3B79A

Crystal structure of the n-terminal peptidase c39 like domain of the toxin secretion atp-binding protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
AMKDPLLNSLIYVSRYYGLANSPEALVNGLPLSDGKLTPFLLPRAAERAGLVAKENRAELEKISSLILPAILVLKGGDSCVLNSINMETREAEVTTLESGMVPISIPLEDLLEQYTGRYFLVKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal peptidase C39 like domain of the toxin secretion ATP-binding protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Nucleotide binding protein
molecule keywords Toxin secretion ATP-binding protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3b79A00
2DC6A 3IV2A 3H7DA 1F2CA 1GMYA 3KWBX 3IEJA 3CH2X 1SNKA 2CIOA 2R9CA 4YV8A 3I3TA 1BGOA 4PP1A 2PREA 4BS5A 1CB5A 2CB5A 4W5CA 1CJLA 1KXRA 1YVBA 1CVZA 3PBHA 4QRXA 1AECA 3S3RA 4Q8HA 1NQCA 2AUZA 2HH5A 4FJCA 2VHFA 4FK5A 3S3QA 1PADA 1U5IA 1QDQA 2O6XA 4I05A 1U9VA 2DZZA 1PBHA 4X6JA 4P6EA 3LFYA 4W5BA 1PCIA 1U9WA 4YYWA 5K16A 3IMAA 3DF0A 1EWPA 1CS8A 1AIMA 1KHQA 3NHEA 1NB5A 3PDFA 2DCAA 2Y5BA 3PW3A 5EGWA 4DMYA 3IHPA 4XUIA 2P86A 9PAPA 2DCDA 4BQVA 4N79A 1AU3A 3CBKA 2FTDA 3P5WA 1XKGA 2DC9A 2XU1A 3HHIA 2GHUA 3ZUAA 3OVZA 3OF8A 2F1GA 1MIRA 1YALA 1MEMA 1GECE 2JQFR 3RVXA 4Q8GA 1YT7A 2AYNA 2YJCA 3H89A 1MHWA 3BWKA 2HD5A 2AVWA 3F5VA 5J94A 5CVMA 5PADA 4P6GA 2AYOA 2PADA 2G8EA 1ITOA 3CBJA 3QJ3A 1EF7A 2R9OA 2DZYA 3N4CA 2B1MA 1NB3A 3K9MA 3KKUA 4BPVA 1NPZA 1F29A 3OF9A 4N4ZA 2H7JA 1YK7A 2FRQA 2P0RA 3O1GA 4PP2E 1IWDA 2G6DA 2G7YA 3V6EA 5CHVA 2YJ9A 4KLBA 1MEGA 3E1ZB 1F2AA 3PNRA 2AU1A 2C0YA 3M99A 3MHHA 2E01A 1KFXL 2YJ2A 3HWNA 1U9QX 1NL6A 2FT2A 4YYUA 4HWYA 1ICFA 4QH6A 3BCNA 4OEMA 3RVVA 4YYQA 2BDLA 1PPPA 4X6HA 1HUCB 2DJGB 4CDCB 3H8CA 3WXEA 5CHTA 1X9YA 1EWOA 1O0EA 5A24A 8PCHA 2GFOA 3KFQA 4YYRA 1M6DA 3N3GA 3AI8A 2VHSA 2FUDA 1TU6A 2XU4A 1Y08A 4QRVA 3K24A 1VSNA 4YYSA 1BQIA 4CDDB 1TLOA 3BPMA 1DF0A 2YJBA 2IPPB 2NQGA 4QBBA 4MSXA 1AYWA 1A6RA 2JQGR 4W4UA 1EWLA 1ZIVA 3H6SA 4FIPA 1EWMA 2R9MA 2G8JA 3KX1A 2ARYA 1PXVA 3H8BA 2DCBA 3HHAA 3MTNA 2DCCA 5F02A 3K8UA 2OULA 1KHPA 2F7DA 1ME3A 2NQIA 2NQAA 1AYUA 5JH3A 4OELA 3KWZA 1PE6A 1SP4B 3RVWA 3IOQA 4MZOA 3QSDA 2AIMA 4ZUXU 4AXLA 6PADA 3D6SA 3KSEA 1POPA 1PIPA 4RY2A 1NLJA 3WXGA 3BOWA 3CH3X 2NQDB 1QMYA 4PADA 3QT4A 4YVAA 4AXMA 2E03A 2FQ9A 1CTEA 2ACTA 1CPJA 4DMXA 4K7CA 2YJ8A 5CVOB 2FYEA 2FO5A 1CQDA 2OP3A 2E00A 5FPWA 2R9FA 2ATOA 1S4VA 2WBFX 1QXPA 3WXFA 4I07A 3O0UA 1FH0A 2BDZA 1DEUA 2AUXA 1ATKA 1AU2A 2HHNA 2PNSA 2R9NA 3OISA 3BC3A 4BS6A 3BPFA 7PCKA 1VJVA 4BSQA 2DJFB 2E02A 3U8EA 1F2BA 2FRAA 1BP4A 