3LFYA

Ctd of tarocystatin in complex with papain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
publication title Complex structure of tarocystatin with papain and characterization of tarocystatin proposed the role of C-terminal extension for inhibitory mechanism of group-2 phytocystatins
rcsb
molecule tags Hydrolase
total genus 61
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lfyA00
1PADA 2G8EA 3O1GA 3QJ3A 1CPJA 4QRVA 3H7DA 2G6DA 2AYOA 3PNRA 5CHVA 1S4VA 1AU2A 1CJLA 4I04A 1CB5A 1M6DA 2GHUA 2YJBA 3D6SA 2G8JA 3OF8A 2IPPB 4CDFB 2GFOA 1GECE 1U9XA 3KKUA 3PW3A 4AXLA 2B1NA 1YK8A 1ME3A 1KHPA 2HHNA 3IOQA 4P6GA 2IBIA 1AECA 1MS6A 4RY2A 2XU5A 3OVZA 4FJCA 1MHWA 1FH0A 1DF0A 2VHSA 2FTDA 3WXFA 3H89A 1PPOA 3KW9A 4G54A 3IEJA 3E1ZB 1VJVA 3BWKA 4W5CA 4X6IA 3K24A 3KX1A 3O0UA 1PBHA 4WA6A 4W5BA 1U9WA 4CZWA 1THEA 1YT7A 1EWOA 5PADA 4DMYA 4YYQA 3KFQA 2P86A 5CVOB 1NQCA 2FT2A 4I07A 3IUTA 2PNSA 3BCNA 3H8CA 1NLJA 1TU6A 2ATOA 5CVMA 3BPMA 1VSNA 4XR7A 4Q8HA 1PIPA 1X9YA 9PAPA 3I06A 1YVBA 2DCDA 1Y4HA 2Y6EA 1ITOA 3IMAA 2NQAA 1AYWA 3QT4A 1NPZA 2P0RA 2FYEA 3RVWA 3OISA 2XU1A 3NHEA 3K8UA 2DCAA 3OF9A 2FRQA 3MORA 3U8EA 1TL9A 2NQGA 3I3TA 1MIRA 1Y08A 2XU3A 1EWLA 2YJ2A 1YK7A 1IWDA 5EGWA 2O6XA 1POPA 2B1MA 1AU0A 1CS8A 1U9VA 4Q8GA 3V6CA 2JQGR 1QMYA 1YALA 5J94A 3TNXA 1ICFA 5EF4A 2WBFX 4FIPA 1BGOA 1NB3A 2AUXA 5JH3A 4CDDB 1PPDA 2HD5A 2R9MA 4AXMA 4XUIA 3RVVA 4YVAA 2BDLA 4YYSA 3N3GA 1AIMA 5F02A 1U5IA 2YJCA 2H7JA 2YJ9A 4X6HA 4MSXA 1U9QX 1ZIVA 2CB5A 1BP4A 4N4ZA 3N4CA 4MZSA 1KFUL 3HD3A 1QXPA 1GCBA 3F5VA 4PP2E 3P5UA 1PE6A 4K7CA 4YYVA 2PBHA 1AU3A 2DCBA 4YYRA 1GLOA 4BS6A 3H6SA 2DC9A 1AYUA 1CTEA 2AYNA 2DZYA 2FO5A 1ZCMA 3BOWA 2R9NA 3S3QA 1SNKA 3CBKA 2E03A 2E02A 1K3BB 5A24A 1PCIA 1QOLA 3HWNA 4CDCB 3PDFA 3DF0A 2DZZA 2R9CA 2DJFB 3B79A 2NQDB 3KWZA 2ARYA 3LFYA 3KSEA 1F2CA 3LXSA 1KXRA 4OEMA 1A6RA 3HHAA 3WXEA 3RVXA 4BS5A 1Q6KA 3C9EA 4PADA 2OZ2A 3P5WA 5CHTA 5CVNB 3ZUAA 4N79A 4FK5A 2HH5A 2OP3A 3PBHA 1AU4A 3P5XA 5FPWA 2E01A 2PREA 2ACTA 2YJ8A 2R9OA 1PPPA 3P5VA 3CH3X 2R9FA 3WXGA 1BQIA 1TLOA 4P6EA 3KWBX 3IHPA 2DC7A 3CBJA 4YYUA 5K16A 4QBBA 3K9MA 3BPFA 2FRAA 1DEUA 4KLBA 1KFXL 1EWMA 2AUZA 3USVA 2JQFR 3HHIA 3MHHA 1JQPA 1NL6A 3V6EA 1HUCB 2G7YA 7PCKA 1KHQA 2P7UA 4N8WA 2DC8A 2Y5BA 4BQVA 2FUDA 3BC3A 1XKGA 5JA7A 4BSQA 3F75A 8PCHA 4ZUXU 4QRXA 2CIOA 1O0EA 1STFE 4YYWA 1CQDA 3ERVA 4OELA 3CH2X 1F2AA 4HWYA 2DC6A 4CDEB 2F7DA 3OVXA 1CSBB 2FQ9A 1CVZA 2AS8A 2DJGB 1F2BA 2NQIA 4PP1A 4W4UA 1GMYA 1MEMA 3M99A 4PI3A 3GCBA 1NB5A 2R6NA 1MDWA 4BPVA 3QSDA 3N3KA 4YV8A 1QDQA 2F1GA 3H8BA 2PADA 4I05A 2BDZA 4X6JA 2DCCA 1MEGA 1AYVA 2XU4A 2OULA 1EF7A 1SP4B 2E00A 1PPNA 2AIMA 1PXVA 1F29A 3S3RA 4QRGA 2C0YA 4DMXA 2HXZA 1ATKA 2AU1A 1EWPA 6PADA 2AVWA 2VHFA 3MHSA 3MTNA 1BY8A 3IV2A 1CV8A 3AI8A 4QH6A 4MZOA 1ME4A
