 1KXRA 2VHSA 5JH3A 1PADA 1K3BB 3HD3A 3N3KA 3K24A 1ICFA 2BDZA 1E2TA 9PAPA 3IHPA 1GCBA 4MZSA 4N8WA 3H8CA 4FIPA 4W4UA 2FO5A 3HHIA 3KW9A 2G6DA 3I06A 1PBHA 2JQGR 3C9EA 4C5PA 2B1NA 1ATKA 3OVZA 3MHSA 2HH5A 2E02A 3RVWA 3V6CA 1MIRA 2CB5A 4Q8HA 4W5CA 4W5BA 1MEMA 1KFXL 4N4ZA 1X9YA 1W5RA 3DF0A 3ERVA 1NLJA 4YYQA 2FYEA 3ZUAA 4I07A 4BSQA 1Y4HA 1QDQA 4PADA 1ITOA 2DC7A 1EWOA 2DZZA 2FT2A 1U9XA 2F7DA 1CJLA 1CTEA 1FH0A 2HXZA 3M99A 3CBJA 3B79A 2G8JA 2G7YA 2NQDB 2R9CA 3IMAA 3KWBX 3BCNA 3K9MA 2OULA 3H8BA 1NQCA 2O6XA 4QH6A 3USVA 4WA6A 2R9OA 1NB5A 5F02A 4CDFB 4ZUXU 1KHQA 2AYNA 3P5XA 5EGWA 1QXPA 1BQIA 3LFYA 1GMYA 5PADA 2CIOA 1DEUA 3CBKA 4OELA 3V6EA 3S3RA 3K8UA 2E01A 3HHAA 4Q8GA 2AUZA 4BS5A 3MTNA 5FPWA 4BS6A 1M6DA 4DMYA 1VSNA 4OEMA 2Y6EA 1YALA 4HWYA 1CVZA 2R9NA 5CVNB 1O0EA 2H7JA 2DC6A 1F2CA 3H7DA 2AIMA 5CVOB 6PADA 3CH2X 1KFUL 3P5UA 1MEGA 3BOWA 3N4CA 2GFOA 3P5VA 3QT4A 3BWKA 3H89A 2VFBA 1F2AA 1ZIVA 2ATOA 1DF0A 1Y08A 3IV2A 1CQDA 2PREA 2PBHA 3PBHA 3WXGA 1AYVA 3LXSA 1GX3A 1IWDA 1SNKA 8PCHA 2R9MA 3O1GA 3RVXA 4CZWA 1AECA 3GCBA 1NB3A 3KKUA 1YT7A 1CPJA 3N3GA 4AXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PI3 A;  4YVA A;  2AYO A;  1CV8 A;  2FRQ A;  1TU6 A;  3KX1 A;  3OF9 A;  2F1G A;  5J94 A;  1F29 A;  3BPF A;  2P7U A;  3MHH A;  2P0R A;  3QJ3 A;  1PPO A;  2XU4 A;  5A24 A;  5K16 A;  2NQG A;  3F5V A;  4BPV A;  1Q6K A;  4XR7 A;  4QBB A;  3F75 A;  4KLB A;  2ARY A;  2AS8 A;  1EWL A;  2OZ2 A;  2XU1 A;  3TNX A;  1KHP A;  2YJC A;  5EF4 A;  2NQI A;  1AU2 A;  1TL9 A;  2HHN A;  4FK5 A;  2P86 A;  5CHV A;  3PDF A;  2ACT A;  4X6I A;  1CB5 A;  3D6S A;  2E00 A;  1AYU A;  4X6H A;  1AU3 A;  2FRA A;  1MS6 A;  1PXV A;  2AU1 A;  3BPM A;  3RVV A;  3U8E A;  3BC3 A;  1PCI A;  1U5I A;  2VHF A;  3I3T A;  4YYW A;  1VJV A;  4MZO A;  3KFQ A;  1PPP A;  4N79 A;  1PPN A;  1CS8 A;  3IEJ A;  2XU5 A;  3QSD A;  2E03 A;  2DCC A;  4CDE B;  4G54 A;  1YVB A;  2PAD A;  4YV8 A;  1S4V A;  3OIS A;  2YJ2 A;  1U9W A;  2YJ8 A;  2DZY A;  2IBI A;  1THE A;  4CDC B;  3KWZ A;  1F2B A;  1GEC E;  4PP2 E;  1SP4 B;  4P6E A;  1XKG A;  2DC9 A;  1ME4 A;  3NHE A;  4QRX A;  1A6R A;  3IUT A;  