4CDEB 1GLOA 1GCBA 2Y6EA 3C9EA 1AYVA 3USVA 4PI3A 3B79A 3OVXA 3V6CA 1THEA 1YK8A 2AS8A 1MDWA 3LXSA 3F75A 1QOLA 3ERVA 4XR7A 1AU0A 2DC8A 3GCBA 1PPDA 4X6IA 4N8WA 1Q6KA 1ZCMA 1BY8A 2XU5A 2DC7A 5JA7A 2HXZA 3HD3A 2IBIA 1PPOA 3N3KA 1ME4A 5EF4A 4CZWA 3P5UA 1KFUL 4MZSA 1STFE 3MHSA 2XU3A 1PPNA 1CSBB 3IUTA 1K3BB 1AU4A 3TNXA 4WA6A 2B1NA 2R6NA 3P5VA 3P5XA 2PBHA 4QRGA 1CV8A 1TL9A 1JQPA 2OZ2A 4YYVA 1U9XA 1MS6A 3MORA 4I04A 4CDFB 4G54A 3KW9A 1Y4HA 3I06A 5CVNB 2P7UA
chains in the Genus database with same CATH superfamily
2DC6A 3PSEA 3IV2A 5JZEA 1YZBA 3H7DA 1F2CA 1GMYA 3KWBX 3IEJA 3CH2X 1SNKA 2CIOA 2R9CA 4YV8A 3I3TA 1BGOA 4PP1A 2PREA 5E6JA 4BS5A 1CB5A 2CB5A 4BOPA 4W5CA 4M0WA 3B21A 1CJLA 1KXRA 1YVBA 1CVZA 3PBHA 4QRXA 1AECA 3S3RA 4BOZA 4Q8HA 1NQCA 2AUZA 2HH5A 4FJCA 2VHFA 4FK5A 3IFUA 3S3QA 5KO3A 1PADA 1U5IA 1QDQA 2O6XA 4I05A 3PT2A 1U9VA 2DZZA 4GUAA 1PBHA 2J7QA 4X6JA 4P6EA 3LFYA 4W5BA 1PCIA 1U9WA 4YYWA 2UZJA 4A5UA 5K16A 4IUMA 3IMAA 3O65A 3DF0A 1EWPA 1CS8A 1AIMA 1KHQA 4D8IA 3NHEA 1NB5A 3PDFA 2DCAA 2Y5BA 3OQCA 3PW3A 5EGWA 4DMYA 3IHPA 4XUIA 2P86A 9PAPA 2DCDA 4BQVA 4N79A 1AU3A 3CBKA 2FTDA 3P5WA 1XKGA 2DC9A 2XU1A 3HHIA 2GHUA 3ZUAA 3OVZA 2BTWB 3MP2A 1PVJA 3OF8A 3PHUA 2F1GA 1MIRA 1YALA 1MEMA 1GECE 2JQFR 3RVXA 4Q8GA 1YT7A 3PHWA 2AYNA 2YJCA 3H89A 1MHWA 3BWKA 2HD5A 4HXDB 2AVWA 4RF0A 3F5VA 5J94A 5CVMA 5PADA 2AYOA 4P6GA 2PADA 2G8EA 1ITOA 3CBJA 3BBAA 3QJ3A 1EF7A 2R9OA 2DZYA 3N4CA 2B1MA 1NB3A 4XZXA 3K9MA 4BOQA 3KKUA 4BPVA 1NPZA 1F29A 3OF9A 4N4ZA 2H7JA 1YK7A 4ZTBA 2FRQA 4PT5A 2P0RA 3O1GA 4PP2E 3W30A 1IWDA 2G6DA 2G7YA 3V6EA 5CHVA 2YJ9A 4KLBA 1MEGA 3E1ZB 1F2AA 3PNRA 2AU1A 2C0YA 3M99A 3MHHA 2E01A 1KFXL 2YJ2A 3HWNA 1U9QX 3TRKA 1NL6A 2FT2A 4YYUA 4HWYA 1ICFA 4QH6A 3BCNA 4OEMA 3RVVA 4YYQA 2BDLA 1PPPA 4X6HA 1HUCB 2DJGB 4CDCB 3H8CA 3WXEA 5CHTA 1X9YA 1EWOA 1O0EA 5A24A 8PCHA 2GFOA 3KFQA 4YYRA 1M6DA 3N3GA 3AI8A 3ZNHA 2VHSA 2FUDA 1TU6A 2XU4A 1Y08A 4QRVA 3K24A 1VSNA 4YYSA 1BQIA 4CDDB 1TLOA 3BPMA 4OVZB 1DF0A 3TMPA 2YJBA 2IPPB 2NQGA 4QBBA 2AGAA 4MSXA 3BB7A 1AYWA 1A6RA 2JQGR 4W4UA 4P16A 1EWLA 1ZIVA 3C0RA 5EZQA 3H6SA 4FIPA 2BTWA 1EWMA 2R9MA 2G8JA 3KX1A 2ARYA 4RKXA 3PRMA 1PXVA 3H8BA 2DCBA 3HHAA 3MTNA 2DCCA 2BU3A 5F02A 4WURA 3K8UA 2OULA 1KHPA 2F7DA 1ME3A 2NQIA 2NQAA 2FE8A 1AYUA 5JH3A 4OELA 3KWZA 1PE6A 1SP4B 3RVWA 3IOQA 4MZOA 3QSDA 2AIMA 4ZUXU 4AXLA 6PADA 3D6SA 3KSEA 1POPA 1PIPA 4MI7A 4RY2A 1NLJA 3WXGA 3BOWA 3E9SA 3CH3X 2NQDB 1QMYA 4PADA 3QT4A 4YVAA 4OW0A 4AXMA 2E03A 2FQ9A 1CTEA 2ACTA 1CPJA 4DMXA 4K7CA 2YJ8A 5CVOB 2JTCA 