2DCCA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca077 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
total genus 75
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dccA00
2XU5A 2P0RA 1POPA 3KSEA 3MHHA 2DCBA 2PNSA 4XR7A 4CDEB 1PADA 2AS8A 4MZSA 1EWOA 1ME3A 5EF4A 2BDZA 1U9QX 1AU3A 4PADA 3B79A 4I05A 1MDWA 3P5VA 1EWMA 3K9MA 4XUIA 3O0UA 1A6RA 1Y08A 1X9YA 1PPOA 3BPMA 4I07A 4BQVA 1GCBA 1NQCA 2YJBA 2FTDA 2NQGA 1VJVA 1PPPA 3KFQA 4K7CA 4BS5A 1ME4A 2C0YA 4Q8HA 4AXLA 1QXPA 1PIPA 1SNKA 4DMXA 2AYOA 1DF0A 4CDFB 2CB5A 4WA6A 1CB5A 2DC7A 2FT2A 1AYWA 4DMYA 2PBHA 3RVWA 2O6XA 1K3BB 5CVNB 3TNXA 2F7DA 2ARYA 3H7DA 3N3GA 4RY2A 4QRGA 3KKUA 4QRVA 2G8JA 1QMYA 3QT4A 1MIRA 2GFOA 1YVBA 1NPZA 2Y5BA 3OISA 1CJLA 3RVVA 5A24A 1EWPA 1KFXL 1U9XA 3IOQA 1ITOA 1Y4HA 1TL9A 1CVZA 2G6DA 4MSXA 1YT7A 4I04A 2VHFA 2VHSA 3CH3X 3OF9A 3QJ3A 1SP4B 3F5VA 1AIMA 1BP4A 3KW9A 2DC9A 2DCDA 3BWKA 3WXFA 4BSQA 2PREA 4OEMA 2XU4A 1AYVA 2FYEA 5PADA 3LXSA 4FIPA 1CPJA 1NB3A 2DZYA 4W4UA 3V6CA 1PXVA 1MS6A 2DC8A 1MEGA 3PNRA 3D6SA 2PADA 4G54A 3H6SA 4YYSA 3WXEA 2R9OA 3MORA 2FQ9A 3I3TA 4YV8A 3PBHA 3BC3A 2ATOA 2BDLA 2FRQA 1QOLA 4QBBA 3IV2A 2FO5A 1QDQA 4CDDB 1NL6A 2R9FA 3OF8A 2Y6EA 1PCIA 2DJFB 4X6IA 2JQGR 3OVZA 3IHPA 2YJ2A 1XKGA 3CBJA 1O0EA 1AU2A 7PCKA 2DJGB 9PAPA 1F2BA 2XU3A 4FJCA 2WBFX 1M6DA 3OVXA 1GECE 2DCAA 2AVWA 4X6JA 4HWYA 3IMAA 1VSNA 4P6EA 2NQIA 2DCCA 5K16A 3BPFA 2P7UA 5CVOB 4PI3A 3S3QA 1YK7A 8PCHA 5F02A 2G8EA 2G7YA 4N4ZA 6PADA 5CHTA 1AECA 1YALA 4MZOA 3N3KA 4FK5A 2E02A 3M99A 2B1MA 1U9VA 4YYWA 1U5IA 2AIMA 3KX1A 1IWDA 1FH0A 3QSDA 2DC6A 1JQPA 1GLOA 2OZ2A 4AXMA 2GHUA 4Q8GA 1KXRA 4W5CA 4N8WA 2FRAA 3PDFA 1F29A 3USVA 1ZIVA 5J94A 2F1GA 4YYRA 3LFYA 1KHQA 3U8EA 1ATKA 1PPNA 1S4VA 3CH2X 2CIOA 2DZZA 3MHSA 2YJ9A 4OELA 4ZUXU 1BGOA 2NQDB 4P6GA 3K24A 2HHNA 1CQDA 4PP2E 1F2AA 1THEA 4YYUA 4CZWA 2E00A 3CBKA 3MTNA 3V6EA 4BPVA 4YVAA 3IEJA 3AI8A 3F75A 2FUDA 3H8BA 4QH6A 5FPWA 2OP3A 3IUTA 1ICFA 3HHIA 1HUCB 5JH3A 1AU4A 1NB5A 2B1NA 3RVXA 1ZCMA 2E01A 1CTEA 1CV8A 3BOWA 3E1ZB 2AU1A 1YK8A 1AYUA 4QRXA 1EWLA 5JA7A 2R6NA 5EGWA 1TLOA 3HWNA 1EF7A 2ACTA 2P86A 3DF0A 2IPPB 4CDCB 2AUXA 2HD5A 3NHEA 1U9WA 3N4CA 4KLBA 3K8UA 3KWBX 1STFE 1Q6KA 1GMYA 4N79A 2YJ8A 1PBHA 3PW3A 2YJCA 4BS6A 5CVMA 3C9EA 3O1GA 2OULA 2E03A 3GCBA 1MEMA 2AYNA 4X6HA 3I06A 1BQIA 2H7JA 4PP1A 1PPDA 2R9NA 3ERVA 3HHAA 3HD3A 1CS8A 3BCNA 1PE6A 3ZUAA 2JQFR 4W5BA 3WXGA 3KWZA 1DEUA 1KFUL 1MHWA 2NQAA 4YYVA 2HH5A 2HXZA 3H8CA 1CSBB 5CHVA 1AU0A 1NLJA 3P5XA 2IBIA 2XU1A 1BY8A 1F2CA 1KHPA 3H89A 2AUZA 4YYQA 2R9MA 1TU6A 2R9CA 3P5UA 3P5WA 3S3RA
