3B79A

Crystal structure of the n-terminal peptidase c39 like domain of the toxin secretion atp-binding protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
AMKDPLLNSLIYVSRYYGLANSPEALVNGLPLSDGKLTPFLLPRAAERAGLVAKENRAELEKISSLILPAILVLKGGDSCVLNSINMETREAEVTTLESGMVPISIPLEDLLEQYTGRYFLVKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal peptidase C39 like domain of the toxin secretion ATP-binding protein from Vibrio parahaemolyticus.
rcsb
molecule keywords Toxin secretion ATP-binding protein
molecule tags Nucleotide binding protein
source organism Vibrio parahaemolyticus rimd 2210633
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3b79A00
2FUDA 1CQDA 1PXVA 3K9MA 1KHQA 1SNKA 1U9QX 3USVA 3P5WA 1O0EA 3I3TA 3O1GA 4XR7A 3OVZA 2R9OA 4MZOA 1HUCB 4QRXA 1BY8A 1BGOA 3GCBA 4I07A 1YALA 3M99A 1MEGA 3E1ZB 1ME4A 3OVXA 3K8UA 2DCAA 2E02A 2G7YA 2G8EA 1STFE 4Q8HA 4FK5A 2DJFB 4P6GA 2P86A 1QXPA 1JQPA 1VJVA 1AYUA 2XU5A 5EF4A 2DC8A 1POPA 3IV2A 4YYWA 1GLOA 4MSXA 2IBIA 4X6JA 2OP3A 1NPZA 1NB5A 2FQ9A 4PP1A 2O6XA 4N79A 1PPPA 2G6DA 2FO5A 1YK7A 2C0YA 3F5VA 1IWDA 3P5UA 4CZWA 3K24A 2OULA 3B79A 4W4UA 3C9EA 2E00A 2G8JA 5EGWA 1Y4HA 3BCNA 3IEJA 4HWYA 2AYOA 2H7JA 4FIPA 3IHPA 2F1GA 1KXRA 4FJCA 5PADA 4AXLA 2NQGA 3OF9A 1CB5A 3PDFA 1DEUA 4K7CA 4YYSA 1CPJA 1PE6A 2R9FA 2XU4A 1ITOA 3TNXA 2XU3A 2HH5A 3QT4A 2WBFX 3AI8A 1BP4A 2AU1A 1Q6KA 2R9MA 2R6NA 1MEMA 5F02A 3HHAA 1QMYA 1EF7A 1U9WA 2PNSA 1QDQA 2R9NA 4YYQA 3IOQA 3RVWA 4BPVA 1MHWA 3QJ3A 2IPPB 2F7DA 4BS6A 1CJLA 1PCIA 1ME3A 2GFOA 3CH2X 1KFUL 2YJBA 1QOLA 1ATKA 8PCHA 4DMXA 9PAPA 3CBJA 3ZUAA 2CIOA 1EWMA 1A6RA 3P5XA 4BQVA 4I05A 1ZIVA 2AYNA 2PADA 1X9YA 2VHSA 3HWNA 3OISA 4CDEB 3MORA 2HHNA 2FRQA 1CV8A 1F2AA 1GMYA 2Y5BA 3CBKA 2B1MA 3V6EA 4BS5A 3NHEA 1F2BA 2ARYA 3DF0A 1SP4B 2AUXA 2YJ9A 6PADA 4PI3A 5CHTA 2HD5A 2FYEA 1TL9A 2Y6EA 5K16A 3KSEA 4CDFB 3BPFA 4YV8A 3LXSA 5A24A 4Q8GA 1GCBA 2VHFA 3WXFA 1TLOA 1NB3A 4QH6A 2NQDB 3HHIA 5JA7A 4DMYA 1TU6A 1MS6A 3F75A 3KWZA 1EWLA 4W5BA 3WXEA 1DF0A 1NL6A 2NQIA 2BDZA 3WXGA 1AYVA 1CVZA 1PBHA 2CB5A 3PNRA 1EWOA 1S4VA 1K3BB 4I04A 4CDCB 3N4CA 3V6CA 3S3QA 2E01A 3H8CA 2HXZA 4YYUA 2BDLA 2DCCA 2DCDA 4X6HA 1U9VA 3KKUA 3S3RA 2AIMA 1YK8A 3D6SA 1PPNA 5J94A 1MIRA 4ZUXU 3BPMA 4RY2A 4G54A 4BSQA 3N3KA 4N8WA 2GHUA 1YT7A 4YYRA 1FH0A 1AYWA 1AU3A 2ACTA 1U5IA 4YVAA 3ERVA 2DC6A 3LFYA 3RVVA 2NQAA 4QRVA 4CDDB 1F2CA 2FTDA 1CS8A 1Y08A 2XU1A 1CTEA 2DCBA 4AXMA 3RVXA 3QSDA 2JQGR 3KX1A 3H8BA 1XKGA 3H6SA 3N3GA 3H7DA 1F29A 1GECE 2DZYA 3U8EA 2DJGB 3PW3A 1AIMA 1AECA 3BOWA 