2FYEA 2FO5A 1CQDA 2J7QC 1UKFA 2OP3A 2E00A 5FPWA 2R9FA 2ATOA 1S4VA 2WBFX 4MM3B 1QXPA 3WXFA 4I07A 1DKIA 3O0UA 1FH0A 2BDZA 2Z84A 1DEUA 2AUXA 1ATKA 1AU2A 2HHNA 2PNSA 2R9NA 3OISA 3BC3A 4BS6A 3BPFA 7PCKA 1VJVA 4BSQA 2DJFB 4RF1A 2E02A 3U8EA 1F2BA 2FRAA 2DOSA 4IP3A 1BP4A 4R3DA 4CDEB 1GLOA 1GCBA 2Y6EA 4D8EA 3C9EA 1AYVA 3USVA 4PI3A 3B79A 3OVXA 3V6CA 2HWKA 3PHXA 4RNAA 1THEA 1YK8A 4REZA 2AS8A 4BOUA 1MDWA 3LXSA 3F75A 1QOLA 3ERVA 4XR7A 1AU0A 2DC8A 3GCBA 4OVZA 1PPDA 4X6IA 4N8WA 1Q6KA 1ZCMA 3PRPA 1BY8A 2XU5A 2DC7A 5JA7A 2HXZA 3HD3A 2IBIA 1PPOA 3MTVA 2JRIA 3N3KA 1ME4A 5EF4A 3RNVA 4CZWA 4BOSA 3P5UA 1KFUL 4MZSA 3BY4A 1STFE 3MHSA 2XU3A 1PPNA 1CSBB 3MJ5A 3W31A 3IUTA 1K3BB 1AU4A 3TNXA 4WA6A 2B1NA 5EZSA 2R6NA 3P5VA 3P5XA 2PBHA 4QRGA 1CV8A 1TL9A 1JQPA 2OZ2A 4YYVA 1U9XA 1MS6A 3MORA 4I04A 4CDFB 4G54A 4D8BA 3KW9A 1Y4HA 3I06A 5CVNB 2P7UA
chains in the Genus database with same CATH topology
2DC6A 3IV2A 3H7DA 1F2CA 1GMYA 3KWBX 3IEJA 3CH2X 1SNKA 2CIOA 2R9CA 4YV8A 3I3TA 1BGOA 4PP1A 2PREA 4BS5A 1CB5A 2CB5A 2BSZA 4W5CA 1CJLA 1KXRA 1YVBA 1CVZA 3PBHA 4QRXA 1AECA 3S3RA 4Q8HA 1NQCA 2AUZA 2HH5A 4FJCA 2VHFA 4FK5A 3S3QA 1PADA 1U5IA 1QDQA 2O6XA 4I05A 1U9VA 4NV7A 3D9WA 2DZZA 1PBHA 4X6JA 4P6EA 3LFYA 4W5BA 1PCIA 1U9WA 4YYWA 5K16A 3IMAA 3DF0A 1EWPA 1CS8A 1AIMA 1KHQA 3NHEA 1NB5A 3PDFA 2DCAA 2Y5BA 3PW3A 5EGWA 4DMYA 3IHPA 4XUIA 2P86A 9PAPA 2DCDA 4BQVA 3LTWA 4N79A 1AU3A 3CBKA 2FTDA 3P5WA 1XKGA 2DC9A 2XU1A 3HHIA 2GHUA 3ZUAA 3OVZA 1W4TA 3OF8A 2F1GA 1MIRA 1YALA 1MEMA 1GECE 2JQFR 3RVXA 4Q8GA 1YT7A 2AYNA 2YJCA 3H89A 1MHWA 3BWKA 2HD5A 2AVWA 3F5VA 5J94A 5CVMA 5PADA 4P6GA 2AYOA 2PADA 2G8EA 1ITOA 3CBJA 3QJ3A 1EF7A 1W5RA 2R9OA 2DZYA 3N4CA 2B1MA 1NB3A 3K9MA 1W6FA 3KKUA 4BPVA 1NPZA 1F29A 3OF9A 4N4ZA 2H7JA 1YK7A 2FRQA 2P0RA 3O1GA 4PP2E 1IWDA 2G6DA 2G7YA 3V6EA 5CHVA 2YJ9A 4KLBA 1MEGA 3E1ZB 1F2AA 3PNRA 2AU1A 2C0YA 3M99A 3MHHA 2E01A 1KFXL 2YJ2A 3HWNA 1U9QX 1NL6A 2FT2A 4YYUA 4HWYA 1ICFA 4QH6A 3BCNA 4OEMA 4BGFA 3RVVA 4YYQA 2BDLA 1PPPA 4X6HA 1HUCB 2DJGB 4CDCB 1GX3A 3H8CA 3WXEA 5CHTA 1X9YA 1EWOA 1O0EA 5A24A 8PCHA 2GFOA 3KFQA 4YYRA 1M6DA 3N3GA 3AI8A 2VHSA 2FUDA 1TU6A 2XU4A 1Y08A 4QRVA 3K24A 1VSNA 4YYSA 1BQIA 4CDDB 1TLOA 3BPMA 1DF0A 2YJBA 2IPPB 2NQGA 4QBBA 4MSXA 1AYWA 1A6RA 2JQGR 4W4UA 1EWLA 1ZIVA 3H6SA 4FIPA 4NV8A 1EWMA 2R9MA 2G8JA 3KX1A 2ARYA 1PXVA 3H8BA 2DCBA 3HHAA 3MTNA 2DCCA 5F02A 3K8UA 2OULA 1KHPA 2F7DA 1ME3A 1E2TA 2NQIA 4B55A 2NQAA 1AYUA 5JH3A 4OELA 3KWZA 1PE6A 1SP4B 3RVWA 3IOQA 4MZOA 3QSDA 2AIMA 4ZUXU 4AXLA 6PADA 3D6SA 3KSEA 