chains in the Genus database with same CATH superfamily
1PADA 2G8EA 3O1GA 3QJ3A 1CPJA 1YZBA 4QRVA 1UKFA 2AGAA 3H7DA 2G6DA 2AYOA 3PNRA 2JTCA 5CHVA 1S4VA 1AU2A 1CJLA 4I04A 1CB5A 1M6DA 2GHUA 2YJBA 2J7QC 3D6SA 2G8JA 3OF8A 2IPPB 4CDFB 3PHXA 2GFOA 1GECE 1U9XA 3KKUA 3PW3A 4AXLA 2B1NA 1YK8A 1ME3A 1KHPA 2HHNA 3IOQA 4P6GA 2IBIA 4XZXA 1AECA 1MS6A 4RY2A 2XU5A 4D8BA 3OVZA 4FJCA 1MHWA 1FH0A 1DF0A 2VHSA 2FTDA 3C0RA 3WXFA 3H89A 1PPOA 3KW9A 4G54A 2J7QA 3IEJA 3E1ZB 1VJVA 3BWKA 4D8EA 4W5CA 4X6IA 3K24A 3KX1A 3BB7A 3O0UA 1PBHA 4RF0A 4WA6A 4W5BA 1U9WA 4CZWA 1THEA 3BBAA 3PHWA 1YT7A 1EWOA 5PADA 4DMYA 4OVZA 4IUMA 4YYQA 3KFQA 4REZA 2P86A 5CVOB 1NQCA 2FT2A 4I07A 3IUTA 4OVZB 4RKXA 2PNSA 3BCNA 3ZNHA 3H8CA 1NLJA 1TU6A 2ATOA 5CVMA 3BPMA 1VSNA 4XR7A 4Q8HA 1PIPA 1X9YA 9PAPA 3I06A 3TMPA 1YVBA 2DCDA 1Y4HA 2Y6EA 1ITOA 3IMAA 2NQAA 1AYWA 5EZQA 3QT4A 1NPZA 2P0RA 2Z84A 2FYEA 5JZEA 4P16A 3RVWA 3OISA 2XU1A 3NHEA 3K8UA 2DCAA 3OF9A 2FRQA 3B21A 3MORA 3U8EA 1TL9A 4BOUA 2NQGA 3I3TA 1MIRA 1Y08A 2XU3A 1EWLA 2YJ2A 1YK7A 1IWDA 5EGWA 4BOSA 2O6XA 3W30A 1POPA 2B1MA 1AU0A 1CS8A 1U9VA 4Q8GA 3V6CA 2JQGR 1QMYA 1YALA 5J94A 3TNXA 1ICFA 3E9SA 2WBFX 5EF4A 4FIPA 1DKIA 1BGOA 1NB3A 2AUXA 5JH3A 4CDDB 1PPDA 3W31A 2HD5A 2R9MA 4AXMA 4XUIA 3RVVA 4YVAA 2BDLA 4YYSA 3N3GA 1AIMA 5F02A 1U5IA 4D8IA 2YJCA 2H7JA 2YJ9A 4X6HA 4MSXA 3TRKA 1U9QX 1ZIVA 2CB5A 1BP4A 4N4ZA 3N4CA 4MZSA 3BY4A 2UZJA 1KFUL 3PRPA 3HD3A 2BTWA 1QXPA 5KO3A 1GCBA 3F5VA 4PP2E 3P5UA 1PE6A 2BTWB 2DOSA 4RNAA 4K7CA 4YYVA 2PBHA 1AU3A 2DCBA 4YYRA 1GLOA 4BS6A 3H6SA 2DC9A 1AYUA 1CTEA 2AYNA 3RNVA 2BU3A 4IP3A 2DZYA 2FO5A 1ZCMA 3BOWA 2R9NA 4ZTBA 3S3QA 1SNKA 3O65A 3CBKA 4MM3B 2E03A 2E02A 1K3BB 5A24A 1PCIA 1QOLA 3HWNA 4CDCB 3PDFA 4RF1A 3DF0A 2DZZA 2R9CA 2DJFB 3B79A 2NQDB 2HWKA 3KWZA 2ARYA 2JRIA 3LFYA 3KSEA 1F2CA 3LXSA 1KXRA 4OEMA 1A6RA 3HHAA 3WXEA 3RVXA 4BS5A 1PVJA 1Q6KA 3C9EA 4PADA 3MP2A 2OZ2A 3P5WA 4BOPA 5CHTA 5CVNB 4A5UA 3ZUAA 4N79A 4FK5A 2HH5A 4WURA 2OP3A 3PBHA 1AU4A 3P5XA 5EZSA 5FPWA 2E01A 2PREA 2ACTA 2YJ8A 2R9OA 1PPPA 3P5VA 4MI7A 3CH3X 2R9FA 3WXGA 5E6JA 1BQIA 1TLOA 4P6EA 3KWBX 3IHPA 2DC7A 3CBJA 4YYUA 5K16A 4QBBA 3K9MA 3BPFA 2FRAA 1DEUA 4KLBA 1KFXL 1EWMA 2AUZA 3USVA 2JQFR 3HHIA 3MHHA 