3B79A

Crystal structure of the n-terminal peptidase c39 like domain of the toxin secretion atp-binding protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
b'AMKDPLLNSLIYVSRYYGLANSPEALVNGLPLSDGKLTPFLLPRAAERAGLVAKENRAELEKISSLILPAILVLKGGDSCVLNSINMETREAEVTTLESGMVPISIPLEDLLEQYTGRYFLVKKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin secretion ATP-binding protein
publication title Crystal structure of the N-terminal peptidase C39 like domain of the toxin secretion ATP-binding protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Nucleotide binding protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3b79A00
1KFUL 1CVZA 1EWLA 1U9XA 2HXZA 4QRXA 3IHPA 1AYUA 2B1NA 1AU0A 2XU4A 1ZIVA 3S3RA 2OZ2A 4QH6A 4YYQA 2Y6EA 1KHPA 3B79A 2FRQA 5CVNB 2PNSA 4BPVA 3H8BA 1A6RA 3F5VA 1CV8A 4AXLA 3PNRA 2NQDB 2DC8A 1ICFA 1QOLA 1ZCMA 1NPZA 2AYNA 4G54A 3DF0A 4QBBA 3ERVA 8PCHA 1EWMA 3HHAA 5EF4A 3BPMA 3K8UA 3WXFA 4BQVA 2R9NA 2R9FA 2P0RA 2G8JA 5CVOB 3ZUAA 1SNKA 2AIMA 2E00A 4W5BA 2VHSA 4N4ZA 4P6EA 2HH5A 2OULA 1STFE 3GCBA 3MTNA 3WXEA 1EWOA 3U8EA 1NB5A 4PI3A 2NQAA 1YALA 1K3BB 1YK8A 4X6HA 2GHUA 3MHSA 3E1ZB 5JA7A 9PAPA 1CQDA 2E01A 3BPFA 2OP3A 3NHEA 3IUTA 1JQPA 2PBHA 4QRGA 4CZWA 1KXRA 3I06A 3IMAA 1PIPA 5FPWA 2AUXA 4OEMA 3OF9A 4FIPA 2DC6A 3BOWA 3RVVA 4W5CA 1YVBA 4DMYA 1M6DA 4N8WA 2G6DA 4YV8A 4MSXA 4W4UA 1S4VA 3H6SA 5CHVA 2DCCA 3KWBX 3MHHA 1GCBA 2FYEA 3D6SA 3S3QA 1PXVA 1BY8A 4Q8GA 1F29A 1GLOA 4K7CA 3OF8A 4FJCA 1NLJA 1VJVA 1U9VA 1SP4B 1NB3A 4QRVA 1GECE 2FRAA 2R9CA 1QXPA 2DC7A 3MORA 1AIMA 3PBHA 7PCKA 1CJLA 1MIRA 1AYWA 2R9OA 1BP4A 3I3TA 4RY2A 2AVWA 1YT7A 1AU2A 2AYOA 2IPPB 2BDZA 1PCIA 4P6GA 3KWZA 2E02A 4N79A 4X6IA 5K16A 2YJ9A 2DZYA 3QSDA 2FUDA 1YK7A 3P5UA 1X9YA 3USVA 5EGWA 1PE6A 2DZZA 2G7YA 4Q8HA 2AUZA 2F1GA 3K9MA 2E03A 3BC3A 2GFOA 4CDDB 1BQIA 2XU1A 3KW9A 4HWYA 3K24A 1AYVA 3N3KA 1NL6A 1PPDA 2PADA 4FK5A 3V6CA 1NQCA 5PADA 1PADA 5CHTA 3O0UA 4I04A 2AS8A 3BCNA 3CBKA 5F02A 3HD3A 1F2AA 2P86A 2DJFB 1CS8A 1CB5A 2YJCA 2WBFX 3RVXA 4CDCB 1QMYA 2NQIA 3P5VA 2R6NA 1PPPA 3C9EA 1AU3A 2O6XA 3H7DA 2CB5A 1O0EA 3H8CA 3QT4A 1FH0A 3KSEA 3N3GA 4PP2E 2XU5A 4MZOA 1BGOA 2G8EA 3O1GA 2YJBA 3KX1A 3H89A 4PP1A 1TL9A 3IV2A 1TLOA 4YVAA 2XU3A 6PADA 4YYWA 3P5XA 2DJGB 3CH2X 4WA6A 2NQGA 1CPJA 1CSBB 4CDFB 3N4CA 1THEA 2FO5A 1Y4HA 1ME4A 2C0YA 2FT2A 2YJ2A 1F2BA 4CDEB 1AU4A 2ACTA 3M99A 2F7DA 1DF0A 3CH3X 2VHFA 4XR7A 1DEUA 3OVXA 1POPA 2JQGR 4YYUA 2DCAA 1U9QX 1MEMA 5CVMA 1U5IA 1VSNA 1Q6KA 4YYSA 1MEGA 4I07A 2Y5BA 2DCBA 1CTEA 3LFYA 1EF7A 