2AUX A;  2FUD A;  2XU3 A;  4QRV A;  2PNS A;  2FQ9 A;  5CHT A;  4YYR A;  2DCB A;  1ZCM A;  5JA7 A;  4FJC A;  1BY8 A;  2C0Y A;  2YJ9 A;  3OVX A;  5CVM A;  1YK8 A;  1PIP A;  2B1M A;  2DC8 A;  2GHU A;  2Y5B A;  1U9V A;  3H6S A;  1MDW A;  1GLO A;  1AU4 A;  1MHW A;  3O0U A;  3S3Q A;  3WXF A;  2WBF X;  1TLO A;  3PW3 A;  1STF E;  1BP4 A;  2BDL A;  1AU0 A;  4YYU A;  1EF7 A;  4AXL A;  3OF8 A;  1QMY A;  2DCD A;  4PP1 A;  2IPP B;  1POP A;  1PPD A;  2JQF R;  1EWM A;  4I05 A;  3KSE A;  2R6N A;  1CSB B;  2G8E A;  4I04 A;  3WXE A;  4P6G A;  3AI8 A;  3PNR A;  4RY2 A;  4BQV A;  1HUC B;  1U9Q X;  2FTD A;  1AIM A;  4DMX A;  1BGO A;  2HD5 A;  2OP3 A;  3P5W A;  3E1Z B;  1NL6 A;  4K7C A;  1NPZ A;  1EWP A;  7PCK A;  1PE6 A;  3MOR A;  1YK7 A;  3HWN A;  4CDD B;  2NQA A;  4YYV A;  1ME3 A;  2DCA A;  4YYS A;  4QRG A;  2AVW A;  2YJB A;  1QOL A;  1AYW A;  2DJG B;  2R9F A;  4X6J A;  3CH3 X;  1JQP A;  4XUI A;  4MSX A;  2DJF B;  3IOQ A;  1KXR A;  2VHS A;  5JH3 A;  1PAD A;  1K3B B;  3HD3 A;  3N3K A;  3K24 A;  1ICF A;  2BDZ A;  9PAP A;  3IHP A;  1GCB A;  4MZS A;  4N8W A;  3H8C A;  4FIP A;  4W4U A;  2FO5 A;  3HHI A;  3KW9 A;  2G6D A;  3I06 A;  1PBH A;  2JQG R;  3C9E A;  2B1N A;  1ATK A;  3OVZ A;  3MHS A;  2HH5 A;  2E02 A;  3RVW A;  3V6C A;  1MIR A;  2CB5 A;  4Q8H A;  4W5C A;  4W5B A;  1MEM A;  1KFX L;  4N4Z A;  1X9Y A;  3DF0 A;  3ERV A;  1NLJ A;  4YYQ A;  2FYE A;  3ZUA A;  4I07 A;  4BSQ A;  1Y4H A;  1QDQ A;  4PAD A;  1ITO A;  2DC7 A;  1EWO A;  2DZZ A;  2FT2 A;  1U9X A;  2F7D A;  1CJL A;  1CTE A;  1FH0 A;  2HXZ A;  3M99 A;  3CBJ A;  3B79 A;  2G8J A;  2G7Y A;  2NQD B;  2R9C A;  3IMA A;  3KWB X;  3BCN A;  3K9M A;  2OUL A;  3H8B A;  1NQC A;  2O6X A;  4QH6 A;  3USV A;  4WA6 A;  2R9O A;  1NB5 A;  5F02 A;  4CDF B;  4ZUX U;  1KHQ A;  2AYN A;  3P5X A;  5EGW A;  1QXP A;  1BQI A;  3LFY A;  1GMY A;  5PAD A;  2CIO A;  1DEU A;  3CBK A;  4OEL A;  3V6E A;  3S3R A;  3K8U A;  2E01 A;  3HHA A;  4Q8G A;  2AUZ A;  4BS5 A;  3MTN A;  5FPW A;  4BS6 A;  1M6D A;  4DMY A;  1VSN A;  4OEM A;  2Y6E A;  1YAL A;  4HWY A;  1CVZ A;  2R9N A;  5CVN B;  1O0E A;  2H7J A;  2DC6 A;  