1JQPA 1NL6A 3V6EA 1HUCB 2G7YA 7PCKA 1KHQA 4OW0A 4R3DA 2P7UA 4GUAA 4N8WA 2DC8A 2Y5BA 4BQVA 2FUDA 3BC3A 4BOZA 1XKGA 5JA7A 4BSQA 3PRMA 3F75A 4MZOA 8PCHA 4M0WA 4ZUXU 4QRXA 2CIOA 1O0EA 4HXDB 1STFE 4YYWA 3MJ5A 4BOQA 1CQDA 3ERVA 4OELA 3CH2X 1F2AA 4HWYA 2DC6A 4CDEB 2FE8A 2F7DA 3OVXA 1CSBB 2FQ9A 3PSEA 3OQCA 1CVZA 3PHUA 2AS8A 2DJGB 1F2BA 2NQIA 4PP1A 4W4UA 1GMYA 1MEMA 3M99A 4PI3A 1NB5A 2R6NA 1MDWA 4BPVA 3QSDA 3IFUA 3N3KA 4YV8A 3PT2A 1QDQA 2F1GA 3H8BA 2PADA 4I05A 2BDZA 4X6JA 2DCCA 1MEGA 1AYVA 2XU4A 2OULA 1EF7A 1SP4B 2E00A 1PPNA 2AIMA 1PXVA 1F29A 3S3RA 4QRGA 2C0YA 4DMXA 2HXZA 4PT5A 1ATKA 2AU1A 1EWPA 6PADA 2AVWA 2VHFA 3MHSA 3MTVA 3MTNA 1BY8A 3IV2A 1CV8A 3AI8A 4QH6A 3GCBA 1ME4A
chains in the Genus database with same CATH topology
1PADA 2G8EA 3O1GA 3QJ3A 1CPJA 4QRVA 1W4TA 3H7DA 2G6DA 2AYOA 3PNRA 4NV8A 5CHVA 1S4VA 1AU2A 1CJLA 4I04A 1CB5A 1M6DA 2GHUA 2YJBA 3D6SA 2G8JA 3OF8A 2IPPB 4CDFB 2GFOA 1GECE 1U9XA 3KKUA 3PW3A 4AXLA 2B1NA 1YK8A 1ME3A 1KHPA 2HHNA 3IOQA 4P6GA 2IBIA 1AECA 1MS6A 4RY2A 2XU5A 3OVZA 4FJCA 1MHWA 1FH0A 1DF0A 2VHSA 2FTDA 3WXFA 3H89A 1PPOA 3KW9A 4G54A 3IEJA 3E1ZB 1VJVA 3BWKA 2VFBA 4W5CA 4X6IA 3K24A 3KX1A 3O0UA 1PBHA 4WA6A 4W5BA 1U9WA 4CZWA 1THEA 1YT7A 1EWOA 1W5RA 5PADA 4DMYA 4YYQA 3KFQA 2P86A 5CVOB 1NQCA 3LTWA 2FT2A 4I07A 3IUTA 2PNSA 3BCNA 3H8CA 1NLJA 1TU6A 2ATOA 5CVMA 3BPMA 1VSNA 4XR7A 4Q8HA 1PIPA 1X9YA 9PAPA 3I06A 1YVBA 2DCDA 1Y4HA 2Y6EA 1ITOA 3IMAA 2NQAA 1AYWA 3QT4A 1NPZA 2P0RA 2FYEA 3RVWA 3OISA 2XU1A 3NHEA 3K8UA 2DCAA 3OF9A 2FRQA 4NV7A 3MORA 3U8EA 1TL9A 2NQGA 3I3TA 1MIRA 1Y08A 2XU3A 1EWLA 2YJ2A 1YK7A 1IWDA 5EGWA 2O6XA 4BGFA 1POPA 2B1MA 1AU0A 1CS8A 1U9VA 4Q8GA 3V6CA 2JQGR 1QMYA 1YALA 5J94A 3TNXA 1ICFA 5EF4A 2WBFX 4FIPA 1BGOA 1NB3A 2AUXA 5JH3A 4CDDB 1PPDA 2HD5A 2R9MA 4AXMA 4XUIA 3RVVA 4YVAA 2BDLA 4YYSA 3N3GA 1AIMA 5F02A 1U5IA 2YJCA 2H7JA 2YJ9A 4X6HA 4MSXA 1U9QX 1ZIVA 2CB5A 1BP4A 4N4ZA 3N4CA 4MZSA 1KFUL 3HD3A 1QXPA 1GCBA 3F5VA 4PP2E 3P5UA 1PE6A 4K7CA 4YYVA 2PBHA 4GUZA 1AU3A 2DCBA 4YYRA 1GLOA 4BS6A 3H6SA 2DC9A 1AYUA 1CTEA 2AYNA 2DZYA 2FO5A 1ZCMA 3BOWA 2R9NA 3S3QA 1SNKA 3CBKA 2E03A 2E02A 1K3BB 3D9WA 5A24A 1PCIA 1QOLA 3HWNA 4CDCB 3PDFA 3DF0A 2DZZA 2R9CA 2DJFB 3B79A 2NQDB 3KWZA 2ARYA 3LFYA 3KSEA 1F2CA 3LXSA 1KXRA 4OEMA 1A6RA 3HHAA 3WXEA 3RVXA 4BS5A 1Q6KA 3C9EA 4PADA 2BSZA 2OZ2A 3P5WA 5CHTA 1E2TA 5CVNB 1GX3A 3ZUAA 4N79A 4FK5A 2HH5A 2OP3A 3PBHA 1AU4A 3P5XA 5FPWA 2E01A 2PREA 2ACTA 2YJ8A 2R9OA 1PPPA 3P5VA 3CH3X 2R9FA 3WXGA 1BQIA 1TLOA 4P6EA 3KWBX 