1MHWA 3OVZA 1HUCB 3IOQA 1PBHA 3CBJA 2BDLA 3IEJA 2DCDA 1Y08A 1AECA 2ATOA 3LXSA 4I05A 2PREA 2R9MA 4OELA 4AXMA 5J94A 3WXGA 1ME3A 1ATKA 3V6EA 5A24A 3KKUA 3PDFA 3F75A 1U9WA 3HWNA 3PW3A 4YYVA 2B1MA 1XKGA 3AI8A 2P7UA 1ITOA 4PADA 3BWKA 5JH3A 3KFQA 3RVWA 2JQFR 1EWPA 1MDWA 4ZUXU 1PPNA 1PPOA 2HD5A 3HHIA 2FTDA 4YYRA 3QJ3A 2DC9A 4KLBA 2ARYA 4X6JA 1IWDA 1MS6A 3OISA 1TU6A 2FQ9A 2AU1A 1F2CA 4XUIA 1GMYA 1KHQA 1QDQA 2H7JA 3TNXA 1KFXL 2CIOA 4MZSA 4BS5A 3P5WA 4DMXA 2HHNA 2IBIA 4BSQA 4BS6A 2YJ8A
chains in the Genus database with same CATH superfamily
1KFUL 1CVZA 1EWLA 1U9XA 2HXZA 3MJ5A 4QRXA 3IHPA 1AYUA 2B1NA 1AU0A 4BOPA 3PRPA 3O65A 2XU4A 1ZIVA 3S3RA 2BTWB 2OZ2A 4QH6A 4YYQA 2Y6EA 1KHPA 3B79A 2FRQA 5CVNB 3RNVA 2PNSA 4BPVA 3H8BA 1A6RA 3F5VA 3PT2A 1CV8A 4ZTBA 4AXLA 3PNRA 4GUAA 2NQDB 3PSEA 2DC8A 1ICFA 1QOLA 4REZA 1ZCMA 1NPZA 2FE8A 2AYNA 3TMPA 3W30A 4G54A 3DF0A 4QBBA 3ERVA 8PCHA 1EWMA 3HHAA 5EF4A 4OVZB 3BPMA 3K8UA 3WXFA 4BQVA 2R9NA 2R9FA 2P0RA 2G8JA 5CVOB 3ZUAA 1SNKA 4MI7A 2JRIA 2AIMA 2E00A 4W5BA 2VHSA 4D8EA 4N4ZA 4P6EA 2HH5A 2OULA 1STFE 3GCBA 3MTNA 3WXEA 1EWOA 3U8EA 1NB5A 4PI3A 4R3DA 3IFUA 2NQAA 1YALA 4RF0A 1K3BB 4WURA 1YK8A 4X6HA 2GHUA 3MHSA 3E1ZB 5JA7A 9PAPA 1CQDA 2E01A 3BPFA 2OP3A 2BU3A 3NHEA 3IUTA 1JQPA 4BOQA 2PBHA 4QRGA 4CZWA 1KXRA 3I06A 3IMAA 1PIPA 5FPWA 2AUXA 3C0RA 4OEMA 2HWKA 3OF9A 4FIPA 2DC6A 3BOWA 3PHWA 3RVVA 4W5CA 1YVBA 4DMYA 1M6DA 4N8WA 2G6DA 4YV8A 4MSXA 4W4UA 1S4VA 3H6SA 5CHVA 2DCCA 3KWBX 3MHHA 1GCBA 2FYEA 3D6SA 3S3QA 1PXVA 1BY8A 4Q8GA 1F29A 1GLOA 4K7CA 3OF8A 4FJCA 1NLJA 1VJVA 1U9VA 1SP4B 1NB3A 2UZJA 4QRVA 1GECE 2FRAA 2R9CA 1QXPA 2DC7A 3MORA 1AIMA 3PBHA 7PCKA 1CJLA 1YZBA 1MIRA 1AYWA 1DKIA 2R9OA 1BP4A 3I3TA 4RY2A 2AVWA 1YT7A 3PHUA 1AU2A 2AYOA 2IPPB 2BDZA 4IUMA 1PCIA 5E6JA 4RKXA 4P6GA 3KWZA 2E02A 4N79A 4X6IA 3BB7A 5K16A 2YJ9A 3MP2A 2DZYA 3QSDA 2FUDA 4M0WA 1YK7A 3P5UA 1X9YA 3USVA 1PVJA 5EGWA 3B21A 1PE6A 2DZZA 2G7YA 4Q8HA 2AUZA 4OVZA 2F1GA 3K9MA 2E03A 3BC3A 5EZSA 2GFOA 4CDDB 1BQIA 2XU1A 3KW9A 4HWYA 3K24A 1AYVA 3N3KA 1NL6A 3BY4A 1PPDA 2PADA 4FK5A 3V6CA 1NQCA 5PADA 3W31A 1PADA 5CHTA 3O0UA 4I04A 2AS8A 3BCNA 3CBKA 5F02A 3HD3A 1F2AA 2P86A 2DJFB 1CS8A 1CB5A 2YJCA 2WBFX 3RVXA 4XZXA 4CDCB 1QMYA 2NQIA 3P5VA 2R6NA 1PPPA 3C9EA 1AU3A 2O6XA 3PRMA 2JTCA 3H7DA 2CB5A 4OW0A 3PHXA 1O0EA 5JZEA 3H8CA 3QT4A 1FH0A 3KSEA 3N3GA 4PP2E 2XU5A 4A5UA 4MZOA 4PT5A 1BGOA 2G8EA 3O1GA 2YJBA 3KX1A 3H89A 4IP3A 4PP1A 5EZQA 1TL9A 3IV2A 1TLOA 4YVAA 2XU3A 6PADA 4YYWA 3P5XA 2DJGB 3CH2X 4WA6A 2NQGA 1CPJA 1CSBB 2J7QA 4D8IA 