chains in the Genus database with same CATH superfamily
2XU5A 4OVZB 2P0RA 1POPA 3KSEA 3MHHA 2DCBA 2PNSA 4XR7A 2Z84A 5EZSA 4CDEB 1PADA 2AS8A 4MZSA 4RKXA 1EWOA 1ME3A 3BB7A 5EF4A 2BDZA 1U9QX 1AU3A 4PADA 3B79A 4I05A 1MDWA 3P5VA 1EWMA 4OW0A 3K9MA 4XUIA 3O0UA 1A6RA 1Y08A 1X9YA 1PPOA 3BPMA 4I07A 5KO3A 4BQVA 1GCBA 1NQCA 2YJBA 4BOQA 2FTDA 2NQGA 4BOZA 4BOUA 1VJVA 1PPPA 3KFQA 4K7CA 4BS5A 1ME4A 2C0YA 4Q8HA 4AXLA 1QXPA 1PIPA 1SNKA 3PHUA 4DMXA 2AYOA 1DF0A 4CDFB 4M0WA 4A5UA 2CB5A 4P16A 4WA6A 1CB5A 2DC7A 1PVJA 2FT2A 1AYWA 4DMYA 2PBHA 3RVWA 2O6XA 1K3BB 5CVNB 3TNXA 2F7DA 4D8EA 2ARYA 3H7DA 3N3GA 4RY2A 4QRGA 3KKUA 4QRVA 2G8JA 1QMYA 3QT4A 1MIRA 2GFOA 1YVBA 1NPZA 2Y5BA 4D8BA 3OISA 2BTWB 1CJLA 3RVVA 5A24A 3PSEA 1EWPA 1KFXL 1U9XA 3IOQA 4BOPA 1ITOA 1Y4HA 1TL9A 1CVZA 2G6DA 4MSXA 1YT7A 1DKIA 4I04A 2VHFA 2VHSA 3CH3X 3OF9A 3QJ3A 1SP4B 4PT5A 3F5VA 1AIMA 3MP2A 1BP4A 2FE8A 2UZJA 3KW9A 2DC9A 2DCDA 3BWKA 3WXFA 4BSQA 2PREA 3E9SA 4OEMA 2XU4A 1AYVA 2FYEA 2JRIA 5PADA 2J7QC 3LXSA 4FIPA 4REZA 1CPJA 1NB3A 2DZYA 4W4UA 3V6CA 1PXVA 1MS6A 4IP3A 2AGAA 2DC8A 1MEGA 3PNRA 3D6SA 4BOSA 2PADA 4G54A 3H6SA 4YYSA 3WXEA 2R9OA 3MORA 2FQ9A 3I3TA 4YV8A 3TMPA 3PBHA 3BC3A 2ATOA 2BDLA 2FRQA 1QOLA 4QBBA 3IV2A 2FO5A 1QDQA 4CDDB 1NL6A 2R9FA 3MJ5A 3OF8A 2Y6EA 1PCIA 4MM3B 2HWKA 2DJFB 4X6IA 2JQGR 3OVZA 3IHPA 2J7QA 2YJ2A 1XKGA 3CBJA 3PRMA 1O0EA 3MTVA 1AU2A 7PCKA 2DJGB 9PAPA 1F2BA 2XU3A 3BBAA 4FJCA 2WBFX 1M6DA 3OQCA 4XZXA 3OVXA 5JZEA 1GECE 2DCAA 2AVWA 4X6JA 3IMAA 4HWYA 1VSNA 4P6EA 3W30A 2NQIA 2DCCA 4R3DA 5K16A 4RF0A 3BPFA 2P7UA 5CVOB 4PI3A 4OVZA 3S3QA 1YK7A 8PCHA 5F02A 3ZNHA 2G8EA 2G7YA 4N4ZA 6PADA 5CHTA 1AECA 1YALA 4MZOA 3N3KA 4RNAA 4FK5A 2E02A 3M99A 2B1MA 1U9VA 4YYWA 1U5IA 3IFUA 2AIMA 3KX1A 1IWDA 1FH0A 3QSDA 2DC6A 1JQPA 1GLOA 2OZ2A 4AXMA 2GHUA 4Q8GA 2DOSA 1KXRA 4W5CA 4IUMA 4N8WA 2FRAA 3PDFA 1F29A 3USVA 1ZIVA 4GUAA 5J94A 2F1GA 4YYRA 3LFYA 1KHQA 3U8EA 1ATKA 1PPNA 1S4VA 3CH2X 2CIOA 2DZZA 3MHSA 2YJ9A 4OELA 4ZUXU 2BU3A 1BGOA 2NQDB 4P6GA 3K24A 2HHNA 1CQDA 3W31A 4PP2E 1F2AA 1THEA 4YYUA 4CZWA 2E00A 3CBKA 3MTNA 3V6EA 4BPVA 4YVAA 3IEJA 3AI8A 3F75A 2FUDA 3PT2A 3H8BA 3PRPA 4QH6A 5FPWA 2OP3A 3IUTA 1ICFA 2BTWA 3B21A 3HHIA 1HUCB 5JH3A 1AU4A 1NB5A 4MI7A 2B1NA 3RVXA 1ZCMA 2E01A 1CTEA 5E6JA 1CV8A 3BOWA 3E1ZB 2AU1A 1YK8A 1AYUA 4QRXA 1EWLA 5JA7A 2R6NA 5EGWA 1TLOA 3HWNA 1EF7A 2ACTA 2P86A 3DF0A 2IPPB 4CDCB 