1F2C A;  3H7D A;  2AIM A;  5CVO B;  6PAD A;  3CH2 X;  1KFU L;  3P5U A;  1MEG A;  3BOW A;  3N4C A;  2GFO A;  3P5V A;  3QT4 A;  3BWK A;  3H89 A;  1F2A A;  1ZIV A;  2ATO A;  1DF0 A;  1Y08 A;  3IV2 A;  1CQD A;  2PRE A;  2PBH A;  3PBH A;  3WXG A;  1AYV A;  3LXS A;  1IWD A;  1SNK A;  8PCH A;  2R9M A;  3O1G A;  3RVX A;  4CZW A;  1AEC A;  3GCB A;  1NB3 A;  3KKU A;  1YT7 A;  1CPJ A;  3N3G A;  4AXM A; 
#chains in the Genus database with same CATH topology
 4OVZ A;  4PI3 A;  2BTW A;  4YVA A;  2AYO A;  3PHW A;  1CV8 A;  2FRQ A;  3B21 A;  1TU6 A;  3KX1 A;  2UZJ A;  4D8I A;  3OF9 A;  2F1G A;  5J94 A;  1F29 A;  3BPF A;  2P7U A;  3MHH A;  2P0R A;  3QJ3 A;  1PPO A;  2XU4 A;  5A24 A;  5K16 A;  2NQG A;  3F5V A;  4BPV A;  1Q6K A;  4XR7 A;  4QBB A;  3F75 A;  4IUM A;  4KLB A;  2ARY A;  2AS8 A;  3PT2 A;  3IFU A;  1EWL A;  2OZ2 A;  2XU1 A;  3TNX A;  1KHP A;  2YJC A;  3RNV A;  5EF4 A;  2NQI A;  1AU2 A;  1TL9 A;  2HHN A;  4FK5 A;  2P86 A;  5CHV A;  3PDF A;  2BU3 A;  2ACT A;  4X6I A;  1CB5 A;  3D6S A;  2E00 A;  1AYU A;  4X6H A;  4RF1 A;  1AU3 A;  2FRA A;  1MS6 A;  4OVZ B;  2BTW B;  1PXV A;  2AU1 A;  3BPM A;  3RVV A;  3U8E A;  3BC3 A;  1PCI A;  1U5I A;  2VHF A;  3I3T A;  5KO3 A;  4YYW A;  1VJV A;  4MZO A;  4R3D A;  1YZB A;  3KFQ A;  1PPP A;  4N79 A;  1PPN A;  1CS8 A;  3IEJ A;  2XU5 A;  3QSD A;  2E03 A;  2DCC A;  4CDE B;  4G54 A;  2J7Q C;  1YVB A;  2PAD A;  4YV8 A;  1S4V A;  3OIS A;  2YJ2 A;  3PRP A;  1U9W A;  2YJ8 A;  2DZY A;  2IBI A;  1THE A;  4CDC B;  3KWZ A;  3MJ5 A;  3W31 A;  1F2B A;  4BOQ A;  1GEC E;  4PP2 E;  1SP4 B;  4P6E A;  1XKG A;  2DC9 A;  1ME4 A;  3NHE A;  3TRK A;  4QRX A;  4GUA A;  1A6R A;  3IUT A;  2AUX A;  2FUD A;  2XU3 A;  4QRV A;  2PNS A;  3W30 A;  2FQ9 A;  5CHT A;  4YYR A;  2DCB A;  1ZCM A;  2FE8 A;  5JA7 A;  4FJC A;  1DKI A;  1BY8 A;  2C0Y A;  2YJ9 A;  3OVX A;  5CVM A;  1YK8 A;  1PIP A;  2B1M A;  2DC8 A;  2GHU A;  2Y5B A;  1U9V A;  3H6S A;  1MDW A;  1GLO A;  1AU4 A;  1MHW A;  3O0U A;  3S3Q A;  3WXF A;  2WBF X;  4IP3 A;  1TLO A;  3PW3 A;  1STF E;  1BP4 A;  2BDL A;  1AU0 A;  4YYU A;  1EF7 A;  4AXL A;  3OF8 A;  1QMY