4CDFB 3N4CA 1THEA 2FO5A 1Y4HA 1ME4A 2C0YA 2FT2A 2YJ2A 1F2BA 2BTWA 4CDEB 5KO3A 1AU4A 2ACTA 3M99A 2F7DA 1DF0A 3CH3X 2VHFA 4XR7A 1DEUA 3OVXA 1POPA 4P16A 2JQGR 4YYUA 2DCAA 1U9QX 1MEMA 5CVMA 2AGAA 1U5IA 1VSNA 1Q6KA 4YYSA 1MEGA 4I07A 4BOUA 2Y5BA 2DCBA 1CTEA 3LFYA 1EF7A 1MHWA 3OVZA 4D8BA 1HUCB 3IOQA 1PBHA 3CBJA 2BDLA 3IEJA 2DCDA 1UKFA 1Y08A 1AECA 2ATOA 4RNAA 3LXSA 4I05A 2PREA 2R9MA 4OELA 3BBAA 4AXMA 5J94A 3WXGA 1ME3A 1ATKA 3V6EA 5A24A 3KKUA 4BOSA 3PDFA 3F75A 2DOSA 3ZNHA 1U9WA 4MM3B 3HWNA 3PW3A 4YYVA 2B1MA 1XKGA 2Z84A 3AI8A 2P7UA 1ITOA 4PADA 3BWKA 5JH3A 3KFQA 3RVWA 2JQFR 3OQCA 2J7QC 3E9SA 1EWPA 1MDWA 3MTVA 4ZUXU 1PPNA 1PPOA 2HD5A 3HHIA 2FTDA 4YYRA 3QJ3A 2DC9A 4KLBA 2ARYA 4X6JA 1IWDA 1MS6A 3OISA 4RF1A 1TU6A 2FQ9A 2AU1A 4BOZA 1F2CA 4XUIA 1GMYA 1KHQA 1QDQA 2H7JA 3TNXA 4HXDB 1KFXL 2CIOA 4MZSA 3TRKA 4BS5A 3P5WA 4DMXA 2HHNA 2IBIA 4BSQA 4BS6A 2YJ8A
chains in the Genus database with same CATH topology
1KFUL 1CVZA 1EWLA 1U9XA 2HXZA 4NV7A 4QRXA 3IHPA 4B55A 1AYUA 2B1NA 1AU0A 2XU4A 1ZIVA 3S3RA 2OZ2A 4QH6A 4YYQA 2Y6EA 1KHPA 3B79A 2FRQA 5CVNB 2PNSA 4BPVA 3H8BA 1A6RA 3F5VA 1CV8A 4AXLA 3PNRA 2NQDB 2DC8A 1ICFA 1QOLA 1ZCMA 1NPZA 2AYNA 4G54A 3DF0A 4QBBA 3ERVA 8PCHA 1EWMA 3HHAA 5EF4A 3BPMA 3K8UA 3WXFA 4BQVA 2R9NA 2R9FA 2P0RA 2G8JA 5CVOB 3ZUAA 1SNKA 2AIMA 2E00A 4W5BA 2VHSA 4N4ZA 4P6EA 2HH5A 2OULA 1STFE 3GCBA 3MTNA 3WXEA 1EWOA 3U8EA 1NB5A 4PI3A 2NQAA 4NV8A 1YALA 1K3BB 1YK8A 4X6HA 2GHUA 3MHSA 3E1ZB 5JA7A 9PAPA 1CQDA 2E01A 3BPFA 2OP3A 3NHEA 3IUTA 1JQPA 2PBHA 4QRGA 4CZWA 1KXRA 3I06A 3IMAA 1PIPA 5FPWA 2AUXA 4OEMA 3OF9A 3LTWA 4FIPA 2DC6A 3D9WA 3BOWA 3RVVA 4W5CA 1YVBA 4DMYA 1M6DA 4N8WA 2G6DA 4BGFA 4YV8A 4MSXA 4W4UA 1S4VA 3H6SA 5CHVA 2DCCA 3KWBX 3MHHA 1GCBA 2FYEA 3D6SA 3S3QA 1PXVA 1BY8A 4Q8GA 1F29A 1GLOA 4K7CA 3OF8A 4FJCA 1NLJA 1VJVA 1U9VA 1SP4B 1NB3A 4QRVA 1GECE 2FRAA 2R9CA 1QXPA 2DC7A 3MORA 1AIMA 3PBHA 7PCKA 1CJLA 1MIRA 1AYWA 2R9OA 1BP4A 3I3TA 4RY2A 2AVWA 1YT7A 1AU2A 2AYOA 2IPPB 2BDZA 1PCIA 4P6GA 3KWZA 2E02A 4N79A 4X6IA 5K16A 2YJ9A 2DZYA 3QSDA 2FUDA 1YK7A 3P5UA 1X9YA 3USVA 5EGWA 1PE6A 2DZZA 2G7YA 4Q8HA 2AUZA 2F1GA 3K9MA 2E03A 3BC3A 2GFOA 4CDDB 1BQIA 2XU1A 3KW9A 4HWYA 2VFCA 3K24A 1AYVA 3N3KA 1NL6A 1PPDA 2PADA 4FK5A 3V6CA 1NQCA 5PADA 1PADA 1W4TA 5CHTA 3O0UA 4I04A 2AS8A 3BCNA 1W5RA 3CBKA 5F02A 3HD3A 1F2AA 2P86A 2DJFB 1CS8A 1CB5A 2YJCA 2WBFX 3RVXA 4CDCB 1QMYA 2NQIA 3P5VA 2R6NA 1PPPA 3C9EA 1AU3A 2O6XA 3H7DA 2CB5A 1O0EA 3H8CA 3QT4A 1FH0A 3KSEA 2BSZA 3N3GA 4PP2E 2XU5A 4MZOA 1BGOA 2G8EA 3O1GA 2YJBA 3KX1A 3H89A 