3LFYA

Ctd of tarocystatin in complex with papain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
212
structure length
211
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
molecule tags Hydrolase
publication title Complex structure of tarocystatin with papain and characterization of tarocystatin proposed the role of C-terminal extension for inhibitory mechanism of group-2 phytocystatins
rcsb
total genus 61
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lfyA00
4AXLA 5CVMA 4YVAA 2FYEA 2R6NA 5JA7A 4YYSA 2DC6A 5FPWA 9PAPA 3PNRA 1KFXL 1PCIA 2PBHA 2R9NA 1ME3A 5K16A 2DJFB 4CDCB 4CDFB 3PW3A 1Y08A 4PP1A 1MHWA 2AYNA 2XU5A 3BC3A 3KFQA 1EF7A 2JQFR 1VJVA 1NL6A 2DC9A 4N4ZA 3O0UA 4BPVA 1PPNA 2IPPB 4PP2E 4XR7A 2YJ9A 2BDLA 3PBHA 1X9YA 3QSDA 1BY8A 1PPOA 2FRQA 1EWPA 1CVZA 2VHSA 4CDDB 1SP4B 2E03A 2CB5A 3KWBX 1POPA 3H89A 1ZCMA 3KSEA 3KX1A 1QMYA 2YJBA 2O6XA 3DF0A 2JQGR 3BWKA 2YJCA 4K7CA 4Q8GA 5CVOB 2AYOA 3K8UA 1MDWA 2FQ9A 1EWMA 1U9WA 1CPJA 2WBFX 1AECA 2P0RA 2DZZA 1NQCA 1AIMA 5J94A 3USVA 1U9VA 3F5VA 4Q8HA 1NB5A 5A24A 1Y4HA 1SNKA 4QRXA 4I05A 3P5WA 1NLJA 1DEUA 3ERVA 2DCCA 2AU1A 1PPDA 3V6EA 3C9EA 2B1NA 3IUTA 4RY2A 3B79A 3M99A 1EWLA 3O1GA 2BDZA 2ARYA 1Q6KA 3GCBA 2GHUA 4XUIA 1GLOA 2Y5BA 2FO5A 3QT4A 3IEJA 3N3KA 1CTEA 4BQVA 4YYWA 1AU0A 4ZUXU 2NQDB 3K9MA 3MHHA 4OEMA 2FUDA 1YK7A 4AXMA 3S3QA 4BS5A 2DCAA 1BGOA 1PIPA 1CV8A 2DC7A 2GFOA 3HHAA 7PCKA 2PADA 4PI3A 4MZOA 5EGWA 2XU4A 2FRAA 4BSQA 2NQGA 1S4VA 2CIOA 2AUZA 3IHPA 3IV2A 3MORA 4QRGA 1MS6A 4DMYA 3HWNA 2OULA 3F75A 1YK8A 2DCBA 4OELA 3D6SA 4G54A 1F29A 3S3RA 3IMAA 2PREA 3BCNA 3WXGA 5PADA 3P5UA 4PADA 4CDEB 1KFUL 1CJLA 4X6IA 1MEMA 3AI8A 1CB5A 1YT7A 3RVVA 2DJGB 4YYRA 3RVWA 3P5VA 1JQPA 1QXPA 1F2BA 4N79A 1AU4A 2NQIA 