2AUXA 2HD5A 3NHEA 1U9WA 3N4CA 4RF1A 4KLBA 3K8UA 3KWBX 1STFE 1Q6KA 1UKFA 1GMYA 4N79A 2YJ8A 1PBHA 3PW3A 2YJCA 4BS6A 5CVMA 3C9EA 3O1GA 3PHWA 2OULA 3O65A 2E03A 3GCBA 1MEMA 5EZQA 3PHXA 4HXDB 2AYNA 4X6HA 3I06A 1BQIA 2H7JA 4PP1A 4WURA 1PPDA 2R9NA 3ERVA 3HHAA 3HD3A 1CS8A 1YZBA 2JTCA 3BCNA 1PE6A 3BY4A 3ZUAA 2JQFR 4W5BA 3WXGA 3KWZA 1DEUA 1KFUL 1MHWA 2NQAA 4YYVA 4D8IA 2HH5A 2HXZA 3TRKA 3H8CA 1CSBB 5CHVA 1AU0A 1NLJA 3P5XA 2IBIA 2XU1A 4ZTBA 1BY8A 1F2CA 1KHPA 3H89A 2AUZA 3RNVA 4YYQA 2R9MA 1TU6A 2R9CA 3C0RA 3P5UA 3P5WA 3S3RA
chains in the Genus database with same CATH topology
2XU5A 2P0RA 1POPA 3KSEA 3MHHA 2DCBA 2PNSA 4XR7A 4CDEB 1PADA 2AS8A 4MZSA 1EWOA 1ME3A 5EF4A 2BDZA 1U9QX 1AU3A 4PADA 3B79A 4I05A 1MDWA 3P5VA 1EWMA 3K9MA 4XUIA 3O0UA 1A6RA 1Y08A 1X9YA 1PPOA 3BPMA 4I07A 4BQVA 1GCBA 1NQCA 2YJBA 2FTDA 2NQGA 1VJVA 1PPPA 3KFQA 4K7CA 4BS5A 1ME4A 2C0YA 4Q8HA 4AXLA 1QXPA 1PIPA 1SNKA 4DMXA 2AYOA 1DF0A 4CDFB 2CB5A 4WA6A 1CB5A 2DC7A 2FT2A 1AYWA 4DMYA 2PBHA 3RVWA 2O6XA 4B55A 1K3BB 5CVNB 3TNXA 2F7DA 2ARYA 3H7DA 3N3GA 4RY2A 4QRGA 3KKUA 4QRVA 2G8JA 1QMYA 3QT4A 1MIRA 2GFOA 1YVBA 1NPZA 2Y5BA 3OISA 1CJLA 3RVVA 5A24A 1EWPA 1KFXL 1U9XA 3IOQA 1ITOA 1Y4HA 1TL9A 4NV8A 1CVZA 2G6DA 4MSXA 3D9WA 1YT7A 4I04A 4BGFA 2VHFA 2VHSA 3CH3X 3OF9A 3QJ3A 1SP4B 3F5VA 1AIMA 1BP4A 3KW9A 2DC9A 2DCDA 3BWKA 3WXFA 4BSQA 2PREA 4OEMA 2XU4A 1AYVA 2FYEA 5PADA 3LXSA 4FIPA 1CPJA 1NB3A 2DZYA 4W4UA 3V6CA 1PXVA 4GUZA 1MS6A 2DC8A 1MEGA 2BSZA 3PNRA 3D6SA 2PADA 4G54A 3H6SA 4YYSA 3WXEA 2R9OA 3MORA 2FQ9A 3I3TA 4YV8A 3PBHA 3BC3A 2ATOA 3LTWA 1W4TA 2BDLA 2FRQA 1QOLA 4QBBA 3IV2A 2FO5A 1QDQA 4CDDB 1NL6A 2R9FA 3OF8A 2Y6EA 1PCIA 2DJFB 4X6IA 2JQGR 3OVZA 3IHPA 2YJ2A 1XKGA 3CBJA 1O0EA 1AU2A 7PCKA 2DJGB 9PAPA 1F2BA 2XU3A 4FJCA 2WBFX 1M6DA 1GX3A 1W6FA 3OVXA 1GECE 2DCAA 2AVWA 4X6JA 4HWYA 3IMAA 1VSNA 1W5RA 4P6EA 2NQIA 2DCCA 5K16A 3BPFA 2P7UA 5CVOB 4PI3A 3S3QA 1YK7A 8PCHA 5F02A 2G8EA 2G7YA 4N4ZA 6PADA 5CHTA 1AECA 1YALA 4MZOA 3N3KA 4FK5A 2E02A 3M99A 2B1MA 1U9VA 4YYWA 1U5IA 2AIMA 4NV7A 3KX1A 1IWDA 1FH0A 3QSDA 2DC6A 1JQPA 1GLOA 2OZ2A 4AXMA 2GHUA 4Q8GA 1KXRA 4W5CA 4N8WA 2FRAA 3PDFA 1F29A 3USVA 1ZIVA 5J94A 2F1GA 4YYRA 3LFYA 1KHQA 3U8EA 1ATKA 1PPNA 1S4VA 3CH2X 2CIOA 2DZZA 3MHSA 2YJ9A 4OELA 4ZUXU 1BGOA 2NQDB 4P6GA 3K24A 2HHNA 2VFCA 1CQDA 4PP2E 1F2AA 1THEA 4YYUA 4CZWA 2E00A 3CBKA 3MTNA 3V6EA 4BPVA 4YVAA 3IEJA 3AI8A 3F75A 2FUDA 4C5PA 3H8BA 4QH6A 5FPWA 2OP3A 3IUTA 1ICFA 3HHIA 1HUCB 5JH3A 1AU4A 1NB5A 2B1NA 