4PP1A 1TL9A 3IV2A 1TLOA 4YVAA 2XU3A 6PADA 4YYWA 3P5XA 2DJGB 3CH2X 4GUZA 4WA6A 2NQGA 1CPJA 1CSBB 4CDFB 3N4CA 1THEA 2FO5A 1W6FA 1Y4HA 1ME4A 2C0YA 2FT2A 2YJ2A 1F2BA 4CDEB 1E2TA 1AU4A 2ACTA 3M99A 2F7DA 4C5PA 1DF0A 3CH3X 2VHFA 4XR7A 1DEUA 3OVXA 1POPA 2JQGR 4YYUA 2DCAA 1U9QX 1MEMA 5CVMA 1U5IA 1VSNA 1Q6KA 4YYSA 1MEGA 4I07A 2Y5BA 2DCBA 1CTEA 3LFYA 1EF7A 1MHWA 3OVZA 1HUCB 3IOQA 1PBHA 3CBJA 2BDLA 3IEJA 2DCDA 1Y08A 1AECA 2ATOA 3LXSA 4I05A 2PREA 2R9MA 4OELA 4AXMA 5J94A 3WXGA 1ME3A 1ATKA 3V6EA 5A24A 3KKUA 3PDFA 3F75A 1U9WA 3HWNA 3PW3A 4YYVA 2VFBA 2B1MA 1XKGA 3AI8A 2P7UA 1ITOA 4PADA 3BWKA 5JH3A 3KFQA 3RVWA 2JQFR 1EWPA 1MDWA 4ZUXU 1PPNA 1PPOA 2HD5A 3HHIA 2FTDA 4YYRA 3QJ3A 2DC9A 4KLBA 2ARYA 4X6JA 1IWDA 1MS6A 3OISA 1TU6A 2FQ9A 2AU1A 1F2CA 4XUIA 1GMYA 1KHQA 1QDQA 2H7JA 3TNXA 1GX3A 1KFXL 2CIOA 4MZSA 4BS5A 3P5WA 4DMXA 2HHNA 2IBIA 4BSQA 4BS6A 2YJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFU L;  1CVZ A;  1EWL A;  1U9X A;  2HXZ A;  4QRX A;  3IHP A;  1AYU A;  2B1N A;  1AU0 A;  2XU4 A;  1ZIV A;  3S3R A;  2OZ2 A;  4QH6 A;  4YYQ A;  2Y6E A;  1KHP A;  3B79 A;  2FRQ A;  5CVN B;  2PNS A;  4BPV A;  3H8B A;  1A6R A;  3F5V A;  1CV8 A;  4AXL A;  3PNR A;  2NQD B;  2DC8 A;  1ICF A;  1QOL A;  1ZCM A;  1NPZ A;  2AYN A;  4G54 A;  3DF0 A;  4QBB A;  3ERV A;  8PCH A;  1EWM A;  3HHA A;  5EF4 A;  3BPM A;  3K8U A;  3WXF A;  4BQV A;  2R9N A;  2R9F A;  2P0R A;  2G8J A;  5CVO B;  3ZUA A;  1SNK A;  2AIM A;  2E00 A;  4W5B A;  2VHS A;  4N4Z A;  4P6E A;  2HH5 A;  2OUL A;  1STF E;  3GCB A;  3MTN A;  3WXE A;  1EWO A;  3U8E A;  1NB5 A;  4PI3 A;  2NQA A;  1YAL A;  1K3B B;  1YK8 A;  4X6H A;  2GHU A;  3MHS A;  3E1Z B;  5JA7 A;  9PAP A;  1CQD A;  2E01 A;  3BPF A;  2OP3 A;  3NHE A;  3IUT A;  1JQP A;  2PBH A;  4QRG A;  4CZW A;  1KXR A;  3I06 A;  3IMA A;  1PIP A;  5FPW A;  2AUX A;  4OEM A;  3OF9 A;  4FIP A;  2DC6 A;  3BOW A;  3RVV A;  4W5C A;  1YVB A;  4DMY A;  1M6D A;  4N8W A;  2G6D A;  4YV8 A;  4MSX A;  4W4U A;  1S4V A;  3H6S A;  5CHV A;  2DCC A;  3KWB X;  3MHH A;  1GCB A;  2FYE A;  3D6S A;  3S3Q A;  1PXV A;  1BY8 A;  4Q8G A;  1F29 A;  1GLO A;  4K7C A;  3OF8 A;  4FJC A;  1NLJ A;  1VJV A;  1U9V A;  1SP4 B;  1NB3 A;  4QRV A;  1GEC E;  2FRA A;  2R9C A;  1QXP A;  2DC7 A;  3MOR A;  1AIM A;  3PBH A;  7PCK A;  1CJL A;  1MIR A;  1AYW A;  2R9O A;  1BP4 A;  3I3T A;  4RY2 A;  2AVW A;  1YT7 A;  1AU2 A;  2AYO A;  2IPP B;  2BDZ A;  1PCI A;  4P6G A;  3KWZ A;  2E02 A;  4N79 A;  4X6I A;  5K16 A;  2YJ9 A;  2DZY A;  3QSD A;  2FUD