1ICFA 3BC3A 4YYVA 1U9XA 3MHHA 2YJ8A 1KHPA 4WA6A 1ZCMA 1PADA 4QRGA 3HD3A 4PP2E 7PCKA 3I06A 2AVWA 1MDWA 1VSNA 2DC9A 5CVOB 2DC7A 1AU2A 1AU0A 4OEMA 4W5CA 4X6IA 1PIPA 3PBHA 3KW9A 1NQCA 2P7UA 2R9CA 2YJ2A 1NLJA 1M6DA 1KFXL 2P0RA 2ATOA 3CH3X 3O0UA 3P5VA 2AS8A 4KLBA 2PBHA 1EWPA 4MZSA 3MTNA 3KWBX 2DZZA 2E03A 5FPWA 5CVMA 1BQIA 1THEA 1PPOA 5CVNB 3OF8A 3MHSA 3IMAA 4PADA 4N4ZA 4P6EA 4XUIA 2JQFR 1AU4A 3IUTA 1YVBA 3KFQA 2FT2A 5CHVA 2PREA 2B1NA 1CSBB 3H89A 1PPDA 4OELA 2YJCA 2OZ2A 2FRAA 2AUZA 3BWKA 5JH3A 4QBBA
chains in the Genus database with same CATH superfamily
2FUDA 1CQDA 4BOQA 1PXVA 3K9MA 1KHQA 2FE8A 1SNKA 1U9QX 3USVA 3P5WA 1O0EA 3I3TA 3O1GA 4XR7A 3OVZA 3BY4A 3E9SA 2R9OA 4MZOA 1HUCB 4QRXA 1BY8A 1BGOA 3GCBA 4I07A 2UZJA 1YALA 3M99A 1MEGA 3E1ZB 1ME4A 3OVXA 3K8UA 2DCAA 2E02A 2G7YA 2G8EA 1STFE 4Q8HA 4FK5A 4HXDB 2DJFB 4P6GA 2P86A 1QXPA 1JQPA 1VJVA 1AYUA 2XU5A 5EF4A 2DC8A 1POPA 3IV2A 4YYWA 1GLOA 4MSXA 2IBIA 4X6JA 2OP3A 1NPZA 2BTWA 1NB5A 2FQ9A 4XZXA 4PP1A 2O6XA 5EZSA 4N79A 1PPPA 2G6DA 2FO5A 1YK7A 2C0YA 3F5VA 1IWDA 3P5UA 2JRIA 4CZWA 3K24A 2OULA 3B79A 4W4UA 3C9EA 2E00A 2G8JA 4BOSA 5EGWA 1Y4HA 3BCNA 3BBAA 3IEJA 4HWYA 2AYOA 2H7JA 4FIPA 3W31A 3MJ5A 3IHPA 4GUAA 4BOUA 2BU3A 2F1GA 1KXRA 4FJCA 5PADA 4AXLA 2NQGA 3OF9A 1PVJA 1CB5A 3PDFA 1DEUA 3PHUA 4K7CA 4YYSA 3TRKA 4D8BA 1CPJA 1PE6A 2R9FA 2XU4A 1ITOA 3TNXA 2XU3A 2HH5A 3QT4A 2WBFX 3AI8A 1BP4A 5KO3A 3MP2A 2AU1A 1Q6KA 3TMPA 2R9MA 2R6NA 1MEMA 5F02A 3HHAA 1QMYA 1EF7A 1U9WA 1DKIA 2PNSA 1QDQA 2R9NA 4YYQA 3IOQA 3RVWA 4BPVA 1MHWA 3QJ3A 4WURA 2IPPB 2F7DA 4BS6A 1CJLA 4OVZA 1PCIA 1ME3A 2GFOA 3CH2X 4IUMA 1KFUL 2YJBA 1QOLA 1ATKA 8PCHA 4DMXA 3PHWA 9PAPA 3CBJA 3ZUAA 2CIOA 1EWMA 1A6RA 3P5XA 4BQVA 4I05A 1ZIVA 2AYNA 2PADA 1X9YA 2VHSA 3HWNA 3OISA 4CDEB 3BB7A 3MORA 2HHNA 3O65A 2FRQA 1CV8A 1F2AA 1GMYA 2Y5BA 3CBKA 2B1MA 3V6EA 4BS5A 3NHEA 1F2BA 2ARYA 3DF0A 1SP4B 2AUXA 2YJ9A 6PADA 4PI3A 5CHTA 2HD5A 2FYEA 3PSEA 2BTWB 1TL9A 2Y6EA 5K16A 3KSEA 4CDFB 3RNVA 3BPFA 2AGAA 3PT2A 4YV8A 3LXSA 5A24A 4Q8GA 1GCBA 2VHFA 3WXFA 4PT5A 1TLOA 1NB3A 4QH6A 2NQDB 3HHIA 5JA7A 4DMYA 1TU6A 2HWKA 1YZBA 1MS6A 3F75A 3KWZA 1EWLA 3C0RA 5E6JA 4W5BA 3WXEA 1DF0A 1NL6A 2NQIA 2BDZA 3WXGA 1AYVA 1CVZA 1PBHA 2CB5A 3PNRA 1EWOA 1S4VA 1K3BB 4I04A 4CDCB 3N4CA 4A5UA 3V6CA 4OW0A 3S3QA 2E01A 3H8CA 2HXZA 3PHXA 4REZA 4YYUA 2BDLA 2DCCA 2DCDA 4X6HA 1U9VA 4M0WA 4RNAA 3KKUA 3S3RA 2AIMA 1YK8A 3D6SA 1PPNA 5J94A 4D8IA 2J7QA 1MIRA 4ZUXU 3BPMA 4RY2A 4G54A 4BSQA 3ZNHA 3N3KA 4N8WA 2GHUA 1YT7A 4YYRA 3B21A 1FH0A 1AYWA 1AU3A 4OVZB 