3LFYA

Ctd of tarocystatin in complex with papain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex structure of tarocystatin with papain and characterization of tarocystatin proposed the role of C-terminal extension for inhibitory mechanism of group-2 phytocystatins
rcsb
molecule tags Hydrolase
molecule keywords Papain
total genus 61
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lfyA00
4X6IA 1GCBA 2R9CA 3WXEA 4QRGA 4QH6A 3BWKA 4QRXA 1A6RA 5CVNB 4OEMA 1CV8A 2DC8A 2YJCA 1KFUL 1ZIVA 2E02A 1AYVA 4MZOA 3H8BA 1F2AA 2GFOA 3IEJA 2B1NA 1PADA 1MIRA 3D6SA 2OZ2A 3M99A 2R9FA 1PBHA 3OISA 1NB3A 2P7UA 1SNKA 1MEGA 1BY8A 2XU4A 2VHSA 1NPZA 2IPPB 3MTNA 2BDZA 3GCBA 2PADA 1AU3A 1JQPA 1CVZA 1AYUA 1TLOA 2NQDB 2Y6EA 4YYUA 3CBKA 4P6EA 1NQCA 1PPPA 4YVAA 2AYOA 5CHTA 5JH3A 1CS8A 1PPOA 4BS5A 1EWMA 2P0RA 1YK8A 4XUIA 1ME4A 5J94A 3AI8A 2HH5A 1U9XA 7PCKA 2R9NA 3I06A 1MDWA 1ATKA 3BCNA 1IWDA 1ICFA 2F7DA 1TL9A 4WA6A 3HHAA 2E03A 4YYQA 2OULA 4RY2A 2AVWA 4PADA 1X9YA 3F75A 4YYWA 1CJLA 1O0EA 3IMAA 4X6HA 4PP2E 2XU5A 4DMYA 1Y4HA 4I04A 5EF4A 1QOLA 5F02A 3N4CA 4CDDB 2JQFR 3OF9A 2HD5A 1STFE 4YYSA 2DC6A 4QBBA 3KWZA 3H6SA 3H7DA 4BPVA 4W5BA 2G6DA 2P86A 3PNRA 3KX1A 2AUXA 1Y08A 3USVA 1CTEA 4OELA 4W4UA 3IOQA 4N8WA 2FUDA 2XU1A 1M6DA 2PREA 3MHSA 1BQIA 4KLBA 1CSBB 5FPWA 3OVXA 1AYWA 1PE6A 2DCCA 3RVVA 3F5VA 2XU3A 4YYRA 2NQGA 1EWLA 4K7CA 1VJVA 1VSNA 1DF0A 4ZUXU 2DZZA 2CB5A 1PXVA 3IUTA 1ITOA 2DC9A 1GECE 3WXGA 2G8JA 3S3QA 1MS6A 1BGOA 4FIPA 2Y5BA 1K3BB 2DC7A 3TNXA 1YT7A 4PP1A 4AXLA 2PNSA 1SP4B 1KHPA 2DJGB 1F29A 2HXZA 4I05A 3CH2X 2FT2A 6PADA 1POPA 2F1GA 3E1ZB 5A24A 1AECA 4BSQA 4HWYA 3KWBX 2YJBA 3K8UA 3OF8A 3PDFA 5CVMA 1XKGA 9PAPA 3QSDA 5JA7A 2G7YA 4N79A 2O6XA 4BQVA 1EF7A 3U8EA 3LFYA 2ACTA 4W5CA 2CIOA 1U9QX 2FO5A 3HHIA 2FQ9A 2DCAA 4Q8HA 3P5VA 3O1GA 3BPMA 4CDCB 4QRVA 2NQAA 3H89A 1KXRA 3P5XA 2YJ2A 2FYEA 1CPJA 4BS6A 1CB5A 1DEUA 1MEMA 3ZUAA 4YV8A 1YK7A 1EWPA 3CH3X 1AU2A 1FH0A 3QT4A 2R6NA 2FRQA 4CDEB 1KHQA 4X6JA 3N3GA 2AIMA 4FK5A 4I07A 4PI3A 1PIPA 1PPNA 2FTDA 3LXSA 5PADA 4CDFB 2JQGR 3HWNA 4XR7A 1THEA 3WXFA 4FJCA 3O0UA 2E01A 3PBHA 1AU0A 3N3KA 2B1MA 5EGWA 2AS8A 1MHWA 3C9EA 1Q6KA 2G8EA 4Q8GA 3CBJA 4MSXA 2E00A 3ERVA 1U9WA 2ATOA 3IV2A 3OVZA 3HD3A 1CQDA 2C0YA 1ZCMA 2VHFA 3IHPA 4G54A 2BDLA 3MORA 2DJFB 1YALA 1PCIA 3P5UA 3K24A 1EWOA 2GHUA 2FRAA 3K9MA 3V6CA 1QDQA 1YVBA 3BC3A 5K16A 4YYVA 1U5IA 3V6EA 2H7JA 3P5WA 1QXPA 3KSEA 1PPDA 3DF0A 3KW9A 4MZSA 1QMYA 3BPFA 3RVWA 1NLJA 1S4VA 2AUZA 2DZYA 2HHNA 1F2CA 5CHVA 3QJ3A 2YJ9A 1ME3A 3PW3A 2AYNA 3BOWA 4N4ZA 2AU1A 1U9VA 3NHEA 1NB5A 1KFXL 1NL6A 3I3TA 2NQIA 3H8CA 2WBFX 3B79A 2DCBA 2YJ8A 4DMXA 2R9OA 1AIMA 3RVXA 1HUCB 1AU4A 1GMYA 2IBIA 8PCHA 1GLOA 3KFQA 3MHHA 2PBHA 4P6GA 1BP4A 1F2BA 1TU6A 2ARYA 2R9MA 4AXMA 3KKUA 4CZWA 2OP3A 2DCDA 5CVOB 3S3RA