A;  1YK7 A;  3P5U A;  1X9Y A;  3USV A;  5EGW A;  1PE6 A;  2DZZ A;  2G7Y A;  4Q8H A;  2AUZ A;  2F1G A;  3K9M A;  2E03 A;  3BC3 A;  2GFO A;  4CDD B;  1BQI A;  2XU1 A;  3KW9 A;  4HWY A;  3K24 A;  1AYV A;  3N3K A;  1NL6 A;  1PPD A;  2PAD A;  4FK5 A;  3V6C A;  1NQC A;  5PAD A;  1PAD A;  5CHT A;  3O0U A;  4I04 A;  2AS8 A;  3BCN A;  3CBK A;  5F02 A;  3HD3 A;  1F2A A;  2P86 A;  2DJF B;  1CS8 A;  1CB5 A;  2YJC A;  2WBF X;  3RVX A;  4CDC B;  1QMY A;  2NQI A;  3P5V A;  2R6N A;  1PPP A;  3C9E A;  1AU3 A;  2O6X A;  3H7D A;  2CB5 A;  1O0E A;  3H8C A;  3QT4 A;  1FH0 A;  3KSE A;  3N3G A;  4PP2 E;  2XU5 A;  4MZO A;  1BGO A;  2G8E A;  3O1G A;  2YJB A;  3KX1 A;  3H89 A;  4PP1 A;  1TL9 A;  3IV2 A;  1TLO A;  4YVA A;  2XU3 A;  6PAD A;  4YYW A;  3P5X A;  2DJG B;  3CH2 X;  4WA6 A;  2NQG A;  1CPJ A;  1CSB B;  4CDF B;  3N4C A;  1THE A;  2FO5 A;  1Y4H A;  1ME4 A;  2C0Y A;  2FT2 A;  2YJ2 A;  1F2B A;  4CDE B;  1AU4 A;  2ACT A;  3M99 A;  2F7D A;  1DF0 A;  3CH3 X;  2VHF A;  4XR7 A;  1DEU A;  3OVX A;  1POP A;  2JQG R;  4YYU A;  2DCA A;  1U9Q X;  1MEM A;  5CVM A;  1U5I A;  1VSN A;  1Q6K A;  4YYS A;  1MEG A;  4I07 A;  2Y5B A;  2DCB A;  1CTE A;  3LFY A;  1EF7 A;  1MHW A;  3OVZ A;  1HUC B;  3IOQ A;  1PBH A;  3CBJ A;  2BDL A;  3IEJ A;  2DCD A;  1Y08 A;  1AEC A;  2ATO A;  3LXS A;  4I05 A;  2PRE A;  2R9M A;  4OEL A;  4AXM A;  5J94 A;  3WXG A;  1ME3 A;  1ATK A;  3V6E A;  5A24 A;  3KKU A;  3PDF A;  3F75 A;  1U9W A;  3HWN A;  3PW3 A;  4YYV A;  2B1M A;  1XKG A;  3AI8 A;  2P7U A;  1ITO A;  4PAD A;  3BWK A;  5JH3 A;  3KFQ A;  3RVW A;  2JQF R;  1EWP A;  1MDW A;  4ZUX U;  1PPN A;  1PPO A;  2HD5 A;  3HHI A;  2FTD A;  4YYR A;  3QJ3 A;  2DC9 A;  4KLB A;  2ARY A;  4X6J A;  1IWD A;  1MS6 A;  3OIS A;  1TU6 A;  2FQ9 A;  2AU1 A;  1F2C A;  4XUI A;  1GMY A;  1KHQ A;  1QDQ A;  2H7J A;  3TNX A;  1KFX L;  2CIO A;  4MZS A;  4BS5 A;  3P5W A;  4DMX A;  2HHN A;  2IBI A;  4BSQ A;  4BS6 A;  2YJ8 A; 
#chains in the Genus database with same CATH topology
 1KFU L;  1CVZ A;  1EWL A;  1U9X A;  2HXZ A;  3MJ5 A;  4QRX A;  3IHP A;  1AYU A;  2B1N A;  1AU0 A;  4BOP A;  3PRP A;  3O65 A;  2XU4 A;  1ZIV A;  3S3R A;  2BTW B;  2OZ2 A;  4QH6 A;  4YYQ A;  2Y6E A;  1KHP A;  3B79 A;  2FRQ A;  5CVN B;  3RNV A;  2PNS A;  4BPV A;  3H8B A;  1A6R A;  3F5V A;  3PT2 A;  1CV8 A;  4ZTB A;  4AXL A;  3PNR A;  4GUA A;  2NQD B;  3PSE A;  2DC8 A;  1ICF A;  1QOL A;  4REZ A;  1ZCM A;  1NPZ A;  2FE8 A;  2AYN A;  3TMP A;  3W30 A;  4G54 A;  3DF0 A;  4QBB A;  3ERV A;  