2ACTA 1U5IA 4YVAA 4ZTBA 3ERVA 2DC6A 3LFYA 4MI7A 3RVVA 3OQCA 2NQAA 4MM3B 4QRVA 4IP3A 4CDDB 1F2CA 2FTDA 1CS8A 1Y08A 2XU1A 1CTEA 2DCBA 4AXMA 3RVXA 3QSDA 2JQGR 3KX1A 3H8BA 1XKGA 3H6SA 3N3GA 3H7DA 1F29A 5JZEA 1GECE 3W30A 2DZYA 3IFUA 3U8EA 2DJGB 3PW3A 1AIMA 1AECA 3BOWA 1ICFA 3BC3A 4YYVA 1U9XA 3MHHA 2YJ8A 1KHPA 4WA6A 1UKFA 1ZCMA 1PADA 4QRGA 3HD3A 4PP2E 4BOZA 7PCKA 3I06A 2AVWA 4P16A 2Z84A 4D8EA 1MDWA 1VSNA 2DC9A 5CVOB 2DC7A 1AU2A 1AU0A 4OEMA 4W5CA 4X6IA 1PIPA 3PBHA 3KW9A 1NQCA 2P7UA 2R9CA 2YJ2A 1NLJA 1M6DA 1KFXL 2P0RA 2ATOA 4BOPA 3CH3X 3O0UA 3P5VA 2AS8A 4KLBA 2PBHA 4RF1A 4RKXA 1EWPA 4MZSA 3MTNA 3KWBX 2JTCA 2DZZA 2E03A 5FPWA 5CVMA 1BQIA 3PRPA 5EZQA 1THEA 1PPOA 5CVNB 3OF8A 3MHSA 3IMAA 4PADA 3PRMA 4N4ZA 4P6EA 2J7QC 4XUIA 2DOSA 2JQFR 1AU4A 3IUTA 1YVBA 3KFQA 2FT2A 5CHVA 2PREA 3MTVA 2B1NA 1CSBB 3H89A 1PPDA 4OELA 2YJCA 2OZ2A 4R3DA 2FRAA 4RF0A 2AUZA 3BWKA 5JH3A 4QBBA
chains in the Genus database with same CATH topology
2FUDA 1CQDA 1PXVA 3K9MA 1KHQA 1SNKA 1U9QX 3USVA 3P5WA 1O0EA 3I3TA 3O1GA 4XR7A 3OVZA 3LTWA 2R9OA 4MZOA 1HUCB 4QRXA 1BY8A 1BGOA 3GCBA 4I07A 1YALA 3M99A 1MEGA 3E1ZB 1ME4A 3OVXA 3K8UA 2DCAA 2E02A 2G7YA 2G8EA 1STFE 4Q8HA 4FK5A 2DJFB 4P6GA 1E2TA 2P86A 1QXPA 1JQPA 1VJVA 1AYUA 2XU5A 5EF4A 2DC8A 1POPA 3IV2A 4YYWA 1GLOA 4MSXA 2IBIA 1GX3A 4X6JA 2OP3A 1NPZA 1NB5A 2FQ9A 4PP1A 2O6XA 4N79A 1PPPA 2G6DA 2FO5A 1YK7A 2C0YA 3F5VA 1IWDA 4GUZA 3P5UA 4CZWA 3K24A 2OULA 3B79A 4W4UA 3C9EA 2E00A 2G8JA 5EGWA 1Y4HA 3BCNA 3IEJA 4HWYA 2AYOA 2H7JA 4FIPA 3IHPA 2F1GA 1KXRA 4FJCA 2VFCA 2VFBA 5PADA 4NV8A 4AXLA 2NQGA 3OF9A 1CB5A 3PDFA 1DEUA 4K7CA 4YYSA 1CPJA 1PE6A 2R9FA 2XU4A 1ITOA 4C5PA 3TNXA 2XU3A 2HH5A 3QT4A 2WBFX 3AI8A 1BP4A 2BSZA 2AU1A 1Q6KA 4BGFA 2R9MA 2R6NA 1MEMA 5F02A 3HHAA 1QMYA 1EF7A 1U9WA 2PNSA 1QDQA 2R9NA 4YYQA 3IOQA 3RVWA 4BPVA 1MHWA 3QJ3A 2IPPB 2F7DA 4BS6A 1CJLA 1PCIA 1ME3A 2GFOA 3CH2X 1KFUL 2YJBA 1QOLA 1ATKA 8PCHA 4DMXA 9PAPA 3CBJA 3ZUAA 2CIOA 1EWMA 1A6RA 3P5XA 4BQVA 4I05A 1ZIVA 2AYNA 2PADA 1X9YA 2VHSA 3HWNA 3OISA 4CDEB 3MORA 2HHNA 2FRQA 1CV8A 1F2AA 1GMYA 2Y5BA 3CBKA 2B1MA 3V6EA 4BS5A 3NHEA 1F2BA 2ARYA 3DF0A 1SP4B 2AUXA 2YJ9A 6PADA 4PI3A 5CHTA 2HD5A 2FYEA 1TL9A 2Y6EA 4B55A 5K16A 3KSEA 4CDFB 3BPFA 4YV8A 3LXSA 5A24A 4Q8GA 1GCBA 2VHFA 3WXFA 1TLOA 1NB3A 4QH6A 2NQDB 3HHIA 5JA7A 4DMYA 1TU6A 1MS6A 3F75A 3KWZA 1EWLA 4W5BA 3WXEA 1DF0A 1NL6A 2NQIA 2BDZA 3WXGA 1AYVA 1CVZA 1PBHA 2CB5A 3PNRA 1EWOA 1S4VA 1K3BB 4I04A 4CDCB 3N4CA 3V6CA 3S3QA 2E01A 3H8CA 2HXZA 1W5RA 4YYUA 2BDLA 2DCCA 2DCDA 4X6HA 1U9VA 3KKUA 