3IHPA 2DC7A 3CBJA 4YYUA 5K16A 4QBBA 3K9MA 3BPFA 2FRAA 1DEUA 4KLBA 1KFXL 1EWMA 2AUZA 3USVA 4C5PA 2JQFR 3HHIA 3MHHA 1JQPA 1NL6A 3V6EA 1HUCB 2G7YA 7PCKA 1KHQA 2P7UA 2VFCA 4N8WA 2DC8A 2Y5BA 4BQVA 2FUDA 3BC3A 1XKGA 5JA7A 4BSQA 3F75A 8PCHA 4ZUXU 4QRXA 2CIOA 1O0EA 1STFE 4YYWA 1CQDA 3ERVA 4OELA 3CH2X 1F2AA 4HWYA 2DC6A 4CDEB 2F7DA 3OVXA 1CSBB 2FQ9A 1CVZA 2AS8A 2DJGB 1F2BA 2NQIA 4PP1A 4W4UA 1GMYA 1MEMA 3M99A 4PI3A 3GCBA 1NB5A 2R6NA 1MDWA 4BPVA 3QSDA 3N3KA 4YV8A 1QDQA 2F1GA 3H8BA 2PADA 4I05A 2BDZA 4X6JA 2DCCA 1MEGA 1AYVA 2XU4A 4B55A 2OULA 1EF7A 1SP4B 2E00A 1W6FA 1PPNA 2AIMA 1PXVA 1F29A 3S3RA 4QRGA 2C0YA 4DMXA 2HXZA 1ATKA 2AU1A 1EWPA 6PADA 2AVWA 2VHFA 3MHSA 3MTNA 1BY8A 3IV2A 1CV8A 3AI8A 4QH6A 4MZOA 1ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAD A;  2G8E A;  3O1G A;  3QJ3 A;  1CPJ A;  4QRV A;  3H7D A;  2G6D A;  2AYO A;  3PNR A;  5CHV A;  1S4V A;  1AU2 A;  1CJL A;  4I04 A;  1CB5 A;  1M6D A;  2GHU A;  2YJB A;  3D6S A;  2G8J A;  3OF8 A;  2IPP B;  4CDF B;  2GFO A;  1GEC E;  1U9X A;  3KKU A;  3PW3 A;  4AXL A;  2B1N A;  1YK8 A;  1ME3 A;  1KHP A;  2HHN A;  3IOQ A;  4P6G A;  2IBI A;  1AEC A;  1MS6 A;  4RY2 A;  2XU5 A;  3OVZ A;  4FJC A;  1MHW A;  1FH0 A;  1DF0 A;  2VHS A;  2FTD A;  3WXF A;  3H89 A;  1PPO A;  3KW9 A;  4G54 A;  3IEJ A;  3E1Z B;  1VJV A;  3BWK A;  4W5C A;  4X6I A;  3K24 A;  3KX1 A;  3O0U A;  1PBH A;  4WA6 A;  4W5B A;  1U9W A;  4CZW A;  1THE A;  1YT7 A;  1EWO A;  5PAD A;  4DMY A;  4YYQ A;  3KFQ A;  2P86 A;  5CVO B;  1NQC A;  2FT2 A;  4I07 A;  3IUT A;  2PNS A;  3BCN A;  3H8C A;  1NLJ A;  1TU6 A;  2ATO A;  5CVM A;  3BPM A;  1VSN A;  4XR7 A;  4Q8H A;  1PIP A;  1X9Y A;  9PAP A;  3I06 A;  1YVB A;  2DCD A;  1Y4H A;  2Y6E A;  1ITO A;  3IMA A;  2NQA A;  1AYW A;  3QT4 A;  1NPZ A;  2P0R A;  2FYE A;  3RVW A;  3OIS A;  2XU1 A;  3NHE A;  3K8U A;  2DCA A;  3OF9 A;  2FRQ A;  3MOR A;  3U8E A;  1TL9 A;  2NQG A;  3I3T A;  1MIR A;  1Y08 A;  2XU3 A;  1EWL A;  2YJ2 A;  1YK7 A;  1IWD A;  5EGW A;  2O6X A;  1POP A;  2B1M A;  1AU0 A;  1CS8 A;  1U9V A;  4Q8G A;  3V6C A;  2JQG R;  1QMY A;  1YAL A;  5J94 A;  3TNX A;  1ICF A;  5EF4 A;  2WBF X;  4FIP A;  1BGO A;  1NB3 A;  2AUX A;  5JH3 A;  4CDD B;  1PPD A;  2HD5 A;  2R9M A;  4AXM A;  4XUI A;  3RVV A;  4YVA A;  2BDL A;  4YYS A;  3N3G A;  1AIM A;  5F02 A;  1U5I A;  2YJC A;  2H7J A;  2YJ9 A;  4X6H A;  4MSX A;  1U9Q X;  1ZIV A;  2CB5 A;  1BP4 A;  4N4Z A;  3N4C A;  4MZS A;  1KFU L;  3HD3 A;  1QXP A;  1GCB A;  3F5V A;  4PP2 