2DCCA

X-ray crystal structure analysis of bovine spleen cathepsin b-ca077 complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
253
structure length
251
Chain Sequence
LPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN B
publication title Quantitative estimation of each active subsite of cathepsin B for the inhibitory activity, based on the inhibitory activitybinding mode relationship of a series of epoxysuccinyl inhibitors by X-ray crystal structure analyses of the complexes
rcsb
molecule tags Hydrolase
total genus 75
structure length 251
sequence length 253
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2dccA00
4BS5A 4YYUA 1F2CA 1F2AA 3ZUAA 2DCDA 2R9NA 1PADA 4CDDB 3H8BA 4QRGA 1AIMA 1QXPA 1VJVA 2H7JA 1THEA 2JQGR 4QRVA 1PPOA 1DEUA 2E00A 3TNXA 5CHTA 2XU1A 2DCCA 1YK7A 4N79A 3IMAA 3IOQA 1EF7A 1MDWA 1PPPA 1U9VA 3WXEA 2IPPB 4WA6A 5EF4A 4DMYA 1U9WA 4ZUXU 3BPFA 5CVNB 2FT2A 4MSXA 1PXVA 3KX1A 3P5UA 2YJ2A 2HH5A 4OELA 1VSNA 3KWBX 2BDLA 5JA7A 5JH3A 3MTNA 1BY8A 1Y4HA 1STFE 1A6RA 3MORA 1K3BB 1CB5A 1GCBA 3HHIA 4W5CA 1PCIA 2GFOA 1AYVA 1KFXL 3OF8A 4YYRA 3K9MA 2GHUA 4FJCA 4XR7A 3AI8A 2E03A 2B1MA 1IWDA 1CPJA 2XU5A 3P5XA 1YALA 2DZZA 2VHSA 1PBHA 3BC3A 3C9EA 1ZCMA 4BQVA 4I07A 5K16A 1KHPA 4I05A 1CV8A 1NB5A 2BDZA 3OVZA 2OZ2A 3GCBA 1AU0A 3OISA 2R9OA 2DZYA 1F2BA 4RY2A 3H7DA 1ICFA 3I3TA 4XUIA 2F7DA 2XU4A 3USVA 2ARYA 3ERVA 4Q8HA 2DCAA 1MS6A 1CVZA 3RVXA 2VHFA 1TLOA 4CDEB 1HUCB 1AYWA 2HD5A 2HXZA 2P86A 3F5VA 3P5VA 3S3QA 2NQDB 2WBFX 2P7UA 4AXLA 4P6GA 4YYWA 1U9XA 2E01A 2PADA 1CS8A 3PW3A 1BQIA 2FRAA 1O0EA 2YJ9A 3CH2X 1ZIVA 4N8WA 1BP4A 4X6HA 2FTDA 3N3GA 4QRXA 1NL6A 4OEMA 2Y5BA 2AYOA 2YJ8A 1CSBB 2FO5A 3CBJA 2G8JA 4YYQA 3CBKA 1NLJA 4N4ZA 2FRQA 1JQPA 4AXMA 4YYVA 3K8UA 3F75A 3I06A 3IEJA 4W4UA 1YT7A 3WXGA 3KKUA 1YK8A 3IUTA 4BS6A 1AU2A 1GLOA 3HD3A 1U9QX 2R9CA 2C0YA 1YVBA 1M6DA 2G8EA 1F29A 1GECE 1TU6A 3M99A 3QJ3A 1QOLA 1ME4A 3S3RA 1EWOA 3O0UA 1KFUL 3V6EA 2AYNA 1KXRA 1ME3A 4I04A 2XU3A 2DC8A 2Y6EA 2PNSA 5CVMA 1MEMA 4CZWA 4FK5A 1ITOA 2JQFR 4PP1A 3DF0A 3LFYA 2AS8A 2R9FA 3KSEA 4CDCB 1NQCA 8PCHA 1Q6KA 3NHEA 3PBHA 2DC9A 1BGOA 1EWPA 1ATKA 4P6EA 2CIOA 1CTEA 3LXSA 1AU3A 1FH0A 3OVXA 2DJGB 4CDFB 3BWKA 1DF0A 4PADA 4PI3A 1NB3A 1PIPA 3RVWA 3WXFA 4BPVA 3QSDA 3P5WA 3H8CA 4YV8A 2O6XA 1CJLA 3PDFA 2PBHA 1AYUA 1XKGA 1TL9A 5J94A 2YJBA 1MEGA 3K24A 2PREA 2NQAA 4G54A 2FYEA 3IHPA 1QDQA 2OULA 4YYSA 3H6SA 4K7CA 4BSQA 1PE6A 2YJCA 5CVOB 4QBBA 3V6CA 2AIMA 1S4VA 1Y08A 3BOWA 3MHHA 2AUXA 3IV2A 4W5BA 3QT4A 3PNRA 4FIPA 2B1NA 