1POPA 1PIPA 4RY2A 1NLJA 3WXGA 3BOWA 3CH3X 2NQDB 1QMYA 4PADA 3QT4A 4YVAA 4AXMA 2E03A 2FQ9A 1CTEA 2ACTA 1CPJA 4DMXA 4K7CA 2YJ8A 5CVOB 2FYEA 2FO5A 1CQDA 2OP3A 2E00A 5FPWA 2R9FA 2ATOA 2VFBA 1S4VA 2WBFX 1QXPA 3WXFA 4I07A 3O0UA 1FH0A 2BDZA 1DEUA 2AUXA 1ATKA 1AU2A 2HHNA 2PNSA 2R9NA 3OISA 3BC3A 4BS6A 3BPFA 7PCKA 1VJVA 4BSQA 2DJFB 2E02A 3U8EA 1F2BA 2FRAA 2VFCA 1BP4A 4CDEB 1GLOA 1GCBA 2Y6EA 3C9EA 1AYVA 3USVA 4PI3A 4C5PA 3B79A 3OVXA 3V6CA 1THEA 1YK8A 2AS8A 1MDWA 3LXSA 3F75A 1QOLA 3ERVA 4XR7A 1AU0A 2DC8A 3GCBA 1PPDA 4X6IA 4N8WA 1Q6KA 1ZCMA 1BY8A 2XU5A 2DC7A 5JA7A 2HXZA 3HD3A 2IBIA 1PPOA 3N3KA 1ME4A 5EF4A 4CZWA 3P5UA 1KFUL 4MZSA 1STFE 3MHSA 2XU3A 1PPNA 1CSBB 3IUTA 1K3BB 4GUZA 1AU4A 3TNXA 4WA6A 2B1NA 2R6NA 3P5VA 3P5XA 2PBHA 4QRGA 1CV8A 1TL9A 1JQPA 2OZ2A 4YYVA 1U9XA 1MS6A 3MORA 4I04A 4CDFB 4G54A 3KW9A 1Y4HA 3I06A 5CVNB 2P7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC6 A;  3IV2 A;  3H7D A;  1F2C A;  1GMY A;  3KWB X;  3IEJ A;  3CH2 X;  1SNK A;  2CIO A;  2R9C A;  4YV8 A;  3I3T A;  1BGO A;  4PP1 A;  2PRE A;  4BS5 A;  1CB5 A;  2CB5 A;  4W5C A;  1CJL A;  1KXR A;  1YVB A;  1CVZ A;  3PBH A;  4QRX A;  1AEC A;  3S3R A;  4Q8H A;  1NQC A;  2AUZ A;  2HH5 A;  4FJC A;  2VHF A;  4FK5 A;  3S3Q A;  1PAD A;  1U5I A;  1QDQ A;  2O6X A;  4I05 A;  1U9V A;  2DZZ A;  1PBH A;  4X6J A;  4P6E A;  3LFY A;  4W5B A;  1PCI A;  1U9W A;  4YYW A;  5K16 A;  3IMA A;  3DF0 A;  1EWP A;  1CS8 A;  1AIM A;  1KHQ A;  3NHE A;  1NB5 A;  3PDF A;  2DCA A;  2Y5B A;  3PW3 A;  5EGW A;  4DMY A;  3IHP A;  4XUI A;  2P86 A;  9PAP A;  2DCD A;  4BQV A;  4N79 A;  1AU3 A;  3CBK A;  2FTD A;  3P5W A;  1XKG A;  2DC9 A;  2XU1 A;  3HHI A;  2GHU A;  3ZUA A;  3OVZ A;  3OF8 A;  2F1G A;  1MIR A;  1YAL A;  1MEM A;  1GEC E;  2JQF R;  3RVX A;  4Q8G A;  1YT7 A;  2AYN A;  2YJC A;  3H89 A;  1MHW A;  3BWK A;  2HD5 A;  2AVW A;  3F5V A;  5J94 A;  5CVM A;  5PAD A;  4P6G A;  2AYO A;  2PAD A;  2G8E A;  1ITO A;  3CBJ A;  3QJ3 A;  1EF7 A;  2R9O A;  2DZY A;  3N4C A;  2B1M A;  1NB3 A;  3K9M A;  3KKU A;  4BPV A;  1NPZ A;  1F29 A;  3OF9 A;  4N4Z A;  2H7J A;  1YK7 A;  2FRQ A;  2P0R A;  3O1G A;  4PP2 E;  1IWD A;  2G6D A;  2G7Y A;  3V6E A;  5CHV A;  2YJ9 A;  4KLB A;  1MEG A;  3E1Z B;  1F2A A;  3PNR A;  2AU1 A;  2C0Y A;  3M99 A;  3MHH A;  2E01 A;  1KFX L;  2YJ2 A;  3HWN A;  1U9Q X;  1NL6 A;  2FT2 A;  4YYU A;  4HWY A;  1ICF A;  4QH6 A;  3BCN A;  4OEM A;  3RVV A;  4YYQ A;  2BDL A;  1PPP A;  4X6H A;  1HUC B;  2DJG B;  4CDC B;  3H8C A;  3WXE A;  5CHT A;  1X9Y