E;  3P5U A;  1PE6 A;  4K7C A;  4YYV A;  2PBH A;  1AU3 A;  2DCB A;  4YYR A;  1GLO A;  4BS6 A;  3H6S A;  2DC9 A;  1AYU A;  1CTE A;  2AYN A;  2DZY A;  2FO5 A;  1ZCM A;  3BOW A;  2R9N A;  3S3Q A;  1SNK A;  3CBK A;  2E03 A;  2E02 A;  1K3B B;  5A24 A;  1PCI A;  1QOL A;  3HWN A;  4CDC B;  3PDF A;  3DF0 A;  2DZZ A;  2R9C A;  2DJF B;  3B79 A;  2NQD B;  3KWZ A;  2ARY A;  3LFY A;  3KSE A;  1F2C A;  3LXS A;  1KXR A;  4OEM A;  1A6R A;  3HHA A;  3WXE A;  3RVX A;  4BS5 A;  1Q6K A;  3C9E A;  4PAD A;  2OZ2 A;  3P5W A;  5CHT A;  5CVN B;  3ZUA A;  4N79 A;  4FK5 A;  2HH5 A;  2OP3 A;  3PBH A;  1AU4 A;  3P5X A;  5FPW A;  2E01 A;  2PRE A;  2ACT A;  2YJ8 A;  2R9O A;  1PPP A;  3P5V A;  3CH3 X;  2R9F A;  3WXG A;  1BQI A;  1TLO A;  4P6E A;  3KWB X;  3IHP A;  2DC7 A;  3CBJ A;  4YYU A;  5K16 A;  4QBB A;  3K9M A;  3BPF A;  2FRA A;  1DEU A;  4KLB A;  1KFX L;  1EWM A;  2AUZ A;  3USV A;  2JQF R;  3HHI A;  3MHH A;  1JQP A;  1NL6 A;  3V6E A;  1HUC B;  2G7Y A;  7PCK A;  1KHQ A;  2P7U A;  4N8W A;  2DC8 A;  2Y5B A;  4BQV A;  2FUD A;  3BC3 A;  1XKG A;  5JA7 A;  4BSQ A;  3F75 A;  8PCH A;  4ZUX U;  4QRX A;  2CIO A;  1O0E A;  1STF E;  4YYW A;  1CQD A;  3ERV A;  4OEL A;  3CH2 X;  1F2A A;  4HWY A;  2DC6 A;  4CDE B;  2F7D A;  3OVX A;  1CSB B;  2FQ9 A;  1CVZ A;  2AS8 A;  2DJG B;  1F2B A;  2NQI A;  4PP1 A;  4W4U A;  1GMY A;  1MEM A;  3M99 A;  4PI3 A;  3GCB A;  1NB5 A;  2R6N A;  1MDW A;  4BPV A;  3QSD A;  3N3K A;  4YV8 A;  1QDQ A;  2F1G A;  3H8B A;  2PAD A;  4I05 A;  2BDZ A;  4X6J A;  2DCC A;  1MEG A;  1AYV A;  2XU4 A;  2OUL A;  1EF7 A;  1SP4 B;  2E00 A;  1PPN A;  2AIM A;  1PXV A;  1F29 A;  3S3R A;  4QRG A;  2C0Y A;  4DMX A;  2HXZ A;  1ATK A;  2AU1 A;  1EWP A;  6PAD A;  2AVW A;  2VHF A;  3MHS A;  3MTN A;  1BY8 A;  3IV2 A;  1CV8 A;  3AI8 A;  4QH6 A;  4MZO A;  1ME4 A; 
#chains in the Genus database with same CATH topology
 1PAD A;  2G8E A;  3O1G A;  3QJ3 A;  1CPJ A;  1YZB A;  4QRV A;  1UKF A;  2AGA A;  3H7D A;  2G6D A;  2AYO A;  3PNR A;  2JTC A;  5CHV A;  1S4V A;  1AU2 A;  1CJL A;  4I04 A;  1CB5 A;  1M6D A;  2GHU A;  2YJB A;  2J7Q C;  3D6S A;  2G8J A;  3OF8 A;  2IPP B;  4CDF B;  3PHX A;  2GFO A;  1GEC E;  1U9X A;  3KKU A;  3PW3 A;  4AXL A;  2B1N A;  1YK8 A;  1ME3 A;  1KHP A;  2HHN A;  3IOQ A;  4P6G A;  2IBI A;  4XZX A;  1AEC A;  1MS6 A;  4RY2 A;  2XU5 A;  4D8B A;  3OVZ A;  4FJC A;  1MHW A;  1FH0 A;  1DF0 A;  2VHS A;  2FTD A;  3C0R A;  3WXF A;  3H89 A;  1PPO A;  3KW9 A;  4G54 A;  2J7Q