6PADA 5F02A 2NQGA 2ACTA 3BCNA 3KFQA 1PPNA 3N4CA 2FUDA 2DC6A 2R6NA 1EWMA 1AU4A 1NPZA 3N3KA 1QMYA 3HWNA 3B79A 5CHVA 3OF9A 4QH6A 4DMXA 2IBIA 1EWLA 1X9YA 1GMYA 1PPDA 1SNKA 2HHNA 2AVWA 5EGWA 4Q8GA 2AUZA 2DJFB 2E02A 2DC7A 4X6IA 2CB5A 5FPWA 2DCBA 3BPMA 1MHWA 3MHSA 2R9MA 1SP4B 3HHAA 7PCKA 4HWYA 2F1GA 3KWZA 2FQ9A 1POPA 3E1ZB 4YVAA 1MIRA 2G6DA 3KW9A 4PP2E 1CQDA 5PADA 2OP3A 2ATOA 1AECA 4MZOA 3RVVA 3CH3X 1U5IA 3D6SA 5A24A 2NQIA 3U8EA 2AU1A 3H89A 9PAPA 4X6JA 2P0RA 4KLBA 1KHQA 2G7YA 4MZSA 3O1GA
chains in the Genus database with same CATH superfamily
4BS5A 4YYUA 1F2CA 2AGAA 1F2AA 4RF0A 3ZUAA 2DCDA 2R9NA 1PADA 4CDDB 3H8BA 4QRGA 1AIMA 4IP3A 1QXPA 1VJVA 2H7JA 1THEA 2JQGR 4QRVA 1PPOA 1DEUA 2E00A 3TNXA 5CHTA 2XU1A 2DCCA 1YK7A 4N79A 3IMAA 3IOQA 1EF7A 1MDWA 1PPPA 1U9VA 3WXEA 2IPPB 4WA6A 3B21A 5EF4A 4DMYA 1U9WA 4ZUXU 3BPFA 4BOSA 5CVNB 2FT2A 3PHXA 4MSXA 4OVZA 2HWKA 1PXVA 3KX1A 3P5UA 2YJ2A 2HH5A 4OELA 1VSNA 3KWBX 2BDLA 5JA7A 4D8IA 5JH3A 3MTNA 1BY8A 4BOPA 3W31A 1Y4HA 1STFE 1A6RA 5EZQA 3MORA 1K3BB 1CB5A 2JRIA 1GCBA 3HHIA 4W5CA 1PCIA 4PT5A 3PHUA 3MP2A 2GFOA 2BTWB 1AYVA 1KFXL 4BOUA 3OF8A 4YYRA 2J7QA 3K9MA 2GHUA 4FJCA 3BB7A 4XR7A 3AI8A 2E03A 2B1MA 1IWDA 4WURA 1CPJA 2XU5A 3P5XA 1YALA 2DZZA 4RNAA 2J7QC 2VHSA 1PBHA 1DKIA 3BC3A 3C9EA 1ZCMA 4BQVA 4I07A 5K16A 1KHPA 4I05A 1CV8A 1NB5A 2BDZA 3OVZA 4ZTBA 2OZ2A 3GCBA 1AU0A 3OISA 4A5UA 2R9OA 2DZYA 1F2BA 2UZJA 4RY2A 3H7DA 1ICFA 3I3TA 3O65A 4XUIA 2F7DA 2XU4A 3USVA 2ARYA 3ERVA 4HXDB 4Q8HA 2DCAA 1MS6A 1CVZA 3RVXA 2VHFA 1TLOA 4CDEB 1HUCB 1AYWA 2HD5A 2Z84A 2BTWA 2HXZA 2P86A 3F5VA 3P5VA 3S3QA 1YZBA 2NQDB 2WBFX 3PT2A 2P7UA 4AXLA 4P6GA 4YYWA 1U9XA 2E01A 2PADA 1CS8A 3PW3A 1BQIA 2FRAA 1O0EA 1PVJA 2YJ9A 3CH2X 1ZIVA 4N8WA 1BP4A 4X6HA 2FTDA 3N3GA 4REZA 4QRXA 1NL6A 4GUAA 4R3DA 3IFUA 4OEMA 2Y5BA 2AYOA 2YJ8A 1CSBB 2FO5A 3CBJA 2G8JA 4YYQA 3CBKA 1NLJA 4N4ZA 2FRQA 1JQPA 4AXMA 3BBAA 4YYVA 3K8UA 3C0RA 4XZXA 3F75A 3MTVA 3I06A 3IEJA 4W4UA 1YT7A 3WXGA 3KKUA 1YK8A 3E9SA 4MI7A 3IUTA 4BS6A 1AU2A 2JTCA 1GLOA 3HD3A 1UKFA 5JZEA 1U9QX 2R9CA 2C0YA 1YVBA 1M6DA 2G8EA 1F29A 1GECE 1TU6A 3M99A 3QJ3A 1QOLA 2FE8A 1ME4A 3S3RA 1EWOA 3O0UA 1KFUL 3V6EA 2AYNA 1KXRA 1ME3A 4I04A 2XU3A 2DC8A 2Y6EA 2PNSA 5CVMA 5E6JA 1MEMA 4CZWA 4FK5A 1ITOA 2JQFR 4PP1A 3DF0A 3LFYA 2AS8A 2R9FA 3KSEA 4CDCB 1NQCA 8PCHA 1Q6KA 3NHEA 3PBHA 2DC9A 3PSEA 1BGOA 1EWPA 1ATKA 4P6EA 2CIOA 1CTEA 3LXSA 1AU3A 1FH0A 3OVXA 4BOZA 2DJGB 4CDFB 5KO3A 3BWKA 1DF0A 4PADA 4RKXA 4PI3A 1NB3A 1PIPA 3RVWA 4M0WA 2BU3A 3WXFA 4BPVA 3QSDA 3P5WA 3H8CA 4YV8A 