A;  2DCD A;  4PP1 A;  2IPP B;  1POP A;  1PPD A;  3TMP A;  2JQF R;  1EWM A;  4I05 A;  3KSE A;  2R6N A;  1CSB B;  2G8E A;  3PRM A;  4I04 A;  4M0W A;  4P6G A;  3WXE A;  3AI8 A;  3PNR A;  4RY2 A;  4BQV A;  1HUC B;  2HWK A;  4D8E A;  1U9Q X;  2FTD A;  1AIM A;  4DMX A;  1BGO A;  2DOS A;  2HD5 A;  2OP3 A;  3P5W A;  3E1Z B;  2AGA A;  1NL6 A;  2JTC A;  4K7C A;  1NPZ A;  1EWP A;  7PCK A;  1PE6 A;  3MOR A;  1YK7 A;  4ZTB A;  3HWN A;  5EZQ A;  4CDD B;  2NQA A;  4YYV A;  1ME3 A;  2DCA A;  4YYS A;  4QRG A;  2AVW A;  2YJB A;  1QOL A;  1AYW A;  2DJG B;  2R9F A;  4X6J A;  2Z84 A;  3CH3 X;  4BOS A;  1JQP A;  4P16 A;  4XUI A;  4MSX A;  2DJF B;  3IOQ A;  1KXR A;  2VHS A;  5JH3 A;  1PAD A;  1K3B B;  3HD3 A;  4WUR A;  3N3K A;  3K24 A;  1ICF A;  2BDZ A;  9PAP A;  3IHP A;  1GCB A;  4MZS A;  4N8W A;  3H8C A;  4FIP A;  4W4U A;  4REZ A;  2FO5 A;  3HHI A;  3KW9 A;  4BOP A;  2G6D A;  3I06 A;  1PBH A;  4RKX A;  2JQG R;  3C9E A;  2B1N A;  1ATK A;  3OVZ A;  3MHS A;  2HH5 A;  2E02 A;  3RVW A;  3V6C A;  1MIR A;  2CB5 A;  4Q8H A;  4W5C A;  4RF0 A;  1MEM A;  4W5B A;  2JRI A;  1KFX L;  4N4Z A;  1X9Y A;  3BY4 A;  4HXD B;  3DF0 A;  3E9S A;  3ERV A;  1NLJ A;  4YYQ A;  2FYE A;  3ZUA A;  4D8B A;  4I07 A;  4BSQ A;  1Y4H A;  1QDQ A;  3PHX A;  4PAD A;  1ITO A;  2DC7 A;  4XZX A;  1EWO A;  2DZZ A;  2FT2 A;  3ZNH A;  1U9X A;  2F7D A;  1CJL A;  1CTE A;  1FH0 A;  2HXZ A;  3M99 A;  4MM3 B;  3CBJ A;  3B79 A;  2G8J A;  2G7Y A;  2NQD B;  2R9C A;  3IMA A;  4OW0 A;  3KWB X;  3BCN A;  3K9M A;  5JZE A;  2OUL A;  3H8B A;  1NQC A;  2O6X A;  4QH6 A;  3USV A;  4WA6 A;  4BOZ A;  2R9O A;  1NB5 A;  5EZS A;  3PHU A;  3OQC A;  5F02 A;  3BBA A;  4CDF B;  4ZUX U;  1KHQ A;  2AYN A;  3P5X A;  5EGW A;  1QXP A;  1BQI A;  3LFY A;  1GMY A;  4BOU A;  5PAD A;  3MTV A;  5E6J A;  2CIO A;  1DEU A;  3CBK A;  4OEL A;  3V6E A;  3S3R A;  3K8U A;  2E01 A;  3HHA A;  4Q8G A;  2AUZ A;  4BS5 A;  3MTN A;  5FPW A;  4BS6 A;  1M6D A;  4DMY A;  3MP2 A;  1VSN A;  4OEM A;  2Y6E A;  1YAL A;  4HWY A;  1CVZ A;  2R9N A;  5CVN B;  1O0E A;  2H7J A;  2DC6 A;  4MI7 A;  1F2C A;  3H7D A;  2AIM A;  5CVO B;  6PAD A;  3CH2 X;  1KFU L;  3P5U A;  1MEG A;  3BOW A;  3N4C A;  2GFO A;  3P5V A;  3QT4 A;  1PVJ A;  3BWK A;  3H89 A;  3BB7 A;  1F2A A;  1ZIV A;  2ATO A;  1DF0 A;  4A5U A;  2J7Q A;  1Y08 A;  3IV2 A;  1CQD A;  2PRE A;  2PBH A;  3PBH A;  3WXG A;  3PSE A;  1UKF A;  1AYV A;  4PT5 A;  3LXS A;  3O65 A;  1IWD A;  1SNK A;  8PCH A;  2R9M A;  3O1G A;  3RVX A;  4CZW A;  1AEC A;  3GCB A;  4RNA A;  1NB3 A;  3KKU A;  1YT7 A;  1CPJ A;  3C0R A;  3N3G A;  4AXM A; 
#chains in the Genus database with same CATH homology
 4PI3 A;  4YVA A;  2AYO A;  1CV8 A;  2FRQ A;  1TU6 A;  3KX1 A;  3OF9 A;  2F1G A;  5J94 A;  1F29 A;  3BPF A;  2P7U A;  3MHH A;  2P0R A;  3QJ3 A;  4B55 A;  1PPO A;  2XU4 A;  5A24 A;  5K16 A;  2NQG A;  3F5V A;  4BPV A;  1Q6K A;  4XR7 A;  4QBB A;  3F75 A;  3D9W A;  2BSZ A;  4KLB A;  2ARY A;  2AS8 A;  1EWL A;  2OZ2 A;  2XU1 A;  3TNX A;  1KHP A;  2YJC A;  5EF4 A;  1W6F A;  2NQI A;  1AU2 A;  1TL9 A;  2HHN A;  4FK5 A;  2P86 A;  5CHV A;  3PDF A;  2ACT A;  4X6I A;  1CB5 A;  3D6S A;  2E00 A;  1AYU A;  4X6H A;  1AU3 A;  2FRA A;  1MS6 A;  1PXV A;  2AU1 A;  3BPM A;  3RVV A;  3U8E A;  3BC3 A;  1PCI A;  1U5I A;  2VHF A;  3I3T A;  4YYW A;  1VJV A;  4MZO A;  3KFQ A;  1PPP A;  4N79 A;  1PPN A;  1CS8 A;  3IEJ A;  2XU5 A;  3QSD A;  2E03 A;  2DCC A;  4CDE B;  4G54 A;  1YVB A;  2PAD A;  4YV8 A;  1S4V A;  3OIS A;  2YJ2 A;  1U9W A;  4GUZ A;  2YJ8 A;  2DZY A;  2IBI A;  1THE A;  4CDC B;  3KWZ A;  4NV8 A;  2VFC A;  1F2B A;  1GEC E;  4PP2 E;  1SP4 B;  4P6E A;  1XKG A;  2DC9 A;  1ME4 A;  3NHE A;  4QRX A;  1A6R A;  3IUT A;  2AUX A;  1W4T A;  2FUD A;  2XU3 A;  4QRV A;  2PNS A;  2FQ9 A;  5CHT A;  4YYR A;  2DCB A;  1ZCM A;  5JA7 A;  4FJC A;  1BY8 A;  2C0Y A;  2YJ9 A;  3OVX A;  5CVM A;  1YK8 A;  1PIP A;  2B1M A;  2DC8 A;  2GHU A;  2Y5B A;  1U9V A;  3H6S A;  1MDW A;  1GLO A;  1AU4 A;  1MHW A;  3O0U A;  3S3Q A;  3WXF A;  2WBF X;  1TLO A;  3PW3 A;  1STF E;  1BP4 A;  2BDL A;  1AU0 A;  4YYU A;  1EF7 A;  4AXL A;  3OF8 A;  1QMY A;  2DCD A;  4PP1 A;  2IPP B;  1POP A;  1PPD A;  3LTW A;  2JQF R;  1EWM A;  4I05 A;  3KSE A;  4BGF A;  2R6N A;  1CSB B;  2G8E A;  