3S3RA 2AIMA 1YK8A 3D6SA 1PPNA 5J94A 3D9WA 1MIRA 4ZUXU 3BPMA 4RY2A 4G54A 4BSQA 3N3KA 4N8WA 2GHUA 1YT7A 4YYRA 1FH0A 1AYWA 1AU3A 2ACTA 1U5IA 4YVAA 3ERVA 2DC6A 3LFYA 3RVVA 2NQAA 4QRVA 4CDDB 1F2CA 2FTDA 1CS8A 1Y08A 2XU1A 1CTEA 2DCBA 4AXMA 3RVXA 3QSDA 2JQGR 3KX1A 3H8BA 1XKGA 3H6SA 3N3GA 3H7DA 1F29A 1GECE 2DZYA 3U8EA 2DJGB 1W4TA 1AIMA 3PW3A 1AECA 3BOWA 1ICFA 3BC3A 4YYVA 1U9XA 1W6FA 3MHHA 2YJ8A 1KHPA 4WA6A 1ZCMA 1PADA 4QRGA 3HD3A 4PP2E 7PCKA 3I06A 2AVWA 1MDWA 1VSNA 2DC9A 5CVOB 2DC7A 1AU2A 1AU0A 4OEMA 4W5CA 4X6IA 1PIPA 3PBHA 3KW9A 1NQCA 2P7UA 2R9CA 2YJ2A 1NLJA 1M6DA 1KFXL 2P0RA 2ATOA 3CH3X 3O0UA 3P5VA 2AS8A 4KLBA 2PBHA 1EWPA 4MZSA 3MTNA 3KWBX 2DZZA 2E03A 5FPWA 5CVMA 1BQIA 1THEA 1PPOA 5CVNB 3OF8A 3MHSA 4NV7A 3IMAA 4PADA 4N4ZA 4P6EA 4XUIA 2JQFR 1AU4A 3IUTA 1YVBA 3KFQA 2FT2A 5CHVA 2PREA 2B1NA 1CSBB 3H89A 1PPDA 4OELA 2YJCA 2OZ2A 2FRAA 2AUZA 3BWKA 5JH3A 4QBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUD A;  1CQD A;  1PXV A;  3K9M A;  1KHQ A;  1SNK A;  1U9Q X;  3USV A;  3P5W A;  1O0E A;  3I3T A;  3O1G A;  4XR7 A;  3OVZ A;  2R9O A;  4MZO A;  1HUC B;  4QRX A;  1BY8 A;  1BGO A;  3GCB A;  4I07 A;  1YAL A;  3M99 A;  1MEG A;  3E1Z B;  1ME4 A;  3OVX A;  3K8U A;  2DCA A;  2E02 A;  2G7Y A;  2G8E A;  1STF E;  4Q8H A;  4FK5 A;  2DJF B;  4P6G A;  2P86 A;  1QXP A;  1JQP A;  1VJV A;  1AYU A;  2XU5 A;  5EF4 A;  2DC8 A;  1POP A;  3IV2 A;  4YYW A;  1GLO A;  4MSX A;  2IBI A;  4X6J A;  2OP3 A;  1NPZ A;  1NB5 A;  2FQ9 A;  4PP1 A;  2O6X A;  4N79 A;  1PPP A;  2G6D A;  2FO5 A;  1YK7 A;  2C0Y A;  3F5V A;  1IWD A;  3P5U A;  4CZW A;  3K24 A;  2OUL A;  3B79 A;  4W4U A;  3C9E A;  2E00 A;  2G8J A;  5EGW A;  1Y4H A;  3BCN A;  3IEJ A;  4HWY A;  2AYO A;  2H7J A;  4FIP A;  3IHP A;  2F1G A;  1KXR A;  4FJC A;  5PAD A;  4AXL A;  2NQG A;  3OF9 A;  1CB5 A;  3PDF A;  1DEU A;  4K7C A;  4YYS A;  1CPJ A;  1PE6 A;  2R9F A;  2XU4 A;  1ITO A;  3TNX A;  2XU3 A;  2HH5 A;  3QT4 A;  2WBF X;  3AI8 A;  1BP4 A;  2AU1 A;  1Q6K A;  2R9M A;  2R6N A;  1MEM A;  5F02 A;  3HHA A;  1QMY A;  1EF7 A;  1U9W A;  2PNS A;  1QDQ A;  2R9N A;  4YYQ A;  3IOQ A;  3RVW A;  4BPV A;  1MHW A;  3QJ3 A;  2IPP B;  2F7D A;  4BS6 A;  1CJL A;  1PCI A;  1ME3 A;  2GFO A;  3CH2 X;  1KFU L;  2YJB A;  1QOL A;  1ATK A;  8PCH A;  4DMX A;  9PAP A;  3CBJ A;  3ZUA A;  2CIO A;  1EWM A;  1A6R A;  3P5X A;  4BQV A;  4I05 A;  1ZIV A;  2AYN A;  2PAD A;  1X9Y A;  2VHS A;  3HWN A;  3OIS A;  4CDE B;  3MOR A;  2HHN A;  2FRQ A;  1CV8 A;  1F2A A;  1GMY A;  2Y5B A;  3CBK A;  2B1M