2O6XA 1CJLA 3PDFA 3TMPA 2PBHA 1AYUA 1XKGA 1TL9A 5J94A 2YJBA 1MEGA 3K24A 2PREA 2NQAA 4G54A 3BY4A 2FYEA 3IHPA 4IUMA 1QDQA 2OULA 5EZSA 4YYSA 3H6SA 4K7CA 4BSQA 1PE6A 2YJCA 5CVOB 4QBBA 3V6CA 2AIMA 4D8EA 1S4VA 1Y08A 3BOWA 3W30A 3MHHA 2AUXA 3IV2A 4W5BA 3QT4A 2DOSA 3PNRA 4FIPA 2B1NA 6PADA 5F02A 2NQGA 2ACTA 3BCNA 3KFQA 1PPNA 3N4CA 2FUDA 2DC6A 2R6NA 1EWMA 3RNVA 1AU4A 4MM3B 1NPZA 3N3KA 1QMYA 3HWNA 3B79A 3TRKA 5CHVA 4BOQA 3OF9A 3PRPA 4QH6A 4DMXA 2IBIA 1EWLA 1X9YA 1GMYA 1PPDA 1SNKA 2HHNA 4OW0A 3MJ5A 2AVWA 5EGWA 4Q8GA 2AUZA 2DJFB 2E02A 3PHWA 2DC7A 4X6IA 2CB5A 3PRMA 5FPWA 2DCBA 3BPMA 1MHWA 3MHSA 2R9MA 1SP4B 3HHAA 7PCKA 4HWYA 2F1GA 3KWZA 2FQ9A 1POPA 3E1ZB 4YVAA 3OQCA 1MIRA 2G6DA 3KW9A 4D8BA 4PP2E 4P16A 1CQDA 5PADA 3ZNHA 4OVZB 2OP3A 2ATOA 4RF1A 1AECA 4MZOA 3RVVA 3CH3X 1U5IA 3D6SA 5A24A 2NQIA 3U8EA 2AU1A 3H89A 9PAPA 4X6JA 2P0RA 4KLBA 1KHQA 2G7YA 4MZSA 3O1GA
chains in the Genus database with same CATH topology
4BS5A 4YYUA 1F2CA 1F2AA 3ZUAA 2DCDA 2R9NA 1PADA 4CDDB 3H8BA 4QRGA 1AIMA 1QXPA 1VJVA 2H7JA 1THEA 4NV8A 2JQGR 4QRVA 1DEUA 1PPOA 2E00A 3TNXA 5CHTA 2XU1A 2DCCA 1GX3A 1YK7A 4N79A 3IMAA 3IOQA 1EF7A 1MDWA 1PPPA 1U9VA 3WXEA 2IPPB 4WA6A 2VFBA 5EF4A 4DMYA 1U9WA 4ZUXU 3BPFA 4BGFA 4NV7A 5CVNB 2FT2A 4MSXA 1PXVA 3KX1A 3P5UA 2YJ2A 2HH5A 4OELA 1VSNA 3KWBX 2BDLA 5JA7A 5JH3A 3MTNA 1BY8A 1Y4HA 1STFE 1A6RA 3MORA 1K3BB 1CB5A 1W4TA 1GCBA 3HHIA 4W5CA 1PCIA 2GFOA 4GUZA 1AYVA 1KFXL 3OF8A 4YYRA 3K9MA 2GHUA 4FJCA 4XR7A 3AI8A 2E03A 2B1MA 1IWDA 1CPJA 2XU5A 3P5XA 1YALA 2DZZA 2VHSA 1PBHA 4B55A 3BC3A 3C9EA 1ZCMA 4BQVA 4I07A 5K16A 1KHPA 4I05A 1CV8A 1NB5A 2BDZA 3OVZA 2OZ2A 3GCBA 1AU0A 3OISA 2R9OA 2DZYA 1F2BA 4RY2A 3H7DA 1ICFA 3I3TA 4XUIA 2F7DA 2XU4A 3USVA 2ARYA 3ERVA 4Q8HA 2DCAA 1MS6A 1CVZA 3RVXA 2VHFA 1TLOA 4CDEB 1HUCB 1AYWA 2HD5A 2HXZA 2P86A 3F5VA 3P5VA 3S3QA 2NQDB 2WBFX 2P7UA 4AXLA 4P6GA 4YYWA 1U9XA 2E01A 2PADA 1CS8A 3PW3A 1BQIA 2FRAA 1O0EA 2YJ9A 3CH2X 1ZIVA 4N8WA 1BP4A 4X6HA 2FTDA 3N3GA 4QRXA 1NL6A 4OEMA 2Y5BA 2AYOA 2YJ8A 1CSBB 2FO5A 3CBJA 2G8JA 4YYQA 3CBKA 1NLJA 1W6FA 2FRQA 4N4ZA 1JQPA 4AXMA 4YYVA 3K8UA 3F75A 3I06A 3IEJA 4W4UA 1YT7A 3WXGA 3KKUA 1YK8A 3IUTA 4BS6A 1AU2A 1GLOA 3HD3A 1U9QX 2R9CA 2C0YA 1YVBA 1M6DA 2G8EA 1F29A 1GECE 1TU6A 3M99A 3QJ3A 1QOLA 1ME4A 3S3RA 1EWOA 3O0UA 1KFUL 3V6EA 2AYNA 1KXRA 1ME3A 4I04A 2XU3A 2VFCA 2DC8A 2Y6EA 2PNSA 5CVMA 1MEMA 4CZWA 4FK5A 1ITOA 2JQFR 4PP1A 3DF0A 3LFYA 2AS8A 2R9FA 3KSEA 4CDCB 1NQCA 8PCHA 1Q6KA 3NHEA 3PBHA 2DC9A 1BGOA 1EWPA 1ATKA 4P6EA 2CIOA 1CTEA 3LXSA 1AU3A 1FH0A 2BSZA 