3KW9A 1DF0A 1F2AA 3H6SA 1CSBB 4X6HA 2AVWA 2HH5A 2ATOA 1GECE 4DMXA 1KHPA 1YALA 1ME4A 1YVBA 2AUXA 3I06A 3WXFA 2C0YA 1VSNA 4X6JA 1THEA 1U5IA 2H7JA 5F02A 6PADA 3KKUA 5CHVA 4W5CA 3OISA 1IWDA 2R9CA 1ZIVA 4YV8A 2HD5A 1FH0A 4YYQA 4I07A 1AU2A 4N8WA 3ZUAA 1AYWA 2E00A 1MIRA 3LFYA 3BPMA 1K3BB 1AYVA 1KHQA 2P86A 4QBBA 2E02A 3K24A 4YYVA 4P6GA 1AYUA 3I3TA 3OVXA 4YYUA 4FJCA 2G8JA 4MSXA 2DCDA 2R9FA 2PNSA 3H8BA 1PPPA 4HWYA 2E01A 2B1MA 3QJ3A 1ITOA 1O0EA 3OF9A 4QRVA 2F1GA 3V6CA 1TU6A 1MEGA 1PE6A 3BPFA 3E1ZB 5EF4A 3LXSA 4WA6A 5CVNB 1TL9A 3U8EA 1BP4A 2FT2A 3OF8A 1U9XA 1ATKA 2P7UA 4P6EA 1PADA 3PDFA 5CHTA 3KWZA 4BS6A 2OP3A 3HD3A 3WXEA 2HXZA 1CS8A 2AIMA 2AS8A 2XU1A 2NQAA 2G6DA 3CBKA 3H7DA 3P5XA 2G7YA 4W5BA 3RVXA 1A6RA 2FTDA 3CBJA 2YJ2A 2XU3A 4W4UA 4QH6A 3IOQA 3N4CA 3MTNA 1NPZA 3H8CA 3N3GA 1TLOA 1XKGA 3HHIA 1AU3A 2R9MA 1PBHA 4MZSA 1HUCB 1GCBA 1EWOA 1STFE 5JH3A 2VHFA 1QDQA 4KLBA 2G8EA 2R9OA 4FIPA 3BOWA 3OVZA 1NB3A 4CZWA 1ICFA 4I04A 2F7DA 2ACTA 3TNXA 8PCHA 1F2CA 2Y6EA 2OZ2A 2DC8A 1KXRA 2YJ8A 2IBIA 3CH2X 1U9QX 3NHEA 4FK5A 1GMYA 1M6DA 1PXVA 2HHNA 3MHSA 1QOLA 3CH3X 1BQIA 1CQDA 2DZYA
chains in the Genus database with same CATH superfamily
4AXLA 5CVMA 4YVAA 3MTVA 2FYEA 2R6NA 5JA7A 4YYSA 2DC6A 5FPWA 3PHXA 3PNRA 9PAPA 1KFXL 1PCIA 1PVJA 2PBHA 4REZA 2R9NA 1ME3A 5K16A 2DJFB 4CDCB 3BY4A 3PHWA 4CDFB 3PW3A 1Y08A 4PP1A 1MHWA 2AYNA 2XU5A 3BC3A 3KFQA 1EF7A 2JQFR 1VJVA 1NL6A 2DC9A 4N4ZA 3O0UA 4BPVA 1PPNA 2IPPB 4PP2E 4XR7A 2YJ9A 2BDLA 3PBHA 1X9YA 3QSDA 1BY8A 1PPOA 2FRQA 4IP3A 1EWPA 1CVZA 2VHSA 4CDDB 1SP4B 2E03A 2CB5A 2FE8A 3KWBX 1POPA 3H89A 1ZCMA 3KSEA 3KX1A 4PT5A 1QMYA 2YJBA 2O6XA 3DF0A 2JQGR 3PSEA 3BWKA 2YJCA 4K7CA 4Q8GA 5CVOB 2AYOA 3K8UA 1MDWA 2FQ9A 3PHUA 1EWMA 1DKIA 1U9WA 1CPJA 