A;  3IEJ A;  3E1Z B;  1VJV A;  3BWK A;  4D8E A;  4W5C A;  4X6I A;  3K24 A;  3KX1 A;  3BB7 A;  3O0U A;  1PBH A;  4RF0 A;  4WA6 A;  4W5B A;  1U9W A;  4CZW A;  1THE A;  3BBA A;  3PHW A;  1YT7 A;  1EWO A;  5PAD A;  4DMY A;  4OVZ A;  4IUM A;  4YYQ A;  3KFQ A;  4REZ A;  2P86 A;  5CVO B;  1NQC A;  2FT2 A;  4I07 A;  3IUT A;  4OVZ B;  4RKX A;  2PNS A;  3BCN A;  3ZNH A;  3H8C A;  1NLJ A;  1TU6 A;  2ATO A;  5CVM A;  3BPM A;  1VSN A;  4XR7 A;  4Q8H A;  1PIP A;  1X9Y A;  9PAP A;  3I06 A;  3TMP A;  1YVB A;  2DCD A;  1Y4H A;  2Y6E A;  1ITO A;  3IMA A;  2NQA A;  1AYW A;  5EZQ A;  3QT4 A;  1NPZ A;  2P0R A;  2Z84 A;  2FYE A;  5JZE A;  4P16 A;  3RVW A;  3OIS A;  2XU1 A;  3NHE A;  3K8U A;  2DCA A;  3OF9 A;  2FRQ A;  3B21 A;  3MOR A;  3U8E A;  1TL9 A;  4BOU A;  2NQG A;  3I3T A;  1MIR A;  1Y08 A;  2XU3 A;  1EWL A;  2YJ2 A;  1YK7 A;  1IWD A;  5EGW A;  4BOS A;  2O6X A;  3W30 A;  1POP A;  2B1M A;  1AU0 A;  1CS8 A;  1U9V A;  4Q8G A;  3V6C A;  2JQG R;  1QMY A;  1YAL A;  5J94 A;  3TNX A;  1ICF A;  3E9S A;  2WBF X;  5EF4 A;  4FIP A;  1DKI A;  1BGO A;  1NB3 A;  2AUX A;  5JH3 A;  4CDD B;  1PPD A;  3W31 A;  2HD5 A;  2R9M A;  4AXM A;  4XUI A;  3RVV A;  4YVA A;  2BDL A;  4YYS A;  3N3G A;  1AIM A;  5F02 A;  1U5I A;  4D8I A;  2YJC A;  2H7J A;  2YJ9 A;  4X6H A;  4MSX A;  3TRK A;  1U9Q X;  1ZIV A;  2CB5 A;  1BP4 A;  4N4Z A;  3N4C A;  4MZS A;  3BY4 A;  2UZJ A;  1KFU L;  3PRP A;  3HD3 A;  2BTW A;  1QXP A;  5KO3 A;  1GCB A;  3F5V A;  4PP2 E;  3P5U A;  1PE6 A;  2BTW B;  2DOS A;  4RNA A;  4K7C A;  4YYV A;  2PBH A;  1AU3 A;  2DCB A;  4YYR A;  1GLO A;  4BS6 A;  3H6S A;  2DC9 A;  1AYU A;  1CTE A;  2AYN A;  3RNV A;  2BU3 A;  4IP3 A;  2DZY A;  2FO5 A;  1ZCM A;  3BOW A;  2R9N A;  4ZTB A;  3S3Q A;  1SNK A;  3O65 A;  3CBK A;  4MM3 B;  2E03 A;  2E02 A;  1K3B B;  5A24 A;  1PCI A;  1QOL A;  3HWN A;  4CDC B;  3PDF A;  4RF1 A;  3DF0 A;  2DZZ A;  2R9C A;  2DJF B;  3B79 A;  2NQD B;  2HWK A;  3KWZ A;  2ARY A;  2JRI A;  3LFY A;  3KSE A;  1F2C A;  3LXS A;  1KXR A;  4OEM A;  1A6R A;  3HHA A;  3WXE A;  3RVX A;  4BS5 A;  1PVJ A;  1Q6K A;  3C9E A;  4PAD A;  3MP2 A;  2OZ2 A;  3P5W A;  4BOP A;  5CHT A;  5CVN B;  4A5U A;  3ZUA A;  4N79 A;  4FK5 A;  2HH5 A;  4WUR A;  2OP3 A;  3PBH A;  1AU4 A;  3P5X A;  5EZS A;  5FPW A;  2E01 A;  2PRE A;  2ACT A;  2YJ8 A;  2R9O A;  1PPP A;  3P5V A;  4MI7 A;  3CH3 X;  2R9F A;  3WXG A;  5E6J A;  1BQI A;  1TLO A;  4P6E A;  3KWB X;  3IHP A;  2DC7 A;  3CBJ A;  4YYU A;  5K16 A;  