1E2TA 3OVXA 2DJGB 4CDFB 3BWKA 1DF0A 4PADA 4PI3A 1NB3A 1PIPA 3RVWA 3WXFA 4BPVA 3QSDA 3P5WA 3H8CA 4YV8A 2O6XA 1CJLA 3PDFA 2PBHA 1AYUA 1XKGA 1TL9A 5J94A 2YJBA 1MEGA 3K24A 2PREA 2NQAA 4G54A 3D9WA 2FYEA 3IHPA 1QDQA 2OULA 4YYSA 3H6SA 4K7CA 4BSQA 1PE6A 2YJCA 5CVOB 4QBBA 3V6CA 2AIMA 1S4VA 1Y08A 3BOWA 3MHHA 2AUXA 3IV2A 4W5BA 3QT4A 3PNRA 4FIPA 2B1NA 6PADA 5F02A 2NQGA 2ACTA 3BCNA 3KFQA 1PPNA 3N4CA 2FUDA 2DC6A 2R6NA 1EWMA 1AU4A 1NPZA 3N3KA 1QMYA 3HWNA 3B79A 5CHVA 3OF9A 4QH6A 1W5RA 4DMXA 2IBIA 1EWLA 1X9YA 1GMYA 1PPDA 1SNKA 2HHNA 2AVWA 5EGWA 4Q8GA 2AUZA 2DJFB 2E02A 2DC7A 4X6IA 2CB5A 5FPWA 2DCBA 3BPMA 1MHWA 3LTWA 3MHSA 2R9MA 1SP4B 3HHAA 7PCKA 4HWYA 2F1GA 3KWZA 2FQ9A 1POPA 3E1ZB 4YVAA 1MIRA 2G6DA 3KW9A 4PP2E 1CQDA 5PADA 2OP3A 2ATOA 1AECA 4MZOA 3RVVA 3CH3X 1U5IA 4C5PA 3D6SA 5A24A 2NQIA 3U8EA 2AU1A 3H89A 9PAPA 4X6JA 2P0RA 4KLBA 1KHQA 2G7YA 4MZSA 3O1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BS5 A;  4YYU A;  1F2C A;  1F2A A;  3ZUA A;  2DCD A;  2R9N A;  1PAD A;  4CDD B;  3H8B A;  4QRG A;  1AIM A;  1QXP A;  1VJV A;  2H7J A;  1THE A;  2JQG R;  4QRV A;  1PPO A;  1DEU A;  2E00 A;  3TNX A;  5CHT A;  2XU1 A;  2DCC A;  1YK7 A;  4N79 A;  3IMA A;  3IOQ A;  1EF7 A;  1MDW A;  1PPP A;  1U9V A;  3WXE A;  2IPP B;  4WA6 A;  5EF4 A;  4DMY A;  1U9W A;  4ZUX U;  3BPF A;  5CVN B;  2FT2 A;  4MSX A;  1PXV A;  3KX1 A;  3P5U A;  2YJ2 A;  2HH5 A;  4OEL A;  1VSN A;  3KWB X;  2BDL A;  5JA7 A;  5JH3 A;  3MTN A;  1BY8 A;  1Y4H A;  1STF E;  1A6R A;  3MOR A;  1K3B B;  1CB5 A;  1GCB A;  3HHI A;  4W5C A;  1PCI A;  2GFO A;  1AYV A;  1KFX L;  3OF8 A;  4YYR A;  3K9M A;  2GHU A;  4FJC A;  4XR7 A;  3AI8 A;  2E03 A;  2B1M A;  1IWD A;  1CPJ A;  2XU5 A;  3P5X A;  1YAL A;  2DZZ A;  2VHS A;  1PBH A;  3BC3 A;  3C9E A;  1ZCM A;  4BQV A;  4I07 A;  5K16 A;  1KHP A;  4I05 A;  1CV8 A;  1NB5 A;  2BDZ A;  3OVZ A;  2OZ2 A;  3GCB A;  1AU0 A;  3OIS A;  2R9O A;  2DZY A;  1F2B A;  4RY2 A;  3H7D A;  1ICF A;  3I3T A;  4XUI A;  2F7D A;  2XU4 A;  3USV A;  2ARY A;  3ERV A;  4Q8H A;  2DCA A;  1MS6 A;  1CVZ A;  3RVX A;  2VHF A;  1TLO A;  4CDE B;  1HUC B;  1AYW A;  2HD5 A;  2HXZ A;  2P86 A;  3F5V A;  3P5V A;  3S3Q A;  2NQD B;  2WBF X;  2P7U A;  4AXL A;  4P6G A;  4YYW A;  1U9X A;  2E01 A;  2PAD A;  1CS8 A;  3PW3 A;  1BQI A;  2FRA A;  1O0E A;  2YJ9 A;  3CH2 X;  1ZIV A;  4N8W A;  1BP4 A;  4X6H A;  2FTD A;  3N3G A;  4QRX A;  1NL6 A;  4OEM A;  2Y5B A;  2AYO A;  2YJ8 A;  1CSB B;  2FO5 A;  3CBJ A;  2G8J A;  4YYQ A;  3CBK A;  1NLJ A;  4N4Z A;  