3RVXA 1ZCMA 2E01A 1CTEA 1CV8A 3BOWA 3E1ZB 2AU1A 1YK8A 1AYUA 4QRXA 1EWLA 5JA7A 2R6NA 5EGWA 1TLOA 3HWNA 1EF7A 2ACTA 2P86A 3DF0A 2IPPB 4CDCB 2AUXA 2HD5A 3NHEA 1U9WA 3N4CA 4KLBA 3K8UA 3KWBX 1STFE 1Q6KA 1GMYA 4N79A 2YJ8A 1PBHA 3PW3A 2YJCA 4BS6A 5CVMA 3C9EA 3O1GA 2OULA 2E03A 3GCBA 1MEMA 2AYNA 4X6HA 3I06A 1E2TA 1BQIA 2H7JA 4PP1A 1PPDA 2R9NA 3ERVA 3HHAA 3HD3A 1CS8A 3BCNA 1PE6A 3ZUAA 2JQFR 4W5BA 3WXGA 3KWZA 1DEUA 1KFUL 1MHWA 2NQAA 4YYVA 2HH5A 2HXZA 3H8CA 1CSBB 5CHVA 1AU0A 3P5XA 1NLJA 2IBIA 2XU1A 1BY8A 1F2CA 1KHPA 3H89A 2AUZA 4YYQA 2VFBA 2R9MA 1TU6A 2R9CA 3P5UA 3P5WA 3S3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU5 A;  2P0R A;  1POP A;  3KSE A;  3MHH A;  2DCB A;  2PNS A;  4XR7 A;  4CDE B;  1PAD A;  2AS8 A;  4MZS A;  1EWO A;  1ME3 A;  5EF4 A;  2BDZ A;  1U9Q X;  1AU3 A;  4PAD A;  3B79 A;  4I05 A;  1MDW A;  3P5V A;  1EWM A;  3K9M A;  4XUI A;  3O0U A;  1A6R A;  1Y08 A;  1X9Y A;  1PPO A;  3BPM A;  4I07 A;  4BQV A;  1GCB A;  1NQC A;  2YJB A;  2FTD A;  2NQG A;  1VJV A;  1PPP A;  3KFQ A;  4K7C A;  4BS5 A;  1ME4 A;  2C0Y A;  4Q8H A;  4AXL A;  1QXP A;  1PIP A;  1SNK A;  4DMX A;  2AYO A;  1DF0 A;  4CDF B;  2CB5 A;  4WA6 A;  1CB5 A;  2DC7 A;  2FT2 A;  1AYW A;  4DMY A;  2PBH A;  3RVW A;  2O6X A;  1K3B B;  5CVN B;  3TNX A;  2F7D A;  2ARY A;  3H7D A;  3N3G A;  4RY2 A;  4QRG A;  3KKU A;  4QRV A;  2G8J A;  1QMY A;  3QT4 A;  1MIR A;  2GFO A;  1YVB A;  1NPZ A;  2Y5B A;  3OIS A;  1CJL A;  3RVV A;  5A24 A;  1EWP A;  1KFX L;  1U9X A;  3IOQ A;  1ITO A;  1Y4H A;  1TL9 A;  1CVZ A;  2G6D A;  4MSX A;  1YT7 A;  4I04 A;  2VHF A;  2VHS A;  3CH3 X;  3OF9 A;  3QJ3 A;  1SP4 B;  3F5V A;  1AIM A;  1BP4 A;  3KW9 A;  2DC9 A;  2DCD A;  3BWK A;  3WXF A;  4BSQ A;  2PRE A;  4OEM A;  2XU4 A;  1AYV A;  2FYE A;  5PAD A;  3LXS A;  4FIP A;  1CPJ A;  1NB3 A;  2DZY A;  4W4U A;  3V6C A;  1PXV A;  1MS6 A;  2DC8 A;  1MEG A;  3PNR A;  3D6S A;  2PAD A;  4G54 A;  3H6S A;  4YYS A;  3WXE A;  2R9O A;  3MOR A;  2FQ9 A;  3I3T A;  4YV8 A;  3PBH A;  3BC3 A;  2ATO A;  2BDL A;  2FRQ A;  1QOL A;  4QBB A;  3IV2 A;  2FO5 A;  1QDQ A;  4CDD B;  1NL6 A;  2R9F A;  3OF8 A;  2Y6E A;  1PCI A;  2DJF B;  4X6I A;  2JQG R;  3OVZ A;  3IHP A;  2YJ2 A;  1XKG A;  3CBJ A;  1O0E A;  1AU2 A;  7PCK A;  2DJG B;  9PAP A;  1F2B A;  2XU3 A;  4FJC A;  2WBF X;  1M6D A;  3OVX A;  1GEC E;  2DCA A;  2AVW A;  4X6J A;  4HWY A;  3IMA A;  1VSN A;  4P6E A;  2NQI A;  2DCC A;  5K16 A;  3BPF A;  2P7U A;  5CVO B;  