4I04 A;  4NV7 A;  3WXE A;  4P6G A;  3AI8 A;  3PNR A;  4RY2 A;  4BQV A;  1HUC B;  1U9Q X;  2FTD A;  1AIM A;  4DMX A;  1BGO A;  2HD5 A;  2OP3 A;  3P5W A;  3E1Z B;  1NL6 A;  4K7C A;  1NPZ A;  1EWP A;  7PCK A;  1PE6 A;  3MOR A;  1YK7 A;  3HWN A;  4CDD B;  2NQA A;  4YYV A;  1ME3 A;  2DCA A;  4YYS A;  4QRG A;  2AVW A;  2YJB A;  1QOL A;  1AYW A;  2DJG B;  2R9F A;  4X6J A;  3CH3 X;  1JQP A;  4XUI A;  4MSX A;  2DJF B;  3IOQ A;  1KXR A;  2VHS A;  5JH3 A;  1PAD A;  1K3B B;  3HD3 A;  3N3K A;  3K24 A;  1ICF A;  2BDZ A;  1E2T A;  9PAP A;  3IHP A;  1GCB A;  4MZS A;  4N8W A;  3H8C A;  4FIP A;  4W4U A;  2FO5 A;  3HHI A;  3KW9 A;  2G6D A;  3I06 A;  1PBH A;  2JQG R;  3C9E A;  4C5P A;  2B1N A;  1ATK A;  3OVZ A;  3MHS A;  2HH5 A;  2E02 A;  3RVW A;  3V6C A;  1MIR A;  2CB5 A;  4Q8H A;  4W5C A;  4W5B A;  1MEM A;  1KFX L;  4N4Z A;  1X9Y A;  1W5R A;  3DF0 A;  3ERV A;  1NLJ A;  4YYQ A;  2FYE A;  3ZUA A;  4I07 A;  4BSQ A;  1Y4H A;  1QDQ A;  4PAD A;  1ITO A;  2DC7 A;  1EWO A;  2DZZ A;  2FT2 A;  1U9X A;  2F7D A;  1CJL A;  1CTE A;  1FH0 A;  2HXZ A;  3M99 A;  3CBJ A;  3B79 A;  2G8J A;  2G7Y A;  2NQD B;  2R9C A;  3IMA A;  3KWB X;  3BCN A;  3K9M A;  2OUL A;  3H8B A;  1NQC A;  2O6X A;  4QH6 A;  3USV A;  4WA6 A;  2R9O A;  1NB5 A;  5F02 A;  4CDF B;  4ZUX U;  1KHQ A;  2AYN A;  3P5X A;  5EGW A;  1QXP A;  1BQI A;  3LFY A;  1GMY A;  5PAD A;  2CIO A;  1DEU A;  3CBK A;  4OEL A;  3V6E A;  3S3R A;  3K8U A;  2E01 A;  3HHA A;  4Q8G A;  2AUZ A;  4BS5 A;  3MTN A;  5FPW A;  4BS6 A;  1M6D A;  4DMY A;  1VSN A;  4OEM A;  2Y6E A;  1YAL A;  4HWY A;  1CVZ A;  2R9N A;  5CVN B;  1O0E A;  2H7J A;  2DC6 A;  1F2C A;  3H7D A;  2AIM A;  5CVO B;  6PAD A;  3CH2 X;  1KFU L;  3P5U A;  1MEG A;  3BOW A;  3N4C A;  2GFO A;  3P5V A;  3QT4 A;  3BWK A;  3H89 A;  2VFB A;  1F2A A;  1ZIV A;  2ATO A;  1DF0 A;  1Y08 A;  3IV2 A;  1CQD A;  2PRE A;  2PBH A;  3PBH A;  3WXG A;  1AYV A;  3LXS A;  1GX3 A;  1IWD A;  1SNK A;  8PCH A;  2R9M A;  3O1G A;  3RVX A;  4CZW A;  1AEC A;  3GCB A;  1NB3 A;  3KKU A;  1YT7 A;  1CPJ A;  3N3G A;  4AXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...