8PCH A;  1EWM A;  3HHA A;  5EF4 A;  4OVZ B;  3BPM A;  3K8U A;  3WXF A;  4BQV A;  2R9N A;  2R9F A;  2P0R A;  2G8J A;  5CVO B;  3ZUA A;  1SNK A;  4MI7 A;  2JRI A;  2AIM A;  2E00 A;  4W5B A;  2VHS A;  4D8E A;  4N4Z A;  4P6E A;  2HH5 A;  2OUL A;  1STF E;  3GCB A;  3MTN A;  3WXE A;  1EWO A;  3U8E A;  1NB5 A;  4PI3 A;  4R3D A;  3IFU A;  2NQA A;  1YAL A;  4RF0 A;  1K3B B;  4WUR A;  1YK8 A;  4X6H A;  2GHU A;  3MHS A;  3E1Z B;  5JA7 A;  9PAP A;  1CQD A;  2E01 A;  3BPF A;  2OP3 A;  2BU3 A;  3NHE A;  3IUT A;  1JQP A;  4BOQ A;  2PBH A;  4QRG A;  4CZW A;  1KXR A;  3I06 A;  3IMA A;  1PIP A;  5FPW A;  2AUX A;  3C0R A;  4OEM A;  2HWK A;  3OF9 A;  4FIP A;  2DC6 A;  3BOW A;  3PHW A;  3RVV A;  4W5C A;  1YVB A;  4DMY A;  1M6D A;  4N8W A;  2G6D A;  4YV8 A;  4MSX A;  4W4U A;  1S4V A;  3H6S A;  5CHV A;  2DCC A;  3KWB X;  3MHH A;  1GCB A;  2FYE A;  3D6S A;  3S3Q A;  1PXV A;  1BY8 A;  4Q8G A;  1F29 A;  1GLO A;  4K7C A;  3OF8 A;  4FJC A;  1NLJ A;  1VJV A;  1U9V A;  1SP4 B;  1NB3 A;  2UZJ A;  4QRV A;  1GEC E;  2FRA A;  2R9C A;  1QXP A;  2DC7 A;  3MOR A;  1AIM A;  3PBH A;  7PCK A;  1CJL A;  1YZB A;  1MIR A;  1AYW A;  1DKI A;  2R9O A;  1BP4 A;  3I3T A;  4RY2 A;  2AVW A;  1YT7 A;  3PHU A;  1AU2 A;  2AYO A;  2IPP B;  2BDZ A;  4IUM A;  1PCI A;  5E6J A;  4RKX A;  4P6G A;  3KWZ A;  2E02 A;  4N79 A;  4X6I A;  3BB7 A;  5K16 A;  2YJ9 A;  3MP2 A;  2DZY A;  3QSD A;  2FUD A;  4M0W A;  1YK7 A;  3P5U A;  1X9Y A;  3USV A;  1PVJ A;  5EGW A;  3B21 A;  1PE6 A;  2DZZ A;  2G7Y A;  4Q8H A;  2AUZ A;  4OVZ A;  2F1G A;  3K9M A;  2E03 A;  3BC3 A;  5EZS A;  2GFO A;  4CDD B;  1BQI A;  2XU1 A;  3KW9 A;  4HWY A;  3K24 A;  1AYV A;  3N3K A;  1NL6 A;  3BY4 A;  1PPD A;  2PAD A;  4FK5 A;  3V6C A;  1NQC A;  5PAD A;  3W31 A;  1PAD A;  5CHT A;  3O0U A;  4I04 A;  2AS8 A;  3BCN A;  3CBK A;  5F02 A;  3HD3 A;  1F2A A;  2P86 A;  2DJF B;  1CS8 A;  1CB5 A;  2YJC A;  2WBF X;  3RVX A;  4XZX A;  4CDC B;  1QMY A;  2NQI A;  3P5V A;  2R6N A;  1PPP A;  3C9E A;  1AU3 A;  2O6X A;  3PRM A;  2JTC A;  3H7D A;  2CB5 A;  4OW0 A;  3PHX A;  1O0E A;  5JZE A;  3H8C A;  3QT4 A;  1FH0 A;  3KSE A;  3N3G A;  4PP2 E;  2XU5 A;  4A5U A;  4MZO A;  4PT5 A;  1BGO A;  2G8E A;  3O1G A;  2YJB A;  3KX1 A;  3H89 A;  4IP3 A;  4PP1 A;  5EZQ A;  1TL9 A;  3IV2 A;  1TLO A;  4YVA A;  2XU3 A;  6PAD A;  4YYW A;  3P5X A;  2DJG B;  3CH2 X;  4WA6 A;  2NQG A;  1CPJ A;  1CSB B;  2J7Q A;  4D8I A;  4CDF B;  3N4C A;  1THE A;  2FO5 A;  1Y4H A;  1ME4 A;  2C0Y A;  2FT2 A;  2YJ2 A;  1F2B