4QBB A;  3K9M A;  3BPF A;  2FRA A;  1DEU A;  4KLB A;  1KFX L;  1EWM A;  2AUZ A;  3USV A;  2JQF R;  3HHI A;  3MHH A;  1JQP A;  1NL6 A;  3V6E A;  1HUC B;  2G7Y A;  7PCK A;  1KHQ A;  4OW0 A;  4R3D A;  2P7U A;  4GUA A;  4N8W A;  2DC8 A;  2Y5B A;  4BQV A;  2FUD A;  3BC3 A;  4BOZ A;  1XKG A;  5JA7 A;  4BSQ A;  3PRM A;  3F75 A;  4MZO A;  8PCH A;  4M0W A;  4ZUX U;  4QRX A;  2CIO A;  1O0E A;  4HXD B;  1STF E;  4YYW A;  3MJ5 A;  4BOQ A;  1CQD A;  3ERV A;  4OEL A;  3CH2 X;  1F2A A;  4HWY A;  2DC6 A;  4CDE B;  2FE8 A;  2F7D A;  3OVX A;  1CSB B;  2FQ9 A;  3PSE A;  3OQC A;  1CVZ A;  3PHU A;  2AS8 A;  2DJG B;  1F2B A;  2NQI A;  4PP1 A;  4W4U A;  1GMY A;  1MEM A;  3M99 A;  4PI3 A;  1NB5 A;  2R6N A;  1MDW A;  4BPV A;  3QSD A;  3IFU A;  3N3K A;  4YV8 A;  3PT2 A;  1QDQ A;  2F1G A;  3H8B A;  2PAD A;  4I05 A;  2BDZ A;  4X6J A;  2DCC A;  1MEG A;  1AYV A;  2XU4 A;  2OUL A;  1EF7 A;  1SP4 B;  2E00 A;  1PPN A;  2AIM A;  1PXV A;  1F29 A;  3S3R A;  4QRG A;  2C0Y A;  4DMX A;  2HXZ A;  4PT5 A;  1ATK A;  2AU1 A;  1EWP A;  6PAD A;  2AVW A;  2VHF A;  3MHS A;  3MTV A;  3MTN A;  1BY8 A;  3IV2 A;  1CV8 A;  3AI8 A;  4QH6 A;  3GCB A;  1ME4 A; 
#chains in the Genus database with same CATH homology
 1PAD A;  2G8E A;  3O1G A;  3QJ3 A;  1CPJ A;  4QRV A;  1W4T A;  3H7D A;  2G6D A;  2AYO A;  3PNR A;  4NV8 A;  5CHV A;  1S4V A;  1AU2 A;  1CJL A;  4I04 A;  1CB5 A;  1M6D A;  2GHU A;  2YJB A;  3D6S A;  2G8J A;  3OF8 A;  2IPP B;  4CDF B;  2GFO A;  1GEC E;  1U9X A;  3KKU A;  3PW3 A;  4AXL A;  2B1N A;  1YK8 A;  1ME3 A;  1KHP A;  2HHN A;  3IOQ A;  4P6G A;  2IBI A;  1AEC A;  1MS6 A;  4RY2 A;  2XU5 A;  3OVZ A;  4FJC A;  1MHW A;  1FH0 A;  1DF0 A;  2VHS A;  2FTD A;  3WXF A;  3H89 A;  1PPO A;  3KW9 A;  4G54 A;  3IEJ A;  3E1Z B;  1VJV A;  3BWK A;  2VFB A;  4W5C A;  4X6I A;  3K24 A;  3KX1 A;  3O0U A;  1PBH A;  4WA6 A;  4W5B A;  1U9W A;  4CZW A;  1THE A;  1YT7 A;  1EWO A;  1W5R A;  5PAD A;  4DMY A;  4YYQ A;  3KFQ A;  2P86 A;  5CVO B;  1NQC A;  3LTW A;  2FT2 A;  4I07 A;  3IUT A;  2PNS A;  3BCN A;  3H8C A;  1NLJ A;  1TU6 A;  2ATO A;  5CVM A;  3BPM A;  1VSN A;  4XR7 A;  4Q8H A;  1PIP A;  1X9Y A;  9PAP A;  3I06 A;  1YVB A;  2DCD A;  1Y4H A;  2Y6E A;  1ITO A;  3IMA A;  2NQA A;  1AYW A;  3QT4 A;  1NPZ A;  2P0R A;  2FYE A;  3RVW A;  3OIS A;  2XU1 A;  3NHE A;  3K8U A;  2DCA A;  3OF9 A;  2FRQ A;  4NV7 A;  3MOR A;  3U8E A;  1TL9 A;  2NQG A;  3I3T A;  1MIR A;  1Y08 A;  2XU3 A;  1EWL A;  2YJ2 A;  1YK7 A;  