A;  1EWO A;  1O0E A;  5A24 A;  8PCH A;  2GFO A;  3KFQ A;  4YYR A;  1M6D A;  3N3G A;  3AI8 A;  2VHS A;  2FUD A;  1TU6 A;  2XU4 A;  1Y08 A;  4QRV A;  3K24 A;  1VSN A;  4YYS A;  1BQI A;  4CDD B;  1TLO A;  3BPM A;  1DF0 A;  2YJB A;  2IPP B;  2NQG A;  4QBB A;  4MSX A;  1AYW A;  1A6R A;  2JQG R;  4W4U A;  1EWL A;  1ZIV A;  3H6S A;  4FIP A;  1EWM A;  2R9M A;  2G8J A;  3KX1 A;  2ARY A;  1PXV A;  3H8B A;  2DCB A;  3HHA A;  3MTN A;  2DCC A;  5F02 A;  3K8U A;  2OUL A;  1KHP A;  2F7D A;  1ME3 A;  2NQI A;  2NQA A;  1AYU A;  5JH3 A;  4OEL A;  3KWZ A;  1PE6 A;  1SP4 B;  3RVW A;  3IOQ A;  4MZO A;  3QSD A;  2AIM A;  4ZUX U;  4AXL A;  6PAD A;  3D6S A;  3KSE A;  1POP A;  1PIP A;  4RY2 A;  1NLJ A;  3WXG A;  3BOW A;  3CH3 X;  2NQD B;  1QMY A;  4PAD A;  3QT4 A;  4YVA A;  4AXM A;  2E03 A;  2FQ9 A;  1CTE A;  2ACT A;  1CPJ A;  4DMX A;  4K7C A;  2YJ8 A;  5CVO B;  2FYE A;  2FO5 A;  1CQD A;  2OP3 A;  2E00 A;  5FPW A;  2R9F A;  2ATO A;  1S4V A;  2WBF X;  1QXP A;  3WXF A;  4I07 A;  3O0U A;  1FH0 A;  2BDZ A;  1DEU A;  2AUX A;  1ATK A;  1AU2 A;  2HHN A;  2PNS A;  2R9N A;  3OIS A;  3BC3 A;  4BS6 A;  3BPF A;  7PCK A;  1VJV A;  4BSQ A;  2DJF B;  2E02 A;  3U8E A;  1F2B A;  2FRA A;  1BP4 A;  4CDE B;  1GLO A;  1GCB A;  2Y6E A;  3C9E A;  1AYV A;  3USV A;  4PI3 A;  3B79 A;  3OVX A;  3V6C A;  1THE A;  1YK8 A;  2AS8 A;  1MDW A;  3LXS A;  3F75 A;  1QOL A;  3ERV A;  4XR7 A;  1AU0 A;  2DC8 A;  3GCB A;  1PPD A;  4X6I A;  4N8W A;  1Q6K A;  1ZCM A;  1BY8 A;  2XU5 A;  2DC7 A;  5JA7 A;  2HXZ A;  3HD3 A;  2IBI A;  1PPO A;  3N3K A;  1ME4 A;  5EF4 A;  4CZW A;  3P5U A;  1KFU L;  4MZS A;  1STF E;  3MHS A;  2XU3 A;  1PPN A;  1CSB B;  3IUT A;  1K3B B;  1AU4 A;  3TNX A;  4WA6 A;  2B1N A;  2R6N A;  3P5V A;  3P5X A;  2PBH A;  4QRG A;  1CV8 A;  1TL9 A;  1JQP A;  2OZ2 A;  4YYV A;  1U9X A;  1MS6 A;  3MOR A;  4I04 A;  4CDF B;  4G54 A;  3KW9 A;  1Y4H A;  3I06 A;  5CVN B;  2P7U A; 
#chains in the Genus database with same CATH topology
 2DC6 A;  3PSE A;  3IV2 A;  5JZE A;  1YZB A;  3H7D A;  1F2C A;  1GMY A;  3KWB X;  3IEJ A;  3CH2 X;  1SNK A;  2CIO A;  2R9C A;  4YV8 A;  3I3T A;  1BGO A;  4PP1 A;  2PRE A;  5E6J A;  4BS5 A;  1CB5 A;  2CB5 A;  4BOP A;  4W5C A;  4M0W A;  3B21 A;  1CJL A;  1KXR A;  1YVB A;  1CVZ A;  3PBH A;  4QRX A;  1AEC A;  3S3R A;  4BOZ A;  4Q8H A;  1NQC A;  2AUZ A;  2HH5 A;  4FJC A;  2VHF A;  4FK5 A;  3IFU A;  3S3Q A;  5KO3 A;  1PAD A;  1U5I A;  1QDQ A;  2O6X A;  4I05 A;  3PT2 A;  1U9V A;  2DZZ A;  4GUA A;  1PBH