A;  3V6E A;  4BS5 A;  3NHE A;  1F2B A;  2ARY A;  3DF0 A;  1SP4 B;  2AUX A;  2YJ9 A;  6PAD A;  4PI3 A;  5CHT A;  2HD5 A;  2FYE A;  1TL9 A;  2Y6E A;  5K16 A;  3KSE A;  4CDF B;  3BPF A;  4YV8 A;  3LXS A;  5A24 A;  4Q8G A;  1GCB A;  2VHF A;  3WXF A;  1TLO A;  1NB3 A;  4QH6 A;  2NQD B;  3HHI A;  5JA7 A;  4DMY A;  1TU6 A;  1MS6 A;  3F75 A;  3KWZ A;  1EWL A;  4W5B A;  3WXE A;  1DF0 A;  1NL6 A;  2NQI A;  2BDZ A;  3WXG A;  1AYV A;  1CVZ A;  1PBH A;  2CB5 A;  3PNR A;  1EWO A;  1S4V A;  1K3B B;  4I04 A;  4CDC B;  3N4C A;  3V6C A;  3S3Q A;  2E01 A;  3H8C A;  2HXZ A;  4YYU A;  2BDL A;  2DCC A;  2DCD A;  4X6H A;  1U9V A;  3KKU A;  3S3R A;  2AIM A;  1YK8 A;  3D6S A;  1PPN A;  5J94 A;  1MIR A;  4ZUX U;  3BPM A;  4RY2 A;  4G54 A;  4BSQ A;  3N3K A;  4N8W A;  2GHU A;  1YT7 A;  4YYR A;  1FH0 A;  1AYW A;  1AU3 A;  2ACT A;  1U5I A;  4YVA A;  3ERV A;  2DC6 A;  3LFY A;  3RVV A;  2NQA A;  4QRV A;  4CDD B;  1F2C A;  2FTD A;  1CS8 A;  1Y08 A;  2XU1 A;  1CTE A;  2DCB A;  4AXM A;  3RVX A;  3QSD A;  2JQG R;  3KX1 A;  3H8B A;  1XKG A;  3H6S A;  3N3G A;  3H7D A;  1F29 A;  1GEC E;  2DZY A;  3U8E A;  2DJG B;  3PW3 A;  1AIM A;  1AEC A;  3BOW A;  1ICF A;  3BC3 A;  4YYV A;  1U9X A;  3MHH A;  2YJ8 A;  1KHP A;  4WA6 A;  1ZCM A;  1PAD A;  4QRG A;  3HD3 A;  4PP2 E;  7PCK A;  3I06 A;  2AVW A;  1MDW A;  1VSN A;  2DC9 A;  5CVO B;  2DC7 A;  1AU2 A;  1AU0 A;  4OEM A;  4W5C A;  4X6I A;  1PIP A;  3PBH A;  3KW9 A;  1NQC A;  2P7U A;  2R9C A;  2YJ2 A;  1NLJ A;  1M6D A;  1KFX L;  2P0R A;  2ATO A;  3CH3 X;  3O0U A;  3P5V A;  2AS8 A;  4KLB A;  2PBH A;  1EWP A;  4MZS A;  3MTN A;  3KWB X;  2DZZ A;  2E03 A;  5FPW A;  5CVM A;  1BQI A;  1THE A;  1PPO A;  5CVN B;  3OF8 A;  3MHS A;  3IMA A;  4PAD A;  4N4Z A;  4P6E A;  4XUI A;  2JQF R;  1AU4 A;  3IUT A;  1YVB A;  3KFQ A;  2FT2 A;  5CHV A;  2PRE A;  2B1N A;  1CSB B;  3H89 A;  1PPD A;  4OEL A;  2YJC A;  2OZ2 A;  2FRA A;  2AUZ A;  3BWK A;  5JH3 A;  4QBB A; 
#chains in the Genus database with same CATH topology
 2FUD A;  1CQD A;  4BOQ A;  1PXV A;  3K9M A;  1KHQ A;  2FE8 A;  1SNK A;  1U9Q X;  3USV A;  3P5W A;  1O0E A;  3I3T A;  3O1G A;  4XR7 A;  3OVZ A;  3BY4 A;  3E9S A;  2R9O A;  4MZO A;  1HUC B;  4QRX A;  1BY8 A;  1BGO A;  3GCB A;  4I07 A;  2UZJ A;  1YAL A;  3M99 A;  1MEG A;  3E1Z B;  1ME4 A;  3OVX A;  3K8U A;  2DCA A;  2E02 A;  2G7Y A;  2G8E A;  1STF E;  4Q8H A;  4FK5 A;  4HXD B;  2DJF B;  4P6G A;  2P86 A;  1QXP A;  1JQP A;  1VJV A;  1AYU A;  2XU5 A;  5EF4 A;  2DC8 A;  1POP A;  