2FRQ A;  1JQP A;  4AXM A;  4YYV A;  3K8U A;  3F75 A;  3I06 A;  3IEJ A;  4W4U A;  1YT7 A;  3WXG A;  3KKU A;  1YK8 A;  3IUT A;  4BS6 A;  1AU2 A;  1GLO A;  3HD3 A;  1U9Q X;  2R9C A;  2C0Y A;  1YVB A;  1M6D A;  2G8E A;  1F29 A;  1GEC E;  1TU6 A;  3M99 A;  3QJ3 A;  1QOL A;  1ME4 A;  3S3R A;  1EWO A;  3O0U A;  1KFU L;  3V6E A;  2AYN A;  1KXR A;  1ME3 A;  4I04 A;  2XU3 A;  2DC8 A;  2Y6E A;  2PNS A;  5CVM A;  1MEM A;  4CZW A;  4FK5 A;  1ITO A;  2JQF R;  4PP1 A;  3DF0 A;  3LFY A;  2AS8 A;  2R9F A;  3KSE A;  4CDC B;  1NQC A;  8PCH A;  1Q6K A;  3NHE A;  3PBH A;  2DC9 A;  1BGO A;  1EWP A;  1ATK A;  4P6E A;  2CIO A;  1CTE A;  3LXS A;  1AU3 A;  1FH0 A;  3OVX A;  2DJG B;  4CDF B;  3BWK A;  1DF0 A;  4PAD A;  4PI3 A;  1NB3 A;  1PIP A;  3RVW A;  3WXF A;  4BPV A;  3QSD A;  3P5W A;  3H8C A;  4YV8 A;  2O6X A;  1CJL A;  3PDF A;  2PBH A;  1AYU A;  1XKG A;  1TL9 A;  5J94 A;  2YJB A;  1MEG A;  3K24 A;  2PRE A;  2NQA A;  4G54 A;  2FYE A;  3IHP A;  1QDQ A;  2OUL A;  4YYS A;  3H6S A;  4K7C A;  4BSQ A;  1PE6 A;  2YJC A;  5CVO B;  4QBB A;  3V6C A;  2AIM A;  1S4V A;  1Y08 A;  3BOW A;  3MHH A;  2AUX A;  3IV2 A;  4W5B A;  3QT4 A;  3PNR A;  4FIP A;  2B1N A;  6PAD A;  5F02 A;  2NQG A;  2ACT A;  3BCN A;  3KFQ A;  1PPN A;  3N4C A;  2FUD A;  2DC6 A;  2R6N A;  1EWM A;  1AU4 A;  1NPZ A;  3N3K A;  1QMY A;  3HWN A;  3B79 A;  5CHV A;  3OF9 A;  4QH6 A;  4DMX A;  2IBI A;  1EWL A;  1X9Y A;  1GMY A;  1PPD A;  1SNK A;  2HHN A;  2AVW A;  5EGW A;  4Q8G A;  2AUZ A;  2DJF B;  2E02 A;  2DC7 A;  4X6I A;  2CB5 A;  5FPW A;  2DCB A;  3BPM A;  1MHW A;  3MHS A;  2R9M A;  1SP4 B;  3HHA A;  7PCK A;  4HWY A;  2F1G A;  3KWZ A;  2FQ9 A;  1POP A;  3E1Z B;  4YVA A;  1MIR A;  2G6D A;  3KW9 A;  4PP2 E;  1CQD A;  5PAD A;  2OP3 A;  2ATO A;  1AEC A;  4MZO A;  3RVV A;  3CH3 X;  1U5I A;  3D6S A;  5A24 A;  2NQI A;  3U8E A;  2AU1 A;  3H89 A;  9PAP A;  4X6J A;  2P0R A;  4KLB A;  1KHQ A;  2G7Y A;  4MZS A;  3O1G A; 
#chains in the Genus database with same CATH topology
 4BS5 A;  4YYU A;  1F2C A;  2AGA A;  1F2A A;  4RF0 A;  3ZUA A;  2DCD A;  2R9N A;  1PAD A;  4CDD B;  3H8B A;  4QRG A;  1AIM A;  4IP3 A;  1QXP A;  1VJV A;  2H7J A;  1THE A;  2JQG R;  4QRV A;  1PPO A;  1DEU A;  2E00 A;  3TNX A;  5CHT A;  2XU1 A;  2DCC A;  1YK7 A;  4N79 A;  3IMA A;  3IOQ A;  1EF7 A;  1MDW A;  1PPP A;  1U9V A;  3WXE A;  2IPP B;  4WA6 A;  3B21 A;  5EF4 A;  4DMY A;  1U9W A;  4ZUX U;  3BPF A;  4BOS A;  5CVN B;  2FT2 A;  3PHX A;  4MSX A;  4OVZ A;  2HWK A;  1PXV A;  3KX1 