A;  2BTW A;  4CDE B;  5KO3 A;  1AU4 A;  2ACT A;  3M99 A;  2F7D A;  1DF0 A;  3CH3 X;  2VHF A;  4XR7 A;  1DEU A;  3OVX A;  1POP A;  4P16 A;  2JQG R;  4YYU A;  2DCA A;  1U9Q X;  1MEM A;  5CVM A;  2AGA A;  1U5I A;  1VSN A;  1Q6K A;  4YYS A;  1MEG A;  4I07 A;  4BOU A;  2Y5B A;  2DCB A;  1CTE A;  3LFY A;  1EF7 A;  1MHW A;  3OVZ A;  4D8B A;  1HUC B;  3IOQ A;  1PBH A;  3CBJ A;  2BDL A;  3IEJ A;  2DCD A;  1UKF A;  1Y08 A;  1AEC A;  2ATO A;  4RNA A;  3LXS A;  4I05 A;  2PRE A;  2R9M A;  4OEL A;  3BBA A;  4AXM A;  5J94 A;  3WXG A;  1ME3 A;  1ATK A;  3V6E A;  5A24 A;  3KKU A;  4BOS A;  3PDF A;  3F75 A;  2DOS A;  3ZNH A;  1U9W A;  4MM3 B;  3HWN A;  3PW3 A;  4YYV A;  2B1M A;  1XKG A;  2Z84 A;  3AI8 A;  2P7U A;  1ITO A;  4PAD A;  3BWK A;  5JH3 A;  3KFQ A;  3RVW A;  2JQF R;  3OQC A;  2J7Q C;  3E9S A;  1EWP A;  1MDW A;  3MTV A;  4ZUX U;  1PPN A;  1PPO A;  2HD5 A;  3HHI A;  2FTD A;  4YYR A;  3QJ3 A;  2DC9 A;  4KLB A;  2ARY A;  4X6J A;  1IWD A;  1MS6 A;  3OIS A;  4RF1 A;  1TU6 A;  2FQ9 A;  2AU1 A;  4BOZ A;  1F2C A;  4XUI A;  1GMY A;  1KHQ A;  1QDQ A;  2H7J A;  3TNX A;  4HXD B;  1KFX L;  2CIO A;  4MZS A;  3TRK A;  4BS5 A;  3P5W A;  4DMX A;  2HHN A;  2IBI A;  4BSQ A;  4BS6 A;  2YJ8 A; 
#chains in the Genus database with same CATH homology
 1KFU L;  1CVZ A;  1EWL A;  1U9X A;  2HXZ A;  4NV7 A;  4QRX A;  3IHP A;  4B55 A;  1AYU A;  2B1N A;  1AU0 A;  2XU4 A;  1ZIV A;  3S3R A;  2OZ2 A;  4QH6 A;  4YYQ A;  2Y6E A;  1KHP A;  3B79 A;  2FRQ A;  5CVN B;  2PNS A;  4BPV A;  3H8B A;  1A6R A;  3F5V A;  1CV8 A;  4AXL A;  3PNR A;  2NQD B;  2DC8 A;  1ICF A;  1QOL A;  1ZCM A;  1NPZ A;  2AYN A;  4G54 A;  3DF0 A;  4QBB A;  3ERV A;  8PCH A;  1EWM A;  3HHA A;  5EF4 A;  3BPM A;  3K8U A;  3WXF A;  4BQV A;  2R9N A;  2R9F A;  2P0R A;  2G8J A;  5CVO B;  3ZUA A;  1SNK A;  2AIM A;  2E00 A;  4W5B A;  2VHS A;  4N4Z A;  4P6E A;  2HH5 A;  2OUL A;  1STF E;  3GCB A;  3MTN A;  3WXE A;  1EWO A;  3U8E A;  1NB5 A;  4PI3 A;  2NQA A;  4NV8 A;  1YAL A;  1K3B B;  1YK8 A;  4X6H A;  2GHU A;  3MHS A;  3E1Z B;  5JA7 A;  9PAP A;  1CQD A;  2E01 A;  3BPF A;  2OP3 A;  3NHE A;  3IUT A;  1JQP A;  2PBH A;  4QRG A;  4CZW A;  1KXR A;  3I06 A;  3IMA A;  1PIP A;  5FPW A;  2AUX A;  4OEM A;  3OF9 A;  3LTW A;  4FIP A;  2DC6 A;  3D9W A;  3BOW A;  3RVV A;  4W5C A;  1YVB A;  4DMY A;  1M6D A;  4N8W A;  2G6D A;  4BGF A;  4YV8 A;  4MSX A;  4W4U A;  1S4V A;  3H6S A;  5CHV A;  2DCC A;  3KWB X;  3MHH A;  1GCB A;  2FYE A;  3D6S A;  3S3Q A;  1PXV A;  1BY8 A;  