chains in the Genus database with same CATH superfamily
4X6IA 1GCBA 2R9CA 3WXEA 4QRGA 4QH6A 3BWKA 4QRXA 1A6RA 5CVNB 4D8BA 4OEMA 1CV8A 2DC8A 2YJCA 1KFUL 1ZIVA 2E02A 1AYVA 3W30A 4MZOA 3H8BA 1F2AA 2GFOA 3IEJA 2B1NA 1PADA 1MIRA 3D6SA 2OZ2A 3M99A 3TRKA 2R9FA 1PBHA 4GUAA 3OISA 1NB3A 2P7UA 1SNKA 1MEGA 5KO3A 1BY8A 2XU4A 2VHSA 1NPZA 2IPPB 4BOQA 3BB7A 3MTNA 2BDZA 3GCBA 2PADA 1AU3A 1JQPA 1CVZA 4RKXA 1AYUA 1TLOA 2NQDB 2Y6EA 4YYUA 3CBKA 4P6EA 1NQCA 4ZTBA 1PPPA 4YVAA 3IFUA 2AYOA 2JTCA 5CHTA 5JH3A 1CS8A 1PPOA 4BS5A 1EWMA 2P0RA 1YK8A 4XUIA 1ME4A 5J94A 3AI8A 2HH5A 1U9XA 4IP3A 7PCKA 2R9NA 3E9SA 5EZSA 3I06A 1MDWA 3PRMA 1ATKA 3BCNA 1IWDA 1ICFA 2F7DA 3PRPA 1TL9A 4RF0A 4WA6A 3HHAA 2E03A 4YYQA 4M0WA 2OULA 4RY2A 4R3DA 2AVWA 4PADA 1X9YA 2DOSA 3F75A 4YYWA 1CJLA 2UZJA 1YZBA 1O0EA 3IMAA 4X6HA 4PP2E 2XU5A 4DMYA 3BY4A 1Y4HA 4I04A 2J7QA 5EF4A 3B21A 1QOLA 5EZQA 5F02A 3N4CA 4CDDB 1PVJA 2JQFR 3OF9A 2HD5A 3PT2A 1STFE 4YYSA 2DC6A 4QBBA 4RF1A 3KWZA 3H6SA 3H7DA 4BPVA 4W5BA 2G6DA 3BBAA 4OW0A 4XZXA 3W31A 2P86A 3PNRA 3KX1A 2AUXA 1Y08A 3USVA 1CTEA 4OELA 4W4UA 3IOQA 4N8WA 2FUDA 2XU1A 1M6DA 2PREA 3MHSA 1BQIA 4KLBA 1CSBB 5FPWA 3OVXA 1AYWA 1PE6A 2DCCA 3RVVA 4PT5A 3F5VA 2BTWA 2XU3A 4YYRA 2NQGA 4REZA 4K7CA 1EWLA 1VJVA 1VSNA 1DF0A 4ZUXU 2DZZA 2CB5A 1PXVA 3IUTA 1ITOA 2DC9A 1GECE 3WXGA 2G8JA 3S3QA 1MS6A 1BGOA 4FIPA 2Y5BA 1K3BB 5JZEA 2DC7A 3TNXA 1YT7A 4OVZB 4PP1A 4AXLA 2PNSA 3O65A 1SP4B 1KHPA 2DJGB 1F29A 4MM3B 4IUMA 2J7QC 2HXZA 4I05A 4BOPA 3CH2X 2FT2A 6PADA 1POPA 4BOSA 1UKFA 2F1GA 3E1ZB 2FE8A 5A24A 1AECA 4BSQA 2AGAA 3KWBX 4HWYA 2YJBA 3K8UA 3OF8A 3PDFA 5CVMA 1XKGA 9PAPA 3QSDA 5JA7A 2G7YA 4N79A 2O6XA 4BQVA 1EF7A 3U8EA 1DKIA 3LFYA 3PSEA 3MTVA 2ACTA 4W5CA 2CIOA 1U9QX 2FO5A 4OVZA 3HHIA 2FQ9A 2DCAA 4Q8HA 3P5VA 3O1GA 3BPMA 4CDCB 3ZNHA 3C0RA 4QRVA 2NQAA 3H89A 1KXRA 3P5XA 2YJ2A 2FYEA 1CPJA 4BS6A 1CB5A 1DEUA 1MEMA 3ZUAA 4YV8A 1YK7A 1EWPA 3RNVA 3CH3X 1AU2A 1FH0A 3TMPA 3QT4A 2R6NA 2FRQA 4CDEB 1KHQA 4X6JA 3N3GA 2AIMA 4FK5A 4I07A 4PI3A 1PIPA 1PPNA 2FTDA 4A5UA 3LXSA 5PADA 4CDFB 2JQGR 3HWNA 3PHXA 4XR7A 3MP2A 1THEA 3WXFA 4FJCA 3O0UA 2E01A 3PBHA 1AU0A 3N3KA 2B1MA 3MJ5A 5EGWA 2AS8A 1MHWA 3C9EA 1Q6KA 2G8EA 4Q8GA 3CBJA 4D8IA 4MSXA 2E00A 