A;  2J7Q A;  4X6J A;  4P6E A;  3LFY A;  4W5B A;  1PCI A;  1U9W A;  4YYW A;  2UZJ A;  4A5U A;  5K16 A;  4IUM A;  3IMA A;  3O65 A;  3DF0 A;  1EWP A;  1CS8 A;  1AIM A;  1KHQ A;  4D8I A;  3NHE A;  1NB5 A;  3PDF A;  2DCA A;  2Y5B A;  3OQC A;  3PW3 A;  5EGW A;  4DMY A;  3IHP A;  4XUI A;  2P86 A;  9PAP A;  2DCD A;  4BQV A;  4N79 A;  1AU3 A;  3CBK A;  2FTD A;  3P5W A;  1XKG A;  2DC9 A;  2XU1 A;  3HHI A;  2GHU A;  3ZUA A;  3OVZ A;  2BTW B;  3MP2 A;  1PVJ A;  3OF8 A;  3PHU A;  2F1G A;  1MIR A;  1YAL A;  1MEM A;  1GEC E;  2JQF R;  3RVX A;  4Q8G A;  1YT7 A;  3PHW A;  2AYN A;  2YJC A;  3H89 A;  1MHW A;  3BWK A;  2HD5 A;  4HXD B;  2AVW A;  4RF0 A;  3F5V A;  5J94 A;  5CVM A;  5PAD A;  2AYO A;  4P6G A;  2PAD A;  2G8E A;  1ITO A;  3CBJ A;  3BBA A;  3QJ3 A;  1EF7 A;  2R9O A;  2DZY A;  3N4C A;  2B1M A;  1NB3 A;  4XZX A;  3K9M A;  4BOQ A;  3KKU A;  4BPV A;  1NPZ A;  1F29 A;  3OF9 A;  4N4Z A;  2H7J A;  1YK7 A;  4ZTB A;  2FRQ A;  4PT5 A;  2P0R A;  3O1G A;  4PP2 E;  3W30 A;  1IWD A;  2G6D A;  2G7Y A;  3V6E A;  5CHV A;  2YJ9 A;  4KLB A;  1MEG A;  3E1Z B;  1F2A A;  3PNR A;  2AU1 A;  2C0Y A;  3M99 A;  3MHH A;  2E01 A;  1KFX L;  2YJ2 A;  3HWN A;  1U9Q X;  3TRK A;  1NL6 A;  2FT2 A;  4YYU A;  4HWY A;  1ICF A;  4QH6 A;  3BCN A;  4OEM A;  3RVV A;  4YYQ A;  2BDL A;  1PPP A;  4X6H A;  1HUC B;  2DJG B;  4CDC B;  3H8C A;  3WXE A;  5CHT A;  1X9Y A;  1EWO A;  1O0E A;  5A24 A;  8PCH A;  2GFO A;  3KFQ A;  4YYR A;  1M6D A;  3N3G A;  3AI8 A;  3ZNH A;  2VHS A;  2FUD A;  1TU6 A;  2XU4 A;  1Y08 A;  4QRV A;  3K24 A;  1VSN A;  4YYS A;  1BQI A;  4CDD B;  1TLO A;  3BPM A;  4OVZ B;  1DF0 A;  3TMP A;  2YJB A;  2IPP B;  2NQG A;  4QBB A;  2AGA A;  4MSX A;  3BB7 A;  1AYW A;  1A6R A;  2JQG R;  4W4U A;  4P16 A;  1EWL A;  1ZIV A;  3C0R A;  5EZQ A;  3H6S A;  4FIP A;  2BTW A;  1EWM A;  2R9M A;  2G8J A;  3KX1 A;  2ARY A;  4RKX A;  3PRM A;  1PXV A;  3H8B A;  2DCB A;  3HHA A;  3MTN A;  2DCC A;  2BU3 A;  5F02 A;  4WUR A;  3K8U A;  2OUL A;  1KHP A;  2F7D A;  1ME3 A;  2NQI A;  2NQA A;  2FE8 A;  1AYU A;  5JH3 A;  4OEL A;  3KWZ A;  1PE6 A;  1SP4 B;  3RVW A;  3IOQ A;  4MZO A;  3QSD A;  2AIM A;  4ZUX U;  4AXL A;  6PAD A;  3D6S A;  3KSE A;  1POP A;  1PIP A;  4MI7 A;  4RY2 A;  1NLJ A;  3WXG A;  3BOW A;  3E9S A;  3CH3 X;  2NQD B;  1QMY A;  4PAD A;  3QT4 A;  4YVA A;  4OW0 A;  4AXM A;  2E03 A;  2FQ9 A;  1CTE A;  2ACT A;  1CPJ A;  4DMX A;  4K7C A;  2YJ8 A;  5CVO B;  2JTC A;  2FYE A;  2FO5 A;  1CQD A;  2J7Q C;  1UKF A;  2OP3 A;  2E00 