2WBFX 1AECA 2P0RA 4R3DA 2DZZA 1NQCA 1AIMA 5J94A 3USVA 4A5UA 1U9VA 3F5VA 4Q8HA 1NB5A 5A24A 1Y4HA 1SNKA 4QRXA 4I05A 3P5WA 4RF0A 1NLJA 1DEUA 3ERVA 3W30A 2DCCA 2AU1A 1PPDA 3V6EA 3C9EA 2B1NA 2J7QC 3IUTA 4RY2A 3B79A 4HXDB 3B21A 3M99A 1EWLA 3O1GA 2BDZA 2ARYA 1Q6KA 3W31A 3GCBA 2GHUA 4XUIA 1GLOA 2Y5BA 2FO5A 3QT4A 3IEJA 3N3KA 1CTEA 4BQVA 4YYWA 1AU0A 4ZUXU 4D8BA 2NQDB 3K9MA 3MHHA 4OEMA 2FUDA 1YK7A 4AXMA 3S3QA 4BS5A 4IUMA 2DCAA 1BGOA 1PIPA 1CV8A 2DC7A 4RKXA 2GFOA 3HHAA 4D8IA 7PCKA 2PADA 4PI3A 4MZOA 5EGWA 2XU4A 4BOUA 2FRAA 4BSQA 2DOSA 2NQGA 1S4VA 2CIOA 3MJ5A 2AUZA 3IHPA 3IV2A 3BBAA 3MORA 4QRGA 1MS6A 4MM3B 4DMYA 3HWNA 2OULA 3F75A 1YK8A 2DCBA 4OELA 3D6SA 4G54A 4RNAA 1F29A 3S3RA 3IMAA 2PREA 3BCNA 3WXGA 5PADA 3P5UA 4PADA 2J7QA 4CDEB 1KFUL 1CJLA 4X6IA 1MEMA 3AI8A 1CB5A 1YT7A 3RVVA 2DJGB 4YYRA 3RVWA 3P5VA 1JQPA 1QXPA 1F2BA 2BU3A 4N79A 1AU4A 2NQIA 3KW9A 1DF0A 1F2AA 3H6SA 1CSBB 4X6HA 2AVWA 2HH5A 2ATOA 1YZBA 1GECE 4DMXA 1KHPA 1YALA 1ME4A 1YVBA 5JZEA 2AUXA 3I06A 3WXFA 2C0YA 1VSNA 4X6JA 5EZQA 1THEA 1U5IA 2H7JA 3IFUA 3PT2A 5F02A 6PADA 3KKUA 5CHVA 4W5CA 3OISA 1IWDA 2R9CA 1ZIVA 4YV8A 2HD5A 1FH0A 4XZXA 4YYQA 4I07A 4N8WA 1AU2A 3ZUAA 1AYWA 2E00A 2JRIA 1MIRA 3ZNHA 3LFYA 3BPMA 1K3BB 3PRPA 1AYVA 1KHQA 2P86A 2BTWB 2AGAA 4P16A 4QBBA 2E02A 3K24A 4YYVA 4P6GA 1AYUA 3I3TA 3OQCA 3OVXA 4YYUA 3O65A 4FJCA 2G8JA 4MSXA 3PRMA 2DCDA 2R9FA 2JTCA 2PNSA 3H8BA 1PPPA 4HWYA 2HWKA 2E01A 2B1MA 3QJ3A 4MI7A 1ITOA 1O0EA 3OF9A 4QRVA 2F1GA 1UKFA 3V6CA 1TU6A 1MEGA 1PE6A 3BPFA 3E1ZB 5EF4A 3LXSA 4WA6A 5CVNB 1TL9A 3U8EA 4OVZA 1BP4A 2FT2A 3OF8A 1U9XA 3BB7A 1ATKA 2P7UA 4P6EA 1PADA 3PDFA 5CHTA 2Z84A 3KWZA 4BS6A 2OP3A 3HD3A 4D8EA 3E9SA 3WXEA 2HXZA 1CS8A 2AIMA 2AS8A 2XU1A 2NQAA 2G6DA 3CBKA 3H7DA 4RF1A 