3ERVA 1U9WA 4RNAA 5E6JA 2ATOA 3IV2A 3OVZA 3HD3A 1CQDA 2C0YA 1ZCMA 2VHFA 3IHPA 4G54A 4P16A 2BDLA 3MORA 2DJFB 1YALA 1PCIA 3P5UA 3K24A 1EWOA 2GHUA 2FRAA 3K9MA 3V6CA 4D8EA 1QDQA 1YVBA 3BC3A 5K16A 4YYVA 1U5IA 2BU3A 3V6EA 2H7JA 3P5WA 1QXPA 3KSEA 1PPDA 3DF0A 3KW9A 4HXDB 4MZSA 2HWKA 1QMYA 3BPFA 3RVWA 1NLJA 1S4VA 2AUZA 2DZYA 2HHNA 1F2CA 5CHVA 3QJ3A 2YJ9A 1ME3A 4WURA 3PW3A 2AYNA 3BOWA 4N4ZA 2AU1A 1U9VA 3NHEA 1NB5A 1KFXL 1NL6A 4BOZA 3I3TA 2NQIA 3H8CA 2WBFX 3B79A 3OQCA 2DCBA 2YJ8A 3PHUA 2BTWB 4DMXA 2R9OA 1AIMA 1HUCB 3RVXA 1AU4A 1GMYA 3PHWA 2IBIA 8PCHA 1GLOA 3KFQA 3MHHA 2PBHA 4P6GA 1BP4A 4MI7A 1F2BA 1TU6A 2JRIA 2ARYA 2R9MA 4AXMA 2Z84A 3KKUA 4CZWA 2OP3A 2DCDA 4BOUA 5CVOB 3S3RA
chains in the Genus database with same CATH topology
4X6IA 1GCBA 2R9CA 3WXEA 4QRGA 4QH6A 3BWKA 4QRXA 1A6RA 5CVNB 4OEMA 1CV8A 2DC8A 2YJCA 1KFUL 1ZIVA 2E02A 1AYVA 4MZOA 3H8BA 1F2AA 2GFOA 3IEJA 2B1NA 1PADA 4BGFA 1MIRA 3D6SA 2OZ2A 3M99A 2R9FA 1PBHA 3OISA 1NB3A 2P7UA 1SNKA 1MEGA 1BY8A 2XU4A 2VHSA 1NPZA 2IPPB 3MTNA 2BDZA 3GCBA 2PADA 1AU3A 1JQPA 1CVZA 1AYUA 1TLOA 2NQDB 2Y6EA 4YYUA 3CBKA 4P6EA 1NQCA 1PPPA 4YVAA 2AYOA 5CHTA 5JH3A 1CS8A 1PPOA 4BS5A 1EWMA 2P0RA 1YK8A 5J94A 1ME4A 4XUIA 3AI8A 2HH5A 1U9XA 7PCKA 2R9NA 3I06A 1MDWA 1ATKA 3BCNA 3LTWA 1IWDA 1ICFA 2F7DA 1TL9A 1E2TA 4WA6A 3HHAA 2E03A 4YYQA 2OULA 4RY2A 2AVWA 4PADA 1X9YA 3F75A 4YYWA 1CJLA 1O0EA 3IMAA 4X6HA 4PP2E 2XU5A 4DMYA 1Y4HA 4I04A 5EF4A 1QOLA 5F02A 3N4CA 4CDDB 2JQFR 1W5RA 3OF9A 2HD5A 1STFE 4YYSA 2DC6A 4QBBA 3KWZA 3H6SA 3H7DA 4BPVA 4W5BA 2G6DA 2P86A 3PNRA 3KX1A 2AUXA 1Y08A 3USVA 1CTEA 4OELA 4W4UA 3IOQA 4N8WA 2FUDA 2XU1A 1M6DA 2PREA 3MHSA 1BQIA 4KLBA 1CSBB 5FPWA 3OVXA 1AYWA 1PE6A 2DCCA 3RVVA 3F5VA 2XU3A 4YYRA 2NQGA 4K7CA 1EWLA 1VJVA 1VSNA 1DF0A 4ZUXU 2DZZA 2CB5A 1PXVA 3IUTA 1ITOA 2DC9A 1GECE 3WXGA 2G8JA 3S3QA 1MS6A 1BGOA 4FIPA 2Y5BA 1K3BB 1GX3A 2DC7A 3TNXA 1YT7A 4PP1A 4AXLA 2PNSA 1SP4B 1KHPA 2DJGB 1F29A 4GUZA 2HXZA 4C5PA 4I05A 3CH2X 2FT2A 6PADA 1POPA 2F1GA 3E1ZB 5A24A 1AECA 4BSQA 4HWYA 3KWBX 2YJBA 3K8UA 3OF8A 3PDFA 5CVMA 1XKGA 9PAPA 3QSDA 5JA7A 2G7YA 4N79A 2O6XA 4BQVA 1EF7A 3U8EA 3LFYA 2VFBA 2ACTA 4W5CA 2CIOA 1U9QX 2FO5A 3HHIA 2FQ9A 2DCAA 4Q8HA 3P5VA 3O1GA 3BPMA 4CDCB 4QRVA 2NQAA 3H89A 1KXRA 1W4TA 3P5XA 2YJ2A 2FYEA 1CPJA 4BS6A 1CB5A 1DEUA 1MEMA 3ZUAA 3D9WA 4YV8A 1YK7A 1EWPA 3CH3X 1AU2A 1FH0A 3QT4A 2R6NA 2FRQA 1W6FA 4CDEB 1KHQA 4X6JA 3N3GA 2AIMA 4FK5A 4I07A 4PI3A 1PIPA 1PPNA 2FTDA 3LXSA 4B55A 5PADA 4CDFB 2JQGR 3HWNA 4XR7A 1THEA 