A;  5FPW A;  2R9F A;  2ATO A;  1S4V A;  2WBF X;  4MM3 B;  1QXP A;  3WXF A;  4I07 A;  1DKI A;  3O0U A;  1FH0 A;  2BDZ A;  2Z84 A;  1DEU A;  2AUX A;  1ATK A;  1AU2 A;  2HHN A;  2PNS A;  2R9N A;  3OIS A;  3BC3 A;  4BS6 A;  3BPF A;  7PCK A;  1VJV A;  4BSQ A;  2DJF B;  4RF1 A;  2E02 A;  3U8E A;  1F2B A;  2FRA A;  2DOS A;  4IP3 A;  1BP4 A;  4R3D A;  4CDE B;  1GLO A;  1GCB A;  2Y6E A;  4D8E A;  3C9E A;  1AYV A;  3USV A;  4PI3 A;  3B79 A;  3OVX A;  3V6C A;  2HWK A;  3PHX A;  4RNA A;  1THE A;  1YK8 A;  4REZ A;  2AS8 A;  4BOU A;  1MDW A;  3LXS A;  3F75 A;  1QOL A;  3ERV A;  4XR7 A;  1AU0 A;  2DC8 A;  3GCB A;  4OVZ A;  1PPD A;  4X6I A;  4N8W A;  1Q6K A;  1ZCM A;  3PRP A;  1BY8 A;  2XU5 A;  2DC7 A;  5JA7 A;  2HXZ A;  3HD3 A;  2IBI A;  1PPO A;  3MTV A;  2JRI A;  3N3K A;  1ME4 A;  5EF4 A;  3RNV A;  4CZW A;  4BOS A;  3P5U A;  1KFU L;  4MZS A;  3BY4 A;  1STF E;  3MHS A;  2XU3 A;  1PPN A;  1CSB B;  3MJ5 A;  3W31 A;  3IUT A;  1K3B B;  1AU4 A;  3TNX A;  4WA6 A;  2B1N A;  5EZS A;  2R6N A;  3P5V A;  3P5X A;  2PBH A;  4QRG A;  1CV8 A;  1TL9 A;  1JQP A;  2OZ2 A;  4YYV A;  1U9X A;  1MS6 A;  3MOR A;  4I04 A;  4CDF B;  4G54 A;  4D8B A;  3KW9 A;  1Y4H A;  3I06 A;  5CVN B;  2P7U A; 
#chains in the Genus database with same CATH homology
 2DC6 A;  3IV2 A;  3H7D A;  1F2C A;  1GMY A;  3KWB X;  3IEJ A;  3CH2 X;  1SNK A;  2CIO A;  2R9C A;  4YV8 A;  3I3T A;  1BGO A;  4PP1 A;  2PRE A;  4BS5 A;  1CB5 A;  2CB5 A;  2BSZ A;  4W5C A;  1CJL A;  1KXR A;  1YVB A;  1CVZ A;  3PBH A;  4QRX A;  1AEC A;  3S3R A;  4Q8H A;  1NQC A;  2AUZ A;  2HH5 A;  4FJC A;  2VHF A;  4FK5 A;  3S3Q A;  1PAD A;  1U5I A;  1QDQ A;  2O6X A;  4I05 A;  1U9V A;  4NV7 A;  3D9W A;  2DZZ A;  1PBH A;  4X6J A;  4P6E A;  3LFY A;  4W5B A;  1PCI A;  1U9W A;  4YYW A;  5K16 A;  3IMA A;  3DF0 A;  1EWP A;  1CS8 A;  1AIM A;  1KHQ A;  3NHE A;  1NB5 A;  3PDF A;  2DCA A;  2Y5B A;  3PW3 A;  5EGW A;  4DMY A;  3IHP A;  4XUI A;  2P86 A;  9PAP A;  2DCD A;  4BQV A;  3LTW A;  4N79 A;  1AU3 A;  3CBK A;  2FTD A;  3P5W A;  1XKG A;  2DC9 A;  2XU1 A;  3HHI A;  2GHU A;  3ZUA A;  3OVZ A;  1W4T A;  3OF8 A;  2F1G A;  1MIR A;  1YAL A;  1MEM A;  1GEC E;  2JQF R;  3RVX A;  4Q8G A;  1YT7 A;  2AYN A;  2YJC A;  3H89 A;  1MHW A;  3BWK A;  2HD5 A;  2AVW A;  3F5V A;  5J94 A;  5CVM A;  5PAD A;  4P6G A;  2AYO A;  2PAD A;  2G8E A;  1ITO A;  3CBJ A;  3QJ3 A;  1EF7 A;  1W5R A;  2R9O A;  2DZY A;  3N4C A;  2B1M A;  1NB3 A;  3K9M A;  1W6F A;  3KKU A;  4BPV A;  1NPZ A;  1F29 A;  3OF9 