3IV2 A;  4YYW A;  1GLO A;  4MSX A;  2IBI A;  4X6J A;  2OP3 A;  1NPZ A;  2BTW A;  1NB5 A;  2FQ9 A;  4XZX A;  4PP1 A;  2O6X A;  5EZS A;  4N79 A;  1PPP A;  2G6D A;  2FO5 A;  1YK7 A;  2C0Y A;  3F5V A;  1IWD A;  3P5U A;  2JRI A;  4CZW A;  3K24 A;  2OUL A;  3B79 A;  4W4U A;  3C9E A;  2E00 A;  2G8J A;  4BOS A;  5EGW A;  1Y4H A;  3BCN A;  3BBA A;  3IEJ A;  4HWY A;  2AYO A;  2H7J A;  4FIP A;  3W31 A;  3MJ5 A;  3IHP A;  4GUA A;  4BOU A;  2BU3 A;  2F1G A;  1KXR A;  4FJC A;  5PAD A;  4AXL A;  2NQG A;  3OF9 A;  1PVJ A;  1CB5 A;  3PDF A;  1DEU A;  3PHU A;  4K7C A;  4YYS A;  3TRK A;  4D8B A;  1CPJ A;  1PE6 A;  2R9F A;  2XU4 A;  1ITO A;  3TNX A;  2XU3 A;  2HH5 A;  3QT4 A;  2WBF X;  3AI8 A;  1BP4 A;  5KO3 A;  3MP2 A;  2AU1 A;  1Q6K A;  3TMP A;  2R9M A;  2R6N A;  1MEM A;  5F02 A;  3HHA A;  1QMY A;  1EF7 A;  1U9W A;  1DKI A;  2PNS A;  1QDQ A;  2R9N A;  4YYQ A;  3IOQ A;  3RVW A;  4BPV A;  1MHW A;  3QJ3 A;  4WUR A;  2IPP B;  2F7D A;  4BS6 A;  1CJL A;  4OVZ A;  1PCI A;  1ME3 A;  2GFO A;  3CH2 X;  4IUM A;  1KFU L;  2YJB A;  1QOL A;  1ATK A;  8PCH A;  4DMX A;  3PHW A;  9PAP A;  3CBJ A;  3ZUA A;  2CIO A;  1EWM A;  1A6R A;  3P5X A;  4BQV A;  4I05 A;  1ZIV A;  2AYN A;  2PAD A;  1X9Y A;  2VHS A;  3HWN A;  3OIS A;  4CDE B;  3BB7 A;  3MOR A;  2HHN A;  3O65 A;  2FRQ A;  1CV8 A;  1F2A A;  1GMY A;  2Y5B A;  3CBK A;  2B1M A;  3V6E A;  4BS5 A;  3NHE A;  1F2B A;  2ARY A;  3DF0 A;  1SP4 B;  2AUX A;  2YJ9 A;  6PAD A;  4PI3 A;  5CHT A;  2HD5 A;  2FYE A;  3PSE A;  2BTW B;  1TL9 A;  2Y6E A;  5K16 A;  3KSE A;  4CDF B;  3RNV A;  3BPF A;  2AGA A;  3PT2 A;  4YV8 A;  3LXS A;  5A24 A;  4Q8G A;  1GCB A;  2VHF A;  3WXF A;  4PT5 A;  1TLO A;  1NB3 A;  4QH6 A;  2NQD B;  3HHI A;  5JA7 A;  4DMY A;  1TU6 A;  2HWK A;  1YZB A;  1MS6 A;  3F75 A;  3KWZ A;  1EWL A;  3C0R A;  5E6J A;  4W5B A;  3WXE A;  1DF0 A;  1NL6 A;  2NQI A;  2BDZ A;  3WXG A;  1AYV A;  1CVZ A;  1PBH A;  2CB5 A;  3PNR A;  1EWO A;  1S4V A;  1K3B B;  4I04 A;  4CDC B;  3N4C A;  4A5U A;  3V6C A;  4OW0 A;  3S3Q A;  2E01 A;  3H8C A;  2HXZ A;  3PHX A;  4REZ A;  4YYU A;  2BDL A;  2DCC A;  2DCD A;  4X6H A;  1U9V A;  4M0W A;  4RNA A;  3KKU A;  3S3R A;  2AIM A;  1YK8 A;  3D6S A;  1PPN A;  5J94 A;  4D8I A;  2J7Q A;  1MIR A;  4ZUX U;  3BPM A;  4RY2 A;  4G54 A;  4BSQ A;  3ZNH A;  3N3K A;  4N8W A;  2GHU A;  1YT7 A;  4YYR A;  3B21 A;  1FH0 A;  1AYW A;  1AU3 A;  4OVZ B;  2ACT A;  1U5I A;  4YVA A;  4ZTB A;  3ERV A;  2DC6 A;  3LFY A;  4MI7 A;  3RVV A;  3OQC A;  2NQA A;  4MM3 B;  