3WXFA 4FJCA 3O0UA 2E01A 3PBHA 1AU0A 3N3KA 2B1MA 5EGWA 2AS8A 1MHWA 3C9EA 1Q6KA 2G8EA 4Q8GA 3CBJA 4MSXA 2E00A 3ERVA 1U9WA 2ATOA 3IV2A 3OVZA 3HD3A 1CQDA 2C0YA 1ZCMA 2VHFA 3IHPA 4G54A 2BDLA 3MORA 2DJFB 1YALA 1PCIA 3P5UA 4NV7A 3K24A 1EWOA 2GHUA 2FRAA 3K9MA 3V6CA 1QDQA 1YVBA 3BC3A 5K16A 4YYVA 1U5IA 3V6EA 2H7JA 3P5WA 1QXPA 3KSEA 1PPDA 3DF0A 3KW9A 4MZSA 1QMYA 3BPFA 3RVWA 1NLJA 1S4VA 2AUZA 2DZYA 2HHNA 1F2CA 5CHVA 3QJ3A 2YJ9A 1ME3A 3PW3A 2AYNA 3BOWA 4N4ZA 2AU1A 1U9VA 3NHEA 1NB5A 1KFXL 1NL6A 3I3TA 2NQIA 3H8CA 2WBFX 3B79A 2DCBA 2YJ8A 2VFCA 4DMXA 2R9OA 1AIMA 1HUCB 3RVXA 1AU4A 1GMYA 2IBIA 8PCHA 4NV8A 2BSZA 1GLOA 3KFQA 3MHHA 2PBHA 4P6GA 1BP4A 1F2BA 1TU6A 2ARYA 2R9MA 4AXMA 3KKUA 4CZWA 2OP3A 2DCDA 5CVOB 3S3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6I A;  1GCB A;  2R9C A;  3WXE A;  4QRG A;  4QH6 A;  3BWK A;  4QRX A;  1A6R A;  5CVN B;  4OEM A;  1CV8 A;  2DC8 A;  2YJC A;  1KFU L;  1ZIV A;  2E02 A;  1AYV A;  4MZO A;  3H8B A;  1F2A A;  2GFO A;  3IEJ A;  2B1N A;  1PAD A;  1MIR A;  3D6S A;  2OZ2 A;  3M99 A;  2R9F A;  1PBH A;  3OIS A;  1NB3 A;  2P7U A;  1SNK A;  1MEG A;  1BY8 A;  2XU4 A;  2VHS A;  1NPZ A;  2IPP B;  3MTN A;  2BDZ A;  3GCB A;  2PAD A;  1AU3 A;  1JQP A;  1CVZ A;  1AYU A;  1TLO A;  2NQD B;  2Y6E A;  4YYU A;  3CBK A;  4P6E A;  1NQC A;  1PPP A;  4YVA A;  2AYO A;  5CHT A;  5JH3 A;  1CS8 A;  1PPO A;  4BS5 A;  1EWM A;  2P0R A;  1YK8 A;  4XUI A;  1ME4 A;  5J94 A;  3AI8 A;  2HH5 A;  1U9X A;  7PCK A;  2R9N A;  3I06 A;  1MDW A;  1ATK A;  3BCN A;  1IWD A;  1ICF A;  2F7D A;  1TL9 A;  4WA6 A;  3HHA A;  2E03 A;  4YYQ A;  2OUL A;  4RY2 A;  2AVW A;  4PAD A;  1X9Y A;  3F75 A;  4YYW A;  1CJL A;  1O0E A;  3IMA A;  4X6H A;  4PP2 E;  2XU5 A;  4DMY A;  1Y4H A;  4I04 A;  5EF4 A;  1QOL A;  5F02 A;  3N4C A;  4CDD B;  2JQF R;  3OF9 A;  2HD5 A;  1STF E;  4YYS A;  2DC6 A;  4QBB A;  3KWZ A;  3H6S A;  3H7D A;  4BPV A;  4W5B A;  2G6D A;  2P86 A;  3PNR A;  3KX1 A;  2AUX A;  1Y08 A;  3USV A;  1CTE A;  4OEL A;  4W4U A;  3IOQ A;  4N8W A;  2FUD A;  2XU1 A;  1M6D A;  2PRE A;  3MHS A;  1BQI A;  4KLB A;  1CSB B;  5FPW A;  3OVX A;  1AYW A;  1PE6 A;  2DCC A;  3RVV A;  3F5V A;  2XU3 A;  4YYR A;  2NQG A;  1EWL A;  4K7C A;  1VJV A;  1VSN A;  1DF0 A;  4ZUX U;  2DZZ A;  2CB5 A;  1PXV A;  3IUT A;  1ITO A;  2DC9 A;  1GEC E;  3WXG A;  2G8J A;  3S3Q A;  1MS6 A;  1BGO A;  4FIP A;  2Y5B A;  1K3B B;  2DC7 A;  3TNX A;  1YT7 A;  4PP1 A;  4AXL A;  2PNS A;  1SP4 B;  1KHP A;  2DJG B;  1F29 A;  2HXZ A;  4I05 A;  3CH2 X;  2FT2 A;  6PAD A;  1POP A;  2F1G A;  3E1Z B;  5A24 A;  1AEC A;  4BSQ A;  4HWY A;  3KWB X;  2YJB A;  3K8U A;  3OF8 A;  3PDF A;  5CVM A;  1XKG A;  9PAP A;  3QSD A;  5JA7 A;  2G7Y A;  4N79 A;  2O6X A;  4BQV A;  1EF7 A;  3U8E A;  3LFY A;  2ACT A;  4W5C A;  2CIO A;  1U9Q X;  2FO5 A;  3HHI A;  2FQ9 A;  2DCA A;  4Q8H A;  3P5V A;  3O1G A;  3BPM A;  4CDC B;  4QRV A;  2NQA A;  3H89 A;  1KXR A;  3P5X A;  2YJ2 A;  2FYE A;  1CPJ A;  4BS6 A;  1CB5 A;  1DEU A;  1MEM A;  3ZUA A;  4YV8 A;  1YK7 A;  1EWP A;  3CH3 X;  1AU2 A;  1FH0 A;  3QT4 A;  2R6N A;  2FRQ A;  4CDE B;  1KHQ A;  4X6J A;  3N3G A;  2AIM A;  4FK5 A;  4I07 A;  4PI3 A;  1PIP A;  1PPN A;  2FTD A;  3LXS A;  5PAD A;  4CDF B;  2JQG R;  3HWN A;  4XR7 A;  1THE A;  3WXF A;  4FJC A;  3O0U A;  2E01 A;  3PBH A;  1AU0 A;  3N3K A;  2B1M A;  5EGW A;  2AS8 A;  1MHW A;  3C9E A;  1Q6K A;  2G8E A;  4Q8G A;  3CBJ A;  4MSX A;  2E00 A;  3ERV A;  1U9W A;  2ATO A;  3IV2 A;  3OVZ A;  3HD3 A;  1CQD A;  2C0Y A;  1ZCM A;  2VHF A;  3IHP A;  4G54 A;  2BDL A;  3MOR A;  2DJF B;  1YAL A;  1PCI A;  3P5U A;  3K24 A;  1EWO A;  2GHU A;  2FRA A;  3K9M A;  3V6C A;  1QDQ A;  1YVB A;  3BC3 A;  5K16 A;  4YYV A;  1U5I A;  3V6E A;  2H7J A;  3P5W A;  1QXP A;  3KSE A;  1PPD A;  3DF0 A;  3KW9 A;  4MZS A;  1QMY A;  3BPF A;  3RVW A;  1NLJ A;  1S4V A;  2AUZ A;  2DZY A;  2HHN A;  1F2C A;  5CHV A;  3QJ3 A;  2YJ9 A;  1ME3 A;  3PW3 A;  2AYN A;  3BOW A;  4N4Z A;  2AU1 A;  1U9V A;  3NHE A;  1NB5 A;  1KFX L;  1NL6 A;  3I3T A;  2NQI A;  3H8C A;  2WBF X;  3B79 A;  2DCB A;  2YJ8 A;  4DMX A;  2R9O A;  1AIM A;  3RVX A;  1HUC B;  1AU4 A;  1GMY A;  2IBI A;  8PCH A;  1GLO A;  3KFQ A;  3MHH A;  2PBH A;  4P6G A;  1BP4 A;  1F2B A;  1TU6 A;  2ARY A;  2R9M A;  4AXM A;  3KKU A;  4CZW A;  2OP3 A;  2DCD A;  5CVO B;  3S3R A; 
#chains in the Genus database with same CATH topology
 4X6I A;  1GCB A;  2R9C A;  3WXE A;  4QRG A;  4QH6 A;  3BWK A;  4QRX A;  1A6R A;  5CVN B;  4D8B A;  4OEM A;  1CV8 A;  2DC8 A;  2YJC A;  1KFU L;  1ZIV A;  2E02 A;  1AYV A;  3W30 A;  4MZO A;  3H8B A;  1F2A A;  2GFO A;  3IEJ A;  2B1N A;  1PAD A;  1MIR A;  3D6S A;  2OZ2 A;  3M99 A;  3TRK A;  2R9F A;  1PBH A;  4GUA A;  3OIS A;  1NB3 A;  2P7U A;  1SNK A;  1MEG A;  5KO3 A;  1BY8 A;  2XU4 A;  2VHS A;  1NPZ A;  2IPP B;  4BOQ A;  3BB7 A;  3MTN A;  2BDZ A;  3GCB A;  2PAD A;  1AU3 A;  1JQP A;  1CVZ A;  4RKX A;  1AYU A;  1TLO A;  2NQD B;  2Y6E A;  4YYU A;  3CBK A;  4P6E A;  1NQC