4PI3 A;  3S3Q A;  1YK7 A;  8PCH A;  5F02 A;  2G8E A;  2G7Y A;  4N4Z A;  6PAD A;  5CHT A;  1AEC A;  1YAL A;  4MZO A;  3N3K A;  4FK5 A;  2E02 A;  3M99 A;  2B1M A;  1U9V A;  4YYW A;  1U5I A;  2AIM A;  3KX1 A;  1IWD A;  1FH0 A;  3QSD A;  2DC6 A;  1JQP A;  1GLO A;  2OZ2 A;  4AXM A;  2GHU A;  4Q8G A;  1KXR A;  4W5C A;  4N8W A;  2FRA A;  3PDF A;  1F29 A;  3USV A;  1ZIV A;  5J94 A;  2F1G A;  4YYR A;  3LFY A;  1KHQ A;  3U8E A;  1ATK A;  1PPN A;  1S4V A;  3CH2 X;  2CIO A;  2DZZ A;  3MHS A;  2YJ9 A;  4OEL A;  4ZUX U;  1BGO A;  2NQD B;  4P6G A;  3K24 A;  2HHN A;  1CQD A;  4PP2 E;  1F2A A;  1THE A;  4YYU A;  4CZW A;  2E00 A;  3CBK A;  3MTN A;  3V6E A;  4BPV A;  4YVA A;  3IEJ A;  3AI8 A;  3F75 A;  2FUD A;  3H8B A;  4QH6 A;  5FPW A;  2OP3 A;  3IUT A;  1ICF A;  3HHI A;  1HUC B;  5JH3 A;  1AU4 A;  1NB5 A;  2B1N A;  3RVX A;  1ZCM A;  2E01 A;  1CTE A;  1CV8 A;  3BOW A;  3E1Z B;  2AU1 A;  1YK8 A;  1AYU A;  4QRX A;  1EWL A;  5JA7 A;  2R6N A;  5EGW A;  1TLO A;  3HWN A;  1EF7 A;  2ACT A;  2P86 A;  3DF0 A;  2IPP B;  4CDC B;  2AUX A;  2HD5 A;  3NHE A;  1U9W A;  3N4C A;  4KLB A;  3K8U A;  3KWB X;  1STF E;  1Q6K A;  1GMY A;  4N79 A;  2YJ8 A;  1PBH A;  3PW3 A;  2YJC A;  4BS6 A;  5CVM A;  3C9E A;  3O1G A;  2OUL A;  2E03 A;  3GCB A;  1MEM A;  2AYN A;  4X6H A;  3I06 A;  1BQI A;  2H7J A;  4PP1 A;  1PPD A;  2R9N A;  3ERV A;  3HHA A;  3HD3 A;  1CS8 A;  3BCN A;  1PE6 A;  3ZUA A;  2JQF R;  4W5B A;  3WXG A;  3KWZ A;  1DEU A;  1KFU L;  1MHW A;  2NQA A;  4YYV A;  2HH5 A;  2HXZ A;  3H8C A;  1CSB B;  5CHV A;  1AU0 A;  1NLJ A;  3P5X A;  2IBI A;  2XU1 A;  1BY8 A;  1F2C A;  1KHP A;  3H89 A;  2AUZ A;  4YYQ A;  2R9M A;  1TU6 A;  2R9C A;  3P5U A;  3P5W A;  3S3R A; 
#chains in the Genus database with same CATH topology
 2XU5 A;  4OVZ B;  2P0R A;  1POP A;  3KSE A;  3MHH A;  2DCB A;  2PNS A;  4XR7 A;  2Z84 A;  5EZS A;  4CDE B;  1PAD A;  2AS8 A;  4MZS A;  4RKX A;  1EWO A;  1ME3 A;  3BB7 A;  5EF4 A;  2BDZ A;  1U9Q X;  1AU3 A;  4PAD A;  3B79 A;  4I05 A;  1MDW A;  3P5V A;  1EWM A;  4OW0 A;  3K9M A;  4XUI A;  3O0U A;  1A6R A;  1Y08 A;  1X9Y A;  1PPO A;  3BPM A;  4I07 A;  5KO3 A;  4BQV A;  1GCB A;  1NQC A;  2YJB A;  4BOQ A;  2FTD A;  2NQG A;  4BOZ A;  4BOU A;  1VJV A;  1PPP A;  3KFQ A;  4K7C A;  4BS5 A;  1ME4 A;  2C0Y A;  4Q8H A;  4AXL A;  1QXP A;  1PIP A;  1SNK A;  3PHU A;  4DMX A;  2AYO A;  1DF0 A;  4CDF B;  4M0W A;  4A5U A;  2CB5 A;  4P16 A;  4WA6 A;  1CB5 A;  2DC7 