4QRV A;  4IP3 A;  4CDD B;  1F2C A;  2FTD A;  1CS8 A;  1Y08 A;  2XU1 A;  1CTE A;  2DCB A;  4AXM A;  3RVX A;  3QSD A;  2JQG R;  3KX1 A;  3H8B A;  1XKG A;  3H6S A;  3N3G A;  3H7D A;  1F29 A;  5JZE A;  1GEC E;  3W30 A;  2DZY A;  3IFU A;  3U8E A;  2DJG B;  3PW3 A;  1AIM A;  1AEC A;  3BOW A;  1ICF A;  3BC3 A;  4YYV A;  1U9X A;  3MHH A;  2YJ8 A;  1KHP A;  4WA6 A;  1UKF A;  1ZCM A;  1PAD A;  4QRG A;  3HD3 A;  4PP2 E;  4BOZ A;  7PCK A;  3I06 A;  2AVW A;  4P16 A;  2Z84 A;  4D8E A;  1MDW A;  1VSN A;  2DC9 A;  5CVO B;  2DC7 A;  1AU2 A;  1AU0 A;  4OEM A;  4W5C A;  4X6I A;  1PIP A;  3PBH A;  3KW9 A;  1NQC A;  2P7U A;  2R9C A;  2YJ2 A;  1NLJ A;  1M6D A;  1KFX L;  2P0R A;  2ATO A;  4BOP A;  3CH3 X;  3O0U A;  3P5V A;  2AS8 A;  4KLB A;  2PBH A;  4RF1 A;  4RKX A;  1EWP A;  4MZS A;  3MTN A;  3KWB X;  2JTC A;  2DZZ A;  2E03 A;  5FPW A;  5CVM A;  1BQI A;  3PRP A;  5EZQ A;  1THE A;  1PPO A;  5CVN B;  3OF8 A;  3MHS A;  3IMA A;  4PAD A;  3PRM A;  4N4Z A;  4P6E A;  2J7Q C;  4XUI A;  2DOS A;  2JQF R;  1AU4 A;  3IUT A;  1YVB A;  3KFQ A;  2FT2 A;  5CHV A;  2PRE A;  3MTV A;  2B1N A;  1CSB B;  3H89 A;  1PPD A;  4OEL A;  2YJC A;  2OZ2 A;  4R3D A;  2FRA A;  4RF0 A;  2AUZ A;  3BWK A;  5JH3 A;  4QBB A; 
#chains in the Genus database with same CATH homology
 2FUD A;  1CQD A;  1PXV A;  3K9M A;  1KHQ A;  1SNK A;  1U9Q X;  3USV A;  3P5W A;  1O0E A;  3I3T A;  3O1G A;  4XR7 A;  3OVZ A;  3LTW A;  2R9O A;  4MZO A;  1HUC B;  4QRX A;  1BY8 A;  1BGO A;  3GCB A;  4I07 A;  1YAL A;  3M99 A;  1MEG A;  3E1Z B;  1ME4 A;  3OVX A;  3K8U A;  2DCA A;  2E02 A;  2G7Y A;  2G8E A;  1STF E;  4Q8H A;  4FK5 A;  2DJF B;  4P6G A;  1E2T A;  2P86 A;  1QXP A;  1JQP A;  1VJV A;  1AYU A;  2XU5 A;  5EF4 A;  2DC8 A;  1POP A;  3IV2 A;  4YYW A;  1GLO A;  4MSX A;  2IBI A;  1GX3 A;  4X6J A;  2OP3 A;  1NPZ A;  1NB5 A;  2FQ9 A;  4PP1 A;  2O6X A;  4N79 A;  1PPP A;  2G6D A;  2FO5 A;  1YK7 A;  2C0Y A;  3F5V A;  1IWD A;  4GUZ A;  3P5U A;  4CZW A;  3K24 A;  2OUL A;  3B79 A;  4W4U A;  3C9E A;  2E00 A;  2G8J A;  5EGW A;  1Y4H A;  3BCN A;  3IEJ A;  4HWY A;  2AYO A;  2H7J A;  4FIP A;  3IHP A;  2F1G A;  1KXR A;  4FJC A;  2VFC A;  2VFB A;  5PAD A;  4NV8 A;  4AXL A;  2NQG A;  3OF9 A;  1CB5 A;  3PDF A;  1DEU A;  4K7C A;  4YYS A;  1CPJ A;  1PE6 A;  2R9F A;  2XU4 A;  1ITO A;  4C5P A;  3TNX A;  2XU3 A;  2HH5 A;  3QT4 A;  2WBF X;  3AI8 A;  1BP4 A;  2BSZ A;  2AU1 A;  1Q6K A;  4BGF A;  2R9M A;  2R6N A;  1MEM A;  5F02 A;  3HHA A;  1QMY A;  1EF7 A;  1U9W A;  2PNS