A;  4ZTB A;  1PPP A;  4YVA A;  3IFU A;  2AYO A;  2JTC A;  5CHT A;  5JH3 A;  1CS8 A;  1PPO A;  4BS5 A;  1EWM A;  2P0R A;  1YK8 A;  4XUI A;  1ME4 A;  5J94 A;  3AI8 A;  2HH5 A;  1U9X A;  4IP3 A;  7PCK A;  2R9N A;  3E9S A;  5EZS A;  3I06 A;  1MDW A;  3PRM A;  1ATK A;  3BCN A;  1IWD A;  1ICF A;  2F7D A;  3PRP A;  1TL9 A;  4RF0 A;  4WA6 A;  3HHA A;  2E03 A;  4YYQ A;  4M0W A;  2OUL A;  4RY2 A;  4R3D A;  2AVW A;  4PAD A;  1X9Y A;  2DOS A;  3F75 A;  4YYW A;  1CJL A;  2UZJ A;  1YZB A;  1O0E A;  3IMA A;  4X6H A;  4PP2 E;  2XU5 A;  4DMY A;  3BY4 A;  1Y4H A;  4I04 A;  2J7Q A;  5EF4 A;  3B21 A;  1QOL A;  5EZQ A;  5F02 A;  3N4C A;  4CDD B;  1PVJ A;  2JQF R;  3OF9 A;  2HD5 A;  3PT2 A;  1STF E;  4YYS A;  2DC6 A;  4QBB A;  4RF1 A;  3KWZ A;  3H6S A;  3H7D A;  4BPV A;  4W5B A;  2G6D A;  3BBA A;  4OW0 A;  4XZX A;  3W31 A;  2P86 A;  3PNR A;  3KX1 A;  2AUX A;  1Y08 A;  3USV A;  1CTE A;  4OEL A;  4W4U A;  3IOQ A;  4N8W A;  2FUD A;  2XU1 A;  1M6D A;  2PRE A;  3MHS A;  1BQI A;  4KLB A;  1CSB B;  5FPW A;  3OVX A;  1AYW A;  1PE6 A;  2DCC A;  3RVV A;  4PT5 A;  3F5V A;  2BTW A;  2XU3 A;  4YYR A;  2NQG A;  4REZ A;  4K7C A;  1EWL A;  1VJV A;  1VSN A;  1DF0 A;  4ZUX U;  2DZZ A;  2CB5 A;  1PXV A;  3IUT A;  1ITO A;  2DC9 A;  1GEC E;  3WXG A;  2G8J A;  3S3Q A;  1MS6 A;  1BGO A;  4FIP A;  2Y5B A;  1K3B B;  5JZE A;  2DC7 A;  3TNX A;  1YT7 A;  4OVZ B;  4PP1 A;  4AXL A;  2PNS A;  3O65 A;  1SP4 B;  1KHP A;  2DJG B;  1F29 A;  4MM3 B;  4IUM A;  2J7Q C;  2HXZ A;  4I05 A;  4BOP A;  3CH2 X;  2FT2 A;  6PAD A;  1POP A;  4BOS A;  1UKF A;  2F1G A;  3E1Z B;  2FE8 A;  5A24 A;  1AEC A;  4BSQ A;  2AGA A;  3KWB X;  4HWY A;  2YJB A;  3K8U A;  3OF8 A;  3PDF A;  5CVM A;  1XKG A;  9PAP A;  3QSD A;  5JA7 A;  2G7Y A;  4N79 A;  2O6X A;  4BQV A;  1EF7 A;  3U8E A;  1DKI A;  3LFY A;  3PSE A;  3MTV A;  2ACT A;  4W5C A;  2CIO A;  1U9Q X;  2FO5 A;  4OVZ A;  3HHI A;  2FQ9 A;  2DCA A;  4Q8H A;  3P5V A;  3O1G A;  3BPM A;  4CDC B;  3ZNH A;  3C0R A;  4QRV A;  2NQA A;  3H89 A;  1KXR A;  3P5X A;  2YJ2 A;  2FYE A;  1CPJ A;  4BS6 A;  1CB5 A;  1DEU A;  1MEM A;  3ZUA A;  4YV8 A;  1YK7 A;  1EWP A;  3RNV A;  3CH3 X;  1AU2 A;  1FH0 A;  3TMP A;  3QT4 A;  2R6N A;  2FRQ A;  4CDE B;  1KHQ A;  4X6J A;  3N3G A;  2AIM A;  4FK5 A;  4I07 A;  4PI3 A;  1PIP A;  1PPN A;  2FTD A;  4A5U A;  3LXS A;  5PAD A;  4CDF B;  2JQG R;  3HWN A;  3PHX A;  4XR7 A;  3MP2 A;  1THE A;  3WXF A;  4FJC A;  3O0U A;  2E01 A;  3PBH A;  1AU0 A;  3N3K A;  