A;  3P5U A;  2YJ2 A;  2HH5 A;  4OEL A;  1VSN A;  3KWB X;  2BDL A;  5JA7 A;  4D8I A;  5JH3 A;  3MTN A;  1BY8 A;  4BOP A;  3W31 A;  1Y4H A;  1STF E;  1A6R A;  5EZQ A;  3MOR A;  1K3B B;  1CB5 A;  2JRI A;  1GCB A;  3HHI A;  4W5C A;  1PCI A;  4PT5 A;  3PHU A;  3MP2 A;  2GFO A;  2BTW B;  1AYV A;  1KFX L;  4BOU A;  3OF8 A;  4YYR A;  2J7Q A;  3K9M A;  2GHU A;  4FJC A;  3BB7 A;  4XR7 A;  3AI8 A;  2E03 A;  2B1M A;  1IWD A;  4WUR A;  1CPJ A;  2XU5 A;  3P5X A;  1YAL A;  2DZZ A;  4RNA A;  2J7Q C;  2VHS A;  1PBH A;  1DKI A;  3BC3 A;  3C9E A;  1ZCM A;  4BQV A;  4I07 A;  5K16 A;  1KHP A;  4I05 A;  1CV8 A;  1NB5 A;  2BDZ A;  3OVZ A;  4ZTB A;  2OZ2 A;  3GCB A;  1AU0 A;  3OIS A;  4A5U A;  2R9O A;  2DZY A;  1F2B A;  2UZJ A;  4RY2 A;  3H7D A;  1ICF A;  3I3T A;  3O65 A;  4XUI A;  2F7D A;  2XU4 A;  3USV A;  2ARY A;  3ERV A;  4HXD B;  4Q8H A;  2DCA A;  1MS6 A;  1CVZ A;  3RVX A;  2VHF A;  1TLO A;  4CDE B;  1HUC B;  1AYW A;  2HD5 A;  2Z84 A;  2BTW A;  2HXZ A;  2P86 A;  3F5V A;  3P5V A;  3S3Q A;  1YZB A;  2NQD B;  2WBF X;  3PT2 A;  2P7U A;  4AXL A;  4P6G A;  4YYW A;  1U9X A;  2E01 A;  2PAD A;  1CS8 A;  3PW3 A;  1BQI A;  2FRA A;  1O0E A;  1PVJ A;  2YJ9 A;  3CH2 X;  1ZIV A;  4N8W A;  1BP4 A;  4X6H A;  2FTD A;  3N3G A;  4REZ A;  4QRX A;  1NL6 A;  4GUA A;  4R3D A;  3IFU A;  4OEM A;  2Y5B A;  2AYO A;  2YJ8 A;  1CSB B;  2FO5 A;  3CBJ A;  2G8J A;  4YYQ A;  3CBK A;  1NLJ A;  4N4Z A;  2FRQ A;  1JQP A;  4AXM A;  3BBA A;  4YYV A;  3K8U A;  3C0R A;  4XZX A;  3F75 A;  3MTV A;  3I06 A;  3IEJ A;  4W4U A;  1YT7 A;  3WXG A;  3KKU A;  1YK8 A;  3E9S A;  4MI7 A;  3IUT A;  4BS6 A;  1AU2 A;  2JTC A;  1GLO A;  3HD3 A;  1UKF A;  5JZE A;  1U9Q X;  2R9C A;  2C0Y A;  1YVB A;  1M6D A;  2G8E A;  1F29 A;  1GEC E;  1TU6 A;  3M99 A;  3QJ3 A;  1QOL A;  2FE8 A;  1ME4 A;  3S3R A;  1EWO A;  3O0U A;  1KFU L;  3V6E A;  2AYN A;  1KXR A;  1ME3 A;  4I04 A;  2XU3 A;  2DC8 A;  2Y6E A;  2PNS A;  5CVM A;  5E6J A;  1MEM A;  4CZW A;  4FK5 A;  1ITO A;  2JQF R;  4PP1 A;  3DF0 A;  3LFY A;  2AS8 A;  2R9F A;  3KSE A;  4CDC B;  1NQC A;  8PCH A;  1Q6K A;  3NHE A;  3PBH A;  2DC9 A;  3PSE A;  1BGO A;  1EWP A;  1ATK A;  4P6E A;  2CIO A;  1CTE A;  3LXS A;  1AU3 A;  1FH0 A;  3OVX A;  4BOZ A;  2DJG B;  4CDF B;  5KO3 A;  3BWK A;  1DF0 A;  4PAD A;  4RKX A;  4PI3 A;  1NB3 A;  1PIP A;  3RVW A;  4M0W A;  2BU3 A;  3WXF A;  4BPV A;  3QSD A;  3P5W A;  3H8C A;  4YV8 A;  2O6X A;  1CJL A;  3PDF A;  3TMP A;  2PBH A;  1AYU A;  1XKG A;  1TL9 A;  5J94 A;  2YJB A;  1MEG