A;  1PVJ A;  2FT2 A;  1AYW A;  4DMY A;  2PBH A;  3RVW A;  2O6X A;  1K3B B;  5CVN B;  3TNX A;  2F7D A;  4D8E A;  2ARY A;  3H7D A;  3N3G A;  4RY2 A;  4QRG A;  3KKU A;  4QRV A;  2G8J A;  1QMY A;  3QT4 A;  1MIR A;  2GFO A;  1YVB A;  1NPZ A;  2Y5B A;  4D8B A;  3OIS A;  2BTW B;  1CJL A;  3RVV A;  5A24 A;  3PSE A;  1EWP A;  1KFX L;  1U9X A;  3IOQ A;  4BOP A;  1ITO A;  1Y4H A;  1TL9 A;  1CVZ A;  2G6D A;  4MSX A;  1YT7 A;  1DKI A;  4I04 A;  2VHF A;  2VHS A;  3CH3 X;  3OF9 A;  3QJ3 A;  1SP4 B;  4PT5 A;  3F5V A;  1AIM A;  3MP2 A;  1BP4 A;  2FE8 A;  2UZJ A;  3KW9 A;  2DC9 A;  2DCD A;  3BWK A;  3WXF A;  4BSQ A;  2PRE A;  3E9S A;  4OEM A;  2XU4 A;  1AYV A;  2FYE A;  2JRI A;  5PAD A;  2J7Q C;  3LXS A;  4FIP A;  4REZ A;  1CPJ A;  1NB3 A;  2DZY A;  4W4U A;  3V6C A;  1PXV A;  1MS6 A;  4IP3 A;  2AGA A;  2DC8 A;  1MEG A;  3PNR A;  3D6S A;  4BOS A;  2PAD A;  4G54 A;  3H6S A;  4YYS A;  3WXE A;  2R9O A;  3MOR A;  2FQ9 A;  3I3T A;  4YV8 A;  3TMP A;  3PBH A;  3BC3 A;  2ATO A;  2BDL A;  2FRQ A;  1QOL A;  4QBB A;  3IV2 A;  2FO5 A;  1QDQ A;  4CDD B;  1NL6 A;  2R9F A;  3MJ5 A;  3OF8 A;  2Y6E A;  1PCI A;  4MM3 B;  2HWK A;  2DJF B;  4X6I A;  2JQG R;  3OVZ A;  3IHP A;  2J7Q A;  2YJ2 A;  1XKG A;  3CBJ A;  3PRM A;  1O0E A;  3MTV A;  1AU2 A;  7PCK A;  2DJG B;  9PAP A;  1F2B A;  2XU3 A;  3BBA A;  4FJC A;  2WBF X;  1M6D A;  3OQC A;  4XZX A;  3OVX A;  5JZE A;  1GEC E;  2DCA A;  2AVW A;  4X6J A;  3IMA A;  4HWY A;  1VSN A;  4P6E A;  3W30 A;  2NQI A;  2DCC A;  4R3D A;  5K16 A;  4RF0 A;  3BPF A;  2P7U A;  5CVO B;  4PI3 A;  4OVZ A;  3S3Q A;  1YK7 A;  8PCH A;  5F02 A;  3ZNH A;  2G8E A;  2G7Y A;  4N4Z A;  6PAD A;  5CHT A;  1AEC A;  1YAL A;  4MZO A;  3N3K A;  4RNA A;  4FK5 A;  2E02 A;  3M99 A;  2B1M A;  1U9V A;  4YYW A;  1U5I A;  3IFU A;  2AIM A;  3KX1 A;  1IWD A;  1FH0 A;  3QSD A;  2DC6 A;  1JQP A;  1GLO A;  2OZ2 A;  4AXM A;  2GHU A;  4Q8G A;  2DOS A;  1KXR A;  4W5C A;  4IUM A;  4N8W A;  2FRA A;  3PDF A;  1F29 A;  3USV A;  1ZIV A;  4GUA A;  5J94 A;  2F1G A;  4YYR A;  3LFY A;  1KHQ A;  3U8E A;  1ATK A;  1PPN A;  1S4V A;  3CH2 X;  2CIO A;  2DZZ A;  3MHS A;  2YJ9 A;  4OEL A;  4ZUX U;  2BU3 A;  1BGO A;  2NQD B;  4P6G A;  3K24 A;  2HHN A;  1CQD A;  3W31 A;  4PP2 E;  1F2A A;  1THE A;  4YYU A;  4CZW A;  2E00 A;  3CBK A;  3MTN A;  3V6E A;  4BPV A;  4YVA A;  3IEJ A;  3AI8 A;  3F75 A;  2FUD A;  3PT2 A;  3H8B A;  3PRP A;  4QH6 A;  5FPW A;  2OP3 A;  3IUT A;  1ICF