3P5XA 2G7YA 4W5BA 3RVXA 1A6RA 2FTDA 3CBJA 4BOQA 2YJ2A 2XU3A 4M0WA 4W4UA 3RNVA 4BOPA 4QH6A 3IOQA 3N4CA 3MTNA 1NPZA 3H8CA 3N3GA 1TLOA 1XKGA 3C0RA 2UZJA 3HHIA 1AU3A 2R9MA 4ZTBA 4WURA 4GUAA 3TRKA 3TMPA 1PBHA 4MZSA 4BOSA 1HUCB 1GCBA 1EWOA 5EZSA 1STFE 5JH3A 2VHFA 1QDQA 4OW0A 4KLBA 2BTWA 2G8EA 2R9OA 4FIPA 3BOWA 3OVZA 1NB3A 4CZWA 1ICFA 5KO3A 4I04A 2F7DA 2ACTA 3TNXA 8PCHA 1F2CA 2Y6EA 2OZ2A 2DC8A 1KXRA 2YJ8A 2IBIA 3CH2X 1U9QX 3NHEA 4FK5A 1GMYA 1M6DA 1PXVA 2HHNA 4BOZA 3MP2A 5E6JA 3MHSA 1QOLA 3CH3X 1BQIA 1CQDA 2DZYA 4OVZB
chains in the Genus database with same CATH topology
4AXLA 5CVMA 4YVAA 2FYEA 2R6NA 5JA7A 4YYSA 2DC6A 5FPWA 9PAPA 3PNRA 1KFXL 1PCIA 2PBHA 2R9NA 1ME3A 5K16A 2DJFB 4CDCB 4CDFB 3PW3A 1Y08A 4PP1A 1MHWA 2AYNA 2XU5A 3BC3A 3KFQA 1EF7A 2JQFR 1VJVA 1NL6A 2DC9A 4N4ZA 3O0UA 4BPVA 1PPNA 2IPPB 4PP2E 4XR7A 2YJ9A 2BDLA 3PBHA 1X9YA 3QSDA 1BY8A 1PPOA 2FRQA 1EWPA 1CVZA 2VHSA 4CDDB 1SP4B 2E03A 2CB5A 2BSZA 3KWBX 1POPA 3H89A 1ZCMA 3KSEA 3KX1A 1QMYA 2YJBA 2O6XA 3DF0A 2JQGR 3BWKA 2YJCA 4K7CA 4Q8GA 5CVOB 2AYOA 3K8UA 1MDWA 2FQ9A 1EWMA 1U9WA 1CPJA 2WBFX 1AECA 2P0RA 2DZZA 1NQCA 1AIMA 5J94A 3USVA 4NV7A 4GUZA 1U9VA 3F5VA 4Q8HA 1NB5A 5A24A 1Y4HA 1SNKA 4QRXA 4I05A 3P5WA 1NLJA 1DEUA 3ERVA 2DCCA 2AU1A 1PPDA 3V6EA 3C9EA 2B1NA 3IUTA 4RY2A 3B79A 1W4TA 3M99A 1EWLA 3O1GA 2BDZA 2ARYA 1Q6KA 3GCBA 2GHUA 4XUIA 1GLOA 2Y5BA 2FO5A 3QT4A 3IEJA 3N3KA 1CTEA 4BQVA 4YYWA 1AU0A 4ZUXU 2NQDB 3K9MA 3MHHA 4OEMA 2FUDA 1YK7A 4AXMA 3S3QA 4BS5A 2DCAA 2VFBA 1BGOA 1PIPA 1CV8A 2DC7A 2GFOA 3HHAA 7PCKA 2PADA 4PI3A 4MZOA 5EGWA 2XU4A 2FRAA 4BSQA 1W5RA 2NQGA 1E2TA 1S4VA 2CIOA 2AUZA 3IHPA 3IV2A 3MORA 4QRGA 1MS6A 4DMYA 3HWNA 2OULA 3F75A 1YK8A 2DCBA 4OELA 3D6SA 4G54A 1F29A 3S3RA 3IMAA 2PREA 3BCNA 3WXGA 