A;  4N4Z A;  2H7J A;  1YK7 A;  2FRQ A;  2P0R A;  3O1G A;  4PP2 E;  1IWD A;  2G6D A;  2G7Y A;  3V6E A;  5CHV A;  2YJ9 A;  4KLB A;  1MEG A;  3E1Z B;  1F2A A;  3PNR A;  2AU1 A;  2C0Y A;  3M99 A;  3MHH A;  2E01 A;  1KFX L;  2YJ2 A;  3HWN A;  1U9Q X;  1NL6 A;  2FT2 A;  4YYU A;  4HWY A;  1ICF A;  4QH6 A;  3BCN A;  4OEM A;  4BGF A;  3RVV A;  4YYQ A;  2BDL A;  1PPP A;  4X6H A;  1HUC B;  2DJG B;  4CDC B;  1GX3 A;  3H8C A;  3WXE A;  5CHT A;  1X9Y A;  1EWO A;  1O0E A;  5A24 A;  8PCH A;  2GFO A;  3KFQ A;  4YYR A;  1M6D A;  3N3G A;  3AI8 A;  2VHS A;  2FUD A;  1TU6 A;  2XU4 A;  1Y08 A;  4QRV A;  3K24 A;  1VSN A;  4YYS A;  1BQI A;  4CDD B;  1TLO A;  3BPM A;  1DF0 A;  2YJB A;  2IPP B;  2NQG A;  4QBB A;  4MSX A;  1AYW A;  1A6R A;  2JQG R;  4W4U A;  1EWL A;  1ZIV A;  3H6S A;  4FIP A;  4NV8 A;  1EWM A;  2R9M A;  2G8J A;  3KX1 A;  2ARY A;  1PXV A;  3H8B A;  2DCB A;  3HHA A;  3MTN A;  2DCC A;  5F02 A;  3K8U A;  2OUL A;  1KHP A;  2F7D A;  1ME3 A;  1E2T A;  2NQI A;  4B55 A;  2NQA A;  1AYU A;  5JH3 A;  4OEL A;  3KWZ A;  1PE6 A;  1SP4 B;  3RVW A;  3IOQ A;  4MZO A;  3QSD A;  2AIM A;  4ZUX U;  4AXL A;  6PAD A;  3D6S A;  3KSE A;  1POP A;  1PIP A;  4RY2 A;  1NLJ A;  3WXG A;  3BOW A;  3CH3 X;  2NQD B;  1QMY A;  4PAD A;  3QT4 A;  4YVA A;  4AXM A;  2E03 A;  2FQ9 A;  1CTE A;  2ACT A;  1CPJ A;  4DMX A;  4K7C A;  2YJ8 A;  5CVO B;  2FYE A;  2FO5 A;  1CQD A;  2OP3 A;  2E00 A;  5FPW A;  2R9F A;  2ATO A;  2VFB A;  1S4V A;  2WBF X;  1QXP A;  3WXF A;  4I07 A;  3O0U A;  1FH0 A;  2BDZ A;  1DEU A;  2AUX A;  1ATK A;  1AU2 A;  2HHN A;  2PNS A;  2R9N A;  3OIS A;  3BC3 A;  4BS6 A;  3BPF A;  7PCK A;  1VJV A;  4BSQ A;  2DJF B;  2E02 A;  3U8E A;  1F2B A;  2FRA A;  2VFC A;  1BP4 A;  4CDE B;  1GLO A;  1GCB A;  2Y6E A;  3C9E A;  1AYV A;  3USV A;  4PI3 A;  4C5P A;  3B79 A;  3OVX A;  3V6C A;  1THE A;  1YK8 A;  2AS8 A;  1MDW A;  3LXS A;  3F75 A;  1QOL A;  3ERV A;  4XR7 A;  1AU0 A;  2DC8 A;  3GCB A;  1PPD A;  4X6I A;  4N8W A;  1Q6K A;  1ZCM A;  1BY8 A;  2XU5 A;  2DC7 A;  5JA7 A;  2HXZ A;  3HD3 A;  2IBI A;  1PPO A;  3N3K A;  1ME4 A;  5EF4 A;  4CZW A;  3P5U A;  1KFU L;  4MZS A;  1STF E;  3MHS A;  2XU3 A;  1PPN A;  1CSB B;  3IUT A;  1K3B B;  4GUZ A;  1AU4 A;  3TNX A;  4WA6 A;  2B1N A;  2R6N A;  3P5V A;  3P5X A;  2PBH A;  4QRG A;  1CV8 A;  1TL9 A;  1JQP A;  2OZ2 A;  4YYV A;  1U9X A;  1MS6 A;  3MOR A;  4I04 A;  4CDF B;  4G54 A;  3KW9 A;  1Y4H A;  3I06 A;  5CVN B;  2P7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...