A;  2BTW A;  3B21 A;  3HHI A;  1HUC B;  5JH3 A;  1AU4 A;  1NB5 A;  4MI7 A;  2B1N A;  3RVX A;  1ZCM A;  2E01 A;  1CTE A;  5E6J A;  1CV8 A;  3BOW A;  3E1Z B;  2AU1 A;  1YK8 A;  1AYU A;  4QRX A;  1EWL A;  5JA7 A;  2R6N A;  5EGW A;  1TLO A;  3HWN A;  1EF7 A;  2ACT A;  2P86 A;  3DF0 A;  2IPP B;  4CDC B;  2AUX A;  2HD5 A;  3NHE A;  1U9W A;  3N4C A;  4RF1 A;  4KLB A;  3K8U A;  3KWB X;  1STF E;  1Q6K A;  1UKF A;  1GMY A;  4N79 A;  2YJ8 A;  1PBH A;  3PW3 A;  2YJC A;  4BS6 A;  5CVM A;  3C9E A;  3O1G A;  3PHW A;  2OUL A;  3O65 A;  2E03 A;  3GCB A;  1MEM A;  5EZQ A;  3PHX A;  4HXD B;  2AYN A;  4X6H A;  3I06 A;  1BQI A;  2H7J A;  4PP1 A;  4WUR A;  1PPD A;  2R9N A;  3ERV A;  3HHA A;  3HD3 A;  1CS8 A;  1YZB A;  2JTC A;  3BCN A;  1PE6 A;  3BY4 A;  3ZUA A;  2JQF R;  4W5B A;  3WXG A;  3KWZ A;  1DEU A;  1KFU L;  1MHW A;  2NQA A;  4YYV A;  4D8I A;  2HH5 A;  2HXZ A;  3TRK A;  3H8C A;  1CSB B;  5CHV A;  1AU0 A;  1NLJ A;  3P5X A;  2IBI A;  2XU1 A;  4ZTB A;  1BY8 A;  1F2C A;  1KHP A;  3H89 A;  2AUZ A;  3RNV A;  4YYQ A;  2R9M A;  1TU6 A;  2R9C A;  3C0R A;  3P5U A;  3P5W A;  3S3R A; 
#chains in the Genus database with same CATH homology
 2XU5 A;  2P0R A;  1POP A;  3KSE A;  3MHH A;  2DCB A;  2PNS A;  4XR7 A;  4CDE B;  1PAD A;  2AS8 A;  4MZS A;  1EWO A;  1ME3 A;  5EF4 A;  2BDZ A;  1U9Q X;  1AU3 A;  4PAD A;  3B79 A;  4I05 A;  1MDW A;  3P5V A;  1EWM A;  3K9M A;  4XUI A;  3O0U A;  1A6R A;  1Y08 A;  1X9Y A;  1PPO A;  3BPM A;  4I07 A;  4BQV A;  1GCB A;  1NQC A;  2YJB A;  2FTD A;  2NQG A;  1VJV A;  1PPP A;  3KFQ A;  4K7C A;  4BS5 A;  1ME4 A;  2C0Y A;  4Q8H A;  4AXL A;  1QXP A;  1PIP A;  1SNK A;  4DMX A;  2AYO A;  1DF0 A;  4CDF B;  2CB5 A;  4WA6 A;  1CB5 A;  2DC7 A;  2FT2 A;  1AYW A;  4DMY A;  2PBH A;  3RVW A;  2O6X A;  4B55 A;  1K3B B;  5CVN B;  3TNX A;  2F7D A;  2ARY A;  3H7D A;  3N3G A;  4RY2 A;  4QRG A;  3KKU A;  4QRV A;  2G8J A;  1QMY A;  3QT4 A;  1MIR A;  2GFO A;  1YVB A;  1NPZ A;  2Y5B A;  3OIS A;  1CJL A;  3RVV A;  5A24 A;  1EWP A;  1KFX L;  1U9X A;  3IOQ A;  1ITO A;  1Y4H A;  1TL9 A;  4NV8 A;  1CVZ A;  2G6D A;  4MSX A;  3D9W A;  1YT7 A;  4I04 A;  4BGF A;  2VHF A;  2VHS A;  3CH3 X;  3OF9 A;  3QJ3 A;  1SP4 B;  3F5V A;  1AIM A;  1BP4 A;  3KW9 A;  2DC9 A;  2DCD A;  3BWK A;  3WXF A;  4BSQ A;  2PRE A;  4OEM A;  2XU4 A;  1AYV A;  2FYE A;  5PAD A;  3LXS A;  4FIP A;  1CPJ A;  1NB3 A;  2DZY A;  4W4U A;  3V6C A;  1PXV A;  4GUZ A;  1MS6 A;  2DC8 A;  