A;  3K24 A;  2PRE A;  2NQA A;  4G54 A;  3BY4 A;  2FYE A;  3IHP A;  4IUM A;  1QDQ A;  2OUL A;  5EZS A;  4YYS A;  3H6S A;  4K7C A;  4BSQ A;  1PE6 A;  2YJC A;  5CVO B;  4QBB A;  3V6C A;  2AIM A;  4D8E A;  1S4V A;  1Y08 A;  3BOW A;  3W30 A;  3MHH A;  2AUX A;  3IV2 A;  4W5B A;  3QT4 A;  2DOS A;  3PNR A;  4FIP A;  2B1N A;  6PAD A;  5F02 A;  2NQG A;  2ACT A;  3BCN A;  3KFQ A;  1PPN A;  3N4C A;  2FUD A;  2DC6 A;  2R6N A;  1EWM A;  3RNV A;  1AU4 A;  4MM3 B;  1NPZ A;  3N3K A;  1QMY A;  3HWN A;  3B79 A;  3TRK A;  5CHV A;  4BOQ A;  3OF9 A;  3PRP A;  4QH6 A;  4DMX A;  2IBI A;  1EWL A;  1X9Y A;  1GMY A;  1PPD A;  1SNK A;  2HHN A;  4OW0 A;  3MJ5 A;  2AVW A;  5EGW A;  4Q8G A;  2AUZ A;  2DJF B;  2E02 A;  3PHW A;  2DC7 A;  4X6I A;  2CB5 A;  3PRM A;  5FPW A;  2DCB A;  3BPM A;  1MHW A;  3MHS A;  2R9M A;  1SP4 B;  3HHA A;  7PCK A;  4HWY A;  2F1G A;  3KWZ A;  2FQ9 A;  1POP A;  3E1Z B;  4YVA A;  3OQC A;  1MIR A;  2G6D A;  3KW9 A;  4D8B A;  4PP2 E;  4P16 A;  1CQD A;  5PAD A;  3ZNH A;  4OVZ B;  2OP3 A;  2ATO A;  4RF1 A;  1AEC A;  4MZO A;  3RVV A;  3CH3 X;  1U5I A;  3D6S A;  5A24 A;  2NQI A;  3U8E A;  2AU1 A;  3H89 A;  9PAP A;  4X6J A;  2P0R A;  4KLB A;  1KHQ A;  2G7Y A;  4MZS A;  3O1G A; 
#chains in the Genus database with same CATH homology
 4BS5 A;  4YYU A;  1F2C A;  1F2A A;  3ZUA A;  2DCD A;  2R9N A;  1PAD A;  4CDD B;  3H8B A;  4QRG A;  1AIM A;  1QXP A;  1VJV A;  2H7J A;  1THE A;  4NV8 A;  2JQG R;  4QRV A;  1DEU A;  1PPO A;  2E00 A;  3TNX A;  5CHT A;  2XU1 A;  2DCC A;  1GX3 A;  1YK7 A;  4N79 A;  3IMA A;  3IOQ A;  1EF7 A;  1MDW A;  1PPP A;  1U9V A;  3WXE A;  2IPP B;  4WA6 A;  2VFB A;  5EF4 A;  4DMY A;  1U9W A;  4ZUX U;  3BPF A;  4BGF A;  4NV7 A;  5CVN B;  2FT2 A;  4MSX A;  1PXV A;  3KX1 A;  3P5U A;  2YJ2 A;  2HH5 A;  4OEL A;  1VSN A;  3KWB X;  2BDL A;  5JA7 A;  5JH3 A;  3MTN A;  1BY8 A;  1Y4H A;  1STF E;  1A6R A;  3MOR A;  1K3B B;  1CB5 A;  1W4T A;  1GCB A;  3HHI A;  4W5C A;  1PCI A;  2GFO A;  4GUZ A;  1AYV A;  1KFX L;  3OF8 A;  4YYR A;  3K9M A;  2GHU A;  4FJC A;  4XR7 A;  3AI8 A;  2E03 A;  2B1M A;  1IWD A;  1CPJ A;  2XU5 A;  3P5X A;  1YAL A;  2DZZ A;  2VHS A;  1PBH A;  4B55 A;  3BC3 A;  3C9E A;  1ZCM A;  4BQV A;  4I07 A;  5K16 A;  1KHP A;  4I05 A;  1CV8 A;  1NB5 A;  2BDZ A;  3OVZ A;  2OZ2 A;  3GCB A;  1AU0 A;  3OIS A;  2R9O A;  2DZY A;  1F2B A;  4RY2 A;  3H7D A;  1ICF A;  3I3T A;  4XUI A;  2F7D A;  2XU4 A;  3USV A;  2ARY A;  3ERV A;  4Q8H A;  2DCA A;  1MS6 A;  1CVZ A;  3RVX A;  2VHF A;  