1IWD A;  5EGW A;  2O6X A;  4BGF A;  1POP A;  2B1M A;  1AU0 A;  1CS8 A;  1U9V A;  4Q8G A;  3V6C A;  2JQG R;  1QMY A;  1YAL A;  5J94 A;  3TNX A;  1ICF A;  5EF4 A;  2WBF X;  4FIP A;  1BGO A;  1NB3 A;  2AUX A;  5JH3 A;  4CDD B;  1PPD A;  2HD5 A;  2R9M A;  4AXM A;  4XUI A;  3RVV A;  4YVA A;  2BDL A;  4YYS A;  3N3G A;  1AIM A;  5F02 A;  1U5I A;  2YJC A;  2H7J A;  2YJ9 A;  4X6H A;  4MSX A;  1U9Q X;  1ZIV A;  2CB5 A;  1BP4 A;  4N4Z A;  3N4C A;  4MZS A;  1KFU L;  3HD3 A;  1QXP A;  1GCB A;  3F5V A;  4PP2 E;  3P5U A;  1PE6 A;  4K7C A;  4YYV A;  2PBH A;  4GUZ A;  1AU3 A;  2DCB A;  4YYR A;  1GLO A;  4BS6 A;  3H6S A;  2DC9 A;  1AYU A;  1CTE A;  2AYN A;  2DZY A;  2FO5 A;  1ZCM A;  3BOW A;  2R9N A;  3S3Q A;  1SNK A;  3CBK A;  2E03 A;  2E02 A;  1K3B B;  3D9W A;  5A24 A;  1PCI A;  1QOL A;  3HWN A;  4CDC B;  3PDF A;  3DF0 A;  2DZZ A;  2R9C A;  2DJF B;  3B79 A;  2NQD B;  3KWZ A;  2ARY A;  3LFY A;  3KSE A;  1F2C A;  3LXS A;  1KXR A;  4OEM A;  1A6R A;  3HHA A;  3WXE A;  3RVX A;  4BS5 A;  1Q6K A;  3C9E A;  4PAD A;  2BSZ A;  2OZ2 A;  3P5W A;  5CHT A;  1E2T A;  5CVN B;  1GX3 A;  3ZUA A;  4N79 A;  4FK5 A;  2HH5 A;  2OP3 A;  3PBH A;  1AU4 A;  3P5X A;  5FPW A;  2E01 A;  2PRE A;  2ACT A;  2YJ8 A;  2R9O A;  1PPP A;  3P5V A;  3CH3 X;  2R9F A;  3WXG A;  1BQI A;  1TLO A;  4P6E A;  3KWB X;  3IHP A;  2DC7 A;  3CBJ A;  4YYU A;  5K16 A;  4QBB A;  3K9M A;  3BPF A;  2FRA A;  1DEU A;  4KLB A;  1KFX L;  1EWM A;  2AUZ A;  3USV A;  4C5P A;  2JQF R;  3HHI A;  3MHH A;  1JQP A;  1NL6 A;  3V6E A;  1HUC B;  2G7Y A;  7PCK A;  1KHQ A;  2P7U A;  2VFC A;  4N8W A;  2DC8 A;  2Y5B A;  4BQV A;  2FUD A;  3BC3 A;  1XKG A;  5JA7 A;  4BSQ A;  3F75 A;  8PCH A;  4ZUX U;  4QRX A;  2CIO A;  1O0E A;  1STF E;  4YYW A;  1CQD A;  3ERV A;  4OEL A;  3CH2 X;  1F2A A;  4HWY A;  2DC6 A;  4CDE B;  2F7D A;  3OVX A;  1CSB B;  2FQ9 A;  1CVZ A;  2AS8 A;  2DJG B;  1F2B A;  2NQI A;  4PP1 A;  4W4U A;  1GMY A;  1MEM A;  3M99 A;  4PI3 A;  3GCB A;  1NB5 A;  2R6N A;  1MDW A;  4BPV A;  3QSD A;  3N3K A;  4YV8 A;  1QDQ A;  2F1G A;  3H8B A;  2PAD A;  4I05 A;  2BDZ A;  4X6J A;  2DCC A;  1MEG A;  1AYV A;  2XU4 A;  4B55 A;  2OUL A;  1EF7 A;  1SP4 B;  2E00 A;  1W6F A;  1PPN A;  2AIM A;  1PXV A;  1F29 A;  3S3R A;  4QRG A;  2C0Y A;  4DMX A;  2HXZ A;  1ATK A;  2AU1 A;  1EWP A;  6PAD A;  2AVW A;  2VHF A;  3MHS A;  3MTN A;  1BY8 A;  3IV2 A;  1CV8 A;  3AI8 A;  4QH6 A;  4MZO A;  1ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...