1MEG A;  2BSZ A;  3PNR A;  3D6S A;  2PAD A;  4G54 A;  3H6S A;  4YYS A;  3WXE A;  2R9O A;  3MOR A;  2FQ9 A;  3I3T A;  4YV8 A;  3PBH A;  3BC3 A;  2ATO A;  3LTW A;  1W4T A;  2BDL A;  2FRQ A;  1QOL A;  4QBB A;  3IV2 A;  2FO5 A;  1QDQ A;  4CDD B;  1NL6 A;  2R9F A;  3OF8 A;  2Y6E A;  1PCI A;  2DJF B;  4X6I A;  2JQG R;  3OVZ A;  3IHP A;  2YJ2 A;  1XKG A;  3CBJ A;  1O0E A;  1AU2 A;  7PCK A;  2DJG B;  9PAP A;  1F2B A;  2XU3 A;  4FJC A;  2WBF X;  1M6D A;  1GX3 A;  1W6F A;  3OVX A;  1GEC E;  2DCA A;  2AVW A;  4X6J A;  4HWY A;  3IMA A;  1VSN A;  1W5R A;  4P6E A;  2NQI A;  2DCC A;  5K16 A;  3BPF A;  2P7U A;  5CVO B;  4PI3 A;  3S3Q A;  1YK7 A;  8PCH A;  5F02 A;  2G8E A;  2G7Y A;  4N4Z A;  6PAD A;  5CHT A;  1AEC A;  1YAL A;  4MZO A;  3N3K A;  4FK5 A;  2E02 A;  3M99 A;  2B1M A;  1U9V A;  4YYW A;  1U5I A;  2AIM A;  4NV7 A;  3KX1 A;  1IWD A;  1FH0 A;  3QSD A;  2DC6 A;  1JQP A;  1GLO A;  2OZ2 A;  4AXM A;  2GHU A;  4Q8G A;  1KXR A;  4W5C A;  4N8W A;  2FRA A;  3PDF A;  1F29 A;  3USV A;  1ZIV A;  5J94 A;  2F1G A;  4YYR A;  3LFY A;  1KHQ A;  3U8E A;  1ATK A;  1PPN A;  1S4V A;  3CH2 X;  2CIO A;  2DZZ A;  3MHS A;  2YJ9 A;  4OEL A;  4ZUX U;  1BGO A;  2NQD B;  4P6G A;  3K24 A;  2HHN A;  2VFC A;  1CQD A;  4PP2 E;  1F2A A;  1THE A;  4YYU A;  4CZW A;  2E00 A;  3CBK A;  3MTN A;  3V6E A;  4BPV A;  4YVA A;  3IEJ A;  3AI8 A;  3F75 A;  2FUD A;  4C5P A;  3H8B A;  4QH6 A;  5FPW A;  2OP3 A;  3IUT A;  1ICF A;  3HHI A;  1HUC B;  5JH3 A;  1AU4 A;  1NB5 A;  2B1N A;  3RVX A;  1ZCM A;  2E01 A;  1CTE A;  1CV8 A;  3BOW A;  3E1Z B;  2AU1 A;  1YK8 A;  1AYU A;  4QRX A;  1EWL A;  5JA7 A;  2R6N A;  5EGW A;  1TLO A;  3HWN A;  1EF7 A;  2ACT A;  2P86 A;  3DF0 A;  2IPP B;  4CDC B;  2AUX A;  2HD5 A;  3NHE A;  1U9W A;  3N4C A;  4KLB A;  3K8U A;  3KWB X;  1STF E;  1Q6K A;  1GMY A;  4N79 A;  2YJ8 A;  1PBH A;  3PW3 A;  2YJC A;  4BS6 A;  5CVM A;  3C9E A;  3O1G A;  2OUL A;  2E03 A;  3GCB A;  1MEM A;  2AYN A;  4X6H A;  3I06 A;  1E2T A;  1BQI A;  2H7J A;  4PP1 A;  1PPD A;  2R9N A;  3ERV A;  3HHA A;  3HD3 A;  1CS8 A;  3BCN A;  1PE6 A;  3ZUA A;  2JQF R;  4W5B A;  3WXG A;  3KWZ A;  1DEU A;  1KFU L;  1MHW A;  2NQA A;  4YYV A;  2HH5 A;  2HXZ A;  3H8C A;  1CSB B;  5CHV A;  1AU0 A;  3P5X A;  1NLJ A;  2IBI A;  2XU1 A;  1BY8 A;  1F2C A;  1KHP A;  3H89 A;  2AUZ A;  4YYQ A;  2VFB A;  2R9M A;  1TU6 A;  2R9C A;  3P5U A;  3P5W A;  3S3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...