2B1M A;  3MJ5 A;  5EGW A;  2AS8 A;  1MHW A;  3C9E A;  1Q6K A;  2G8E A;  4Q8G A;  3CBJ A;  4D8I A;  4MSX A;  2E00 A;  3ERV A;  1U9W A;  4RNA A;  5E6J A;  2ATO A;  3IV2 A;  3OVZ A;  3HD3 A;  1CQD A;  2C0Y A;  1ZCM A;  2VHF A;  3IHP A;  4G54 A;  4P16 A;  2BDL A;  3MOR A;  2DJF B;  1YAL A;  1PCI A;  3P5U A;  3K24 A;  1EWO A;  2GHU A;  2FRA A;  3K9M A;  3V6C A;  4D8E A;  1QDQ A;  1YVB A;  3BC3 A;  5K16 A;  4YYV A;  1U5I A;  2BU3 A;  3V6E A;  2H7J A;  3P5W A;  1QXP A;  3KSE A;  1PPD A;  3DF0 A;  3KW9 A;  4HXD B;  4MZS A;  2HWK A;  1QMY A;  3BPF A;  3RVW A;  1NLJ A;  1S4V A;  2AUZ A;  2DZY A;  2HHN A;  1F2C A;  5CHV A;  3QJ3 A;  2YJ9 A;  1ME3 A;  4WUR A;  3PW3 A;  2AYN A;  3BOW A;  4N4Z A;  2AU1 A;  1U9V A;  3NHE A;  1NB5 A;  1KFX L;  1NL6 A;  4BOZ A;  3I3T A;  2NQI A;  3H8C A;  2WBF X;  3B79 A;  3OQC A;  2DCB A;  2YJ8 A;  3PHU A;  2BTW B;  4DMX A;  2R9O A;  1AIM A;  1HUC B;  3RVX A;  1AU4 A;  1GMY A;  3PHW A;  2IBI A;  8PCH A;  1GLO A;  3KFQ A;  3MHH A;  2PBH A;  4P6G A;  1BP4 A;  4MI7 A;  1F2B A;  1TU6 A;  2JRI A;  2ARY A;  2R9M A;  4AXM A;  2Z84 A;  3KKU A;  4CZW A;  2OP3 A;  2DCD A;  4BOU A;  5CVO B;  3S3R A; 
#chains in the Genus database with same CATH homology
 4X6I A;  1GCB A;  2R9C A;  3WXE A;  4QRG A;  4QH6 A;  3BWK A;  4QRX A;  1A6R A;  5CVN B;  4OEM A;  1CV8 A;  2DC8 A;  2YJC A;  1KFU L;  1ZIV A;  2E02 A;  1AYV A;  4MZO A;  3H8B A;  1F2A A;  2GFO A;  3IEJ A;  2B1N A;  1PAD A;  4BGF A;  1MIR A;  3D6S A;  2OZ2 A;  3M99 A;  2R9F A;  1PBH A;  3OIS A;  1NB3 A;  2P7U A;  1SNK A;  1MEG A;  1BY8 A;  2XU4 A;  2VHS A;  1NPZ A;  2IPP B;  3MTN A;  2BDZ A;  3GCB A;  2PAD A;  1AU3 A;  1JQP A;  1CVZ A;  1AYU A;  1TLO A;  2NQD B;  2Y6E A;  4YYU A;  3CBK A;  4P6E A;  1NQC A;  1PPP A;  4YVA A;  2AYO A;  5CHT A;  5JH3 A;  1CS8 A;  1PPO A;  4BS5 A;  1EWM A;  2P0R A;  1YK8 A;  5J94 A;  1ME4 A;  4XUI A;  3AI8 A;  2HH5 A;  1U9X A;  7PCK A;  2R9N A;  3I06 A;  1MDW A;  1ATK A;  3BCN A;  3LTW A;  1IWD A;  1ICF A;  2F7D A;  1TL9 A;  1E2T A;  4WA6 A;  3HHA A;  2E03 A;  4YYQ A;  2OUL A;  4RY2 A;  2AVW A;  4PAD A;  1X9Y A;  3F75 A;  4YYW A;  1CJL A;  1O0E A;  3IMA A;  4X6H A;  4PP2 E;  2XU5 A;  4DMY A;  1Y4H A;  4I04 A;  5EF4 A;  1QOL A;  5F02 A;  3N4C A;  4CDD B;  2JQF R;  1W5R A;  3OF9 A;  2HD5 A;  1STF E;  4YYS A;  2DC6 A;  4QBB A;  3KWZ A;  3H6S A;  3H7D A;  4BPV A;  4W5B A;  2G6D A;  2P86 A;  3PNR A;  3KX1 A;  2AUX A;  1Y08 A;  3USV A;  1CTE A;  4OEL A;  