1TLO A;  4CDE B;  1HUC B;  1AYW A;  2HD5 A;  2HXZ A;  2P86 A;  3F5V A;  3P5V A;  3S3Q A;  2NQD B;  2WBF X;  2P7U A;  4AXL A;  4P6G A;  4YYW A;  1U9X A;  2E01 A;  2PAD A;  1CS8 A;  3PW3 A;  1BQI A;  2FRA A;  1O0E A;  2YJ9 A;  3CH2 X;  1ZIV A;  4N8W A;  1BP4 A;  4X6H A;  2FTD A;  3N3G A;  4QRX A;  1NL6 A;  4OEM A;  2Y5B A;  2AYO A;  2YJ8 A;  1CSB B;  2FO5 A;  3CBJ A;  2G8J A;  4YYQ A;  3CBK A;  1NLJ A;  1W6F A;  2FRQ A;  4N4Z A;  1JQP A;  4AXM A;  4YYV A;  3K8U A;  3F75 A;  3I06 A;  3IEJ A;  4W4U A;  1YT7 A;  3WXG A;  3KKU A;  1YK8 A;  3IUT A;  4BS6 A;  1AU2 A;  1GLO A;  3HD3 A;  1U9Q X;  2R9C A;  2C0Y A;  1YVB A;  1M6D A;  2G8E A;  1F29 A;  1GEC E;  1TU6 A;  3M99 A;  3QJ3 A;  1QOL A;  1ME4 A;  3S3R A;  1EWO A;  3O0U A;  1KFU L;  3V6E A;  2AYN A;  1KXR A;  1ME3 A;  4I04 A;  2XU3 A;  2VFC A;  2DC8 A;  2Y6E A;  2PNS A;  5CVM A;  1MEM A;  4CZW A;  4FK5 A;  1ITO A;  2JQF R;  4PP1 A;  3DF0 A;  3LFY A;  2AS8 A;  2R9F A;  3KSE A;  4CDC B;  1NQC A;  8PCH A;  1Q6K A;  3NHE A;  3PBH A;  2DC9 A;  1BGO A;  1EWP A;  1ATK A;  4P6E A;  2CIO A;  1CTE A;  3LXS A;  1AU3 A;  1FH0 A;  2BSZ A;  1E2T A;  3OVX A;  2DJG B;  4CDF B;  3BWK A;  1DF0 A;  4PAD A;  4PI3 A;  1NB3 A;  1PIP A;  3RVW A;  3WXF A;  4BPV A;  3QSD A;  3P5W A;  3H8C A;  4YV8 A;  2O6X A;  1CJL A;  3PDF A;  2PBH A;  1AYU A;  1XKG A;  1TL9 A;  5J94 A;  2YJB A;  1MEG A;  3K24 A;  2PRE A;  2NQA A;  4G54 A;  3D9W A;  2FYE A;  3IHP A;  1QDQ A;  2OUL A;  4YYS A;  3H6S A;  4K7C A;  4BSQ A;  1PE6 A;  2YJC A;  5CVO B;  4QBB A;  3V6C A;  2AIM A;  1S4V A;  1Y08 A;  3BOW A;  3MHH A;  2AUX A;  3IV2 A;  4W5B A;  3QT4 A;  3PNR A;  4FIP A;  2B1N A;  6PAD A;  5F02 A;  2NQG A;  2ACT A;  3BCN A;  3KFQ A;  1PPN A;  3N4C A;  2FUD A;  2DC6 A;  2R6N A;  1EWM A;  1AU4 A;  1NPZ A;  3N3K A;  1QMY A;  3HWN A;  3B79 A;  5CHV A;  3OF9 A;  4QH6 A;  1W5R A;  4DMX A;  2IBI A;  1EWL A;  1X9Y A;  1GMY A;  1PPD A;  1SNK A;  2HHN A;  2AVW A;  5EGW A;  4Q8G A;  2AUZ A;  2DJF B;  2E02 A;  2DC7 A;  4X6I A;  2CB5 A;  5FPW A;  2DCB A;  3BPM A;  1MHW A;  3LTW A;  3MHS A;  2R9M A;  1SP4 B;  3HHA A;  7PCK A;  4HWY A;  2F1G A;  3KWZ A;  2FQ9 A;  1POP A;  3E1Z B;  4YVA A;  1MIR A;  2G6D A;  3KW9 A;  4PP2 E;  1CQD A;  5PAD A;  2OP3 A;  2ATO A;  1AEC A;  4MZO A;  3RVV A;  3CH3 X;  1U5I A;  4C5P A;  3D6S A;  5A24 A;  2NQI A;  3U8E A;  2AU1 A;  3H89 A;  9PAP A;  4X6J A;  2P0R A;  4KLB A;  1KHQ A;  2G7Y A;  4MZS A;  3O1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...