4Q8G A;  1F29 A;  1GLO A;  4K7C A;  3OF8 A;  4FJC A;  1NLJ A;  1VJV A;  1U9V A;  1SP4 B;  1NB3 A;  4QRV A;  1GEC E;  2FRA A;  2R9C A;  1QXP A;  2DC7 A;  3MOR A;  1AIM A;  3PBH A;  7PCK A;  1CJL A;  1MIR A;  1AYW A;  2R9O A;  1BP4 A;  3I3T A;  4RY2 A;  2AVW A;  1YT7 A;  1AU2 A;  2AYO A;  2IPP B;  2BDZ A;  1PCI A;  4P6G A;  3KWZ A;  2E02 A;  4N79 A;  4X6I A;  5K16 A;  2YJ9 A;  2DZY A;  3QSD A;  2FUD A;  1YK7 A;  3P5U A;  1X9Y A;  3USV A;  5EGW A;  1PE6 A;  2DZZ A;  2G7Y A;  4Q8H A;  2AUZ A;  2F1G A;  3K9M A;  2E03 A;  3BC3 A;  2GFO A;  4CDD B;  1BQI A;  2XU1 A;  3KW9 A;  4HWY A;  2VFC A;  3K24 A;  1AYV A;  3N3K A;  1NL6 A;  1PPD A;  2PAD A;  4FK5 A;  3V6C A;  1NQC A;  5PAD A;  1PAD A;  1W4T A;  5CHT A;  3O0U A;  4I04 A;  2AS8 A;  3BCN A;  1W5R A;  3CBK A;  5F02 A;  3HD3 A;  1F2A A;  2P86 A;  2DJF B;  1CS8 A;  1CB5 A;  2YJC A;  2WBF X;  3RVX A;  4CDC B;  1QMY A;  2NQI A;  3P5V A;  2R6N A;  1PPP A;  3C9E A;  1AU3 A;  2O6X A;  3H7D A;  2CB5 A;  1O0E A;  3H8C A;  3QT4 A;  1FH0 A;  3KSE A;  2BSZ A;  3N3G A;  4PP2 E;  2XU5 A;  4MZO A;  1BGO A;  2G8E A;  3O1G A;  2YJB A;  3KX1 A;  3H89 A;  4PP1 A;  1TL9 A;  3IV2 A;  1TLO A;  4YVA A;  2XU3 A;  6PAD A;  4YYW A;  3P5X A;  2DJG B;  3CH2 X;  4GUZ A;  4WA6 A;  2NQG A;  1CPJ A;  1CSB B;  4CDF B;  3N4C A;  1THE A;  2FO5 A;  1W6F A;  1Y4H A;  1ME4 A;  2C0Y A;  2FT2 A;  2YJ2 A;  1F2B A;  4CDE B;  1E2T A;  1AU4 A;  2ACT A;  3M99 A;  2F7D A;  4C5P A;  1DF0 A;  3CH3 X;  2VHF A;  4XR7 A;  1DEU A;  3OVX A;  1POP A;  2JQG R;  4YYU A;  2DCA A;  1U9Q X;  1MEM A;  5CVM A;  1U5I A;  1VSN A;  1Q6K A;  4YYS A;  1MEG A;  4I07 A;  2Y5B A;  2DCB A;  1CTE A;  3LFY A;  1EF7 A;  1MHW A;  3OVZ A;  1HUC B;  3IOQ A;  1PBH A;  3CBJ A;  2BDL A;  3IEJ A;  2DCD A;  1Y08 A;  1AEC A;  2ATO A;  3LXS A;  4I05 A;  2PRE A;  2R9M A;  4OEL A;  4AXM A;  5J94 A;  3WXG A;  1ME3 A;  1ATK A;  3V6E A;  5A24 A;  3KKU A;  3PDF A;  3F75 A;  1U9W A;  3HWN A;  3PW3 A;  4YYV A;  2VFB A;  2B1M A;  1XKG A;  3AI8 A;  2P7U A;  1ITO A;  4PAD A;  3BWK A;  5JH3 A;  3KFQ A;  3RVW A;  2JQF R;  1EWP A;  1MDW A;  4ZUX U;  1PPN A;  1PPO A;  2HD5 A;  3HHI A;  2FTD A;  4YYR A;  3QJ3 A;  2DC9 A;  4KLB A;  2ARY A;  4X6J A;  1IWD A;  1MS6 A;  3OIS A;  1TU6 A;  2FQ9 A;  2AU1 A;  1F2C A;  4XUI A;  1GMY A;  1KHQ A;  1QDQ A;  2H7J A;  3TNX A;  1GX3 A;  1KFX L;  2CIO A;  4MZS A;  4BS5 A;  3P5W A;  4DMX A;  2HHN A;  2IBI A;  4BSQ A;  4BS6 A;  2YJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...