4W4U A;  3IOQ A;  4N8W A;  2FUD A;  2XU1 A;  1M6D A;  2PRE A;  3MHS A;  1BQI A;  4KLB A;  1CSB B;  5FPW A;  3OVX A;  1AYW A;  1PE6 A;  2DCC A;  3RVV A;  3F5V A;  2XU3 A;  4YYR A;  2NQG A;  4K7C A;  1EWL A;  1VJV A;  1VSN A;  1DF0 A;  4ZUX U;  2DZZ A;  2CB5 A;  1PXV A;  3IUT A;  1ITO A;  2DC9 A;  1GEC E;  3WXG A;  2G8J A;  3S3Q A;  1MS6 A;  1BGO A;  4FIP A;  2Y5B A;  1K3B B;  1GX3 A;  2DC7 A;  3TNX A;  1YT7 A;  4PP1 A;  4AXL A;  2PNS A;  1SP4 B;  1KHP A;  2DJG B;  1F29 A;  4GUZ A;  2HXZ A;  4C5P A;  4I05 A;  3CH2 X;  2FT2 A;  6PAD A;  1POP A;  2F1G A;  3E1Z B;  5A24 A;  1AEC A;  4BSQ A;  4HWY A;  3KWB X;  2YJB A;  3K8U A;  3OF8 A;  3PDF A;  5CVM A;  1XKG A;  9PAP A;  3QSD A;  5JA7 A;  2G7Y A;  4N79 A;  2O6X A;  4BQV A;  1EF7 A;  3U8E A;  3LFY A;  2VFB A;  2ACT A;  4W5C A;  2CIO A;  1U9Q X;  2FO5 A;  3HHI A;  2FQ9 A;  2DCA A;  4Q8H A;  3P5V A;  3O1G A;  3BPM A;  4CDC B;  4QRV A;  2NQA A;  3H89 A;  1KXR A;  1W4T A;  3P5X A;  2YJ2 A;  2FYE A;  1CPJ A;  4BS6 A;  1CB5 A;  1DEU A;  1MEM A;  3ZUA A;  3D9W A;  4YV8 A;  1YK7 A;  1EWP A;  3CH3 X;  1AU2 A;  1FH0 A;  3QT4 A;  2R6N A;  2FRQ A;  1W6F A;  4CDE B;  1KHQ A;  4X6J A;  3N3G A;  2AIM A;  4FK5 A;  4I07 A;  4PI3 A;  1PIP A;  1PPN A;  2FTD A;  3LXS A;  4B55 A;  5PAD A;  4CDF B;  2JQG R;  3HWN A;  4XR7 A;  1THE A;  3WXF A;  4FJC A;  3O0U A;  2E01 A;  3PBH A;  1AU0 A;  3N3K A;  2B1M A;  5EGW A;  2AS8 A;  1MHW A;  3C9E A;  1Q6K A;  2G8E A;  4Q8G A;  3CBJ A;  4MSX A;  2E00 A;  3ERV A;  1U9W A;  2ATO A;  3IV2 A;  3OVZ A;  3HD3 A;  1CQD A;  2C0Y A;  1ZCM A;  2VHF A;  3IHP A;  4G54 A;  2BDL A;  3MOR A;  2DJF B;  1YAL A;  1PCI A;  3P5U A;  4NV7 A;  3K24 A;  1EWO A;  2GHU A;  2FRA A;  3K9M A;  3V6C A;  1QDQ A;  1YVB A;  3BC3 A;  5K16 A;  4YYV A;  1U5I A;  3V6E A;  2H7J A;  3P5W A;  1QXP A;  3KSE A;  1PPD A;  3DF0 A;  3KW9 A;  4MZS A;  1QMY A;  3BPF A;  3RVW A;  1NLJ A;  1S4V A;  2AUZ A;  2DZY A;  2HHN A;  1F2C A;  5CHV A;  3QJ3 A;  2YJ9 A;  1ME3 A;  3PW3 A;  2AYN A;  3BOW A;  4N4Z A;  2AU1 A;  1U9V A;  3NHE A;  1NB5 A;  1KFX L;  1NL6 A;  3I3T A;  2NQI A;  3H8C A;  2WBF X;  3B79 A;  2DCB A;  2YJ8 A;  2VFC A;  4DMX A;  2R9O A;  1AIM A;  1HUC B;  3RVX A;  1AU4 A;  1GMY A;  2IBI A;  8PCH A;  4NV8 A;  2BSZ A;  1GLO A;  3KFQ A;  3MHH A;  2PBH A;  4P6G A;  1BP4 A;  1F2B A;  1TU6 A;  2ARY A;  2R9M A;  4AXM A;  3KKU A;  4CZW A;  2OP3 A;  2DCD A;  5CVO B;  3S3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...