A;  1QDQ A;  2R9N A;  4YYQ A;  3IOQ A;  3RVW A;  4BPV A;  1MHW A;  3QJ3 A;  2IPP B;  2F7D A;  4BS6 A;  1CJL A;  1PCI A;  1ME3 A;  2GFO A;  3CH2 X;  1KFU L;  2YJB A;  1QOL A;  1ATK A;  8PCH A;  4DMX A;  9PAP A;  3CBJ A;  3ZUA A;  2CIO A;  1EWM A;  1A6R A;  3P5X A;  4BQV A;  4I05 A;  1ZIV A;  2AYN A;  2PAD A;  1X9Y A;  2VHS A;  3HWN A;  3OIS A;  4CDE B;  3MOR A;  2HHN A;  2FRQ A;  1CV8 A;  1F2A A;  1GMY A;  2Y5B A;  3CBK A;  2B1M A;  3V6E A;  4BS5 A;  3NHE A;  1F2B A;  2ARY A;  3DF0 A;  1SP4 B;  2AUX A;  2YJ9 A;  6PAD A;  4PI3 A;  5CHT A;  2HD5 A;  2FYE A;  1TL9 A;  2Y6E A;  4B55 A;  5K16 A;  3KSE A;  4CDF B;  3BPF A;  4YV8 A;  3LXS A;  5A24 A;  4Q8G A;  1GCB A;  2VHF A;  3WXF A;  1TLO A;  1NB3 A;  4QH6 A;  2NQD B;  3HHI A;  5JA7 A;  4DMY A;  1TU6 A;  1MS6 A;  3F75 A;  3KWZ A;  1EWL A;  4W5B A;  3WXE A;  1DF0 A;  1NL6 A;  2NQI A;  2BDZ A;  3WXG A;  1AYV A;  1CVZ A;  1PBH A;  2CB5 A;  3PNR A;  1EWO A;  1S4V A;  1K3B B;  4I04 A;  4CDC B;  3N4C A;  3V6C A;  3S3Q A;  2E01 A;  3H8C A;  2HXZ A;  1W5R A;  4YYU A;  2BDL A;  2DCC A;  2DCD A;  4X6H A;  1U9V A;  3KKU A;  3S3R A;  2AIM A;  1YK8 A;  3D6S A;  1PPN A;  5J94 A;  3D9W A;  1MIR A;  4ZUX U;  3BPM A;  4RY2 A;  4G54 A;  4BSQ A;  3N3K A;  4N8W A;  2GHU A;  1YT7 A;  4YYR A;  1FH0 A;  1AYW A;  1AU3 A;  2ACT A;  1U5I A;  4YVA A;  3ERV A;  2DC6 A;  3LFY A;  3RVV A;  2NQA A;  4QRV A;  4CDD B;  1F2C A;  2FTD A;  1CS8 A;  1Y08 A;  2XU1 A;  1CTE A;  2DCB A;  4AXM A;  3RVX A;  3QSD A;  2JQG R;  3KX1 A;  3H8B A;  1XKG A;  3H6S A;  3N3G A;  3H7D A;  1F29 A;  1GEC E;  2DZY A;  3U8E A;  2DJG B;  1W4T A;  1AIM A;  3PW3 A;  1AEC A;  3BOW A;  1ICF A;  3BC3 A;  4YYV A;  1U9X A;  1W6F A;  3MHH A;  2YJ8 A;  1KHP A;  4WA6 A;  1ZCM A;  1PAD A;  4QRG A;  3HD3 A;  4PP2 E;  7PCK A;  3I06 A;  2AVW A;  1MDW A;  1VSN A;  2DC9 A;  5CVO B;  2DC7 A;  1AU2 A;  1AU0 A;  4OEM A;  4W5C A;  4X6I A;  1PIP A;  3PBH A;  3KW9 A;  1NQC A;  2P7U A;  2R9C A;  2YJ2 A;  1NLJ A;  1M6D A;  1KFX L;  2P0R A;  2ATO A;  3CH3 X;  3O0U A;  3P5V A;  2AS8 A;  4KLB A;  2PBH A;  1EWP A;  4MZS A;  3MTN A;  3KWB X;  2DZZ A;  2E03 A;  5FPW A;  5CVM A;  1BQI A;  1THE A;  1PPO A;  5CVN B;  3OF8 A;  3MHS A;  4NV7 A;  3IMA A;  4PAD A;  4N4Z A;  4P6E A;  4XUI A;  2JQF R;  1AU4 A;  3IUT A;  1YVB A;  3KFQ A;  2FT2 A;  5CHV A;  2PRE A;  2B1N A;  1CSB B;  3H89 A;  1PPD A;  4OEL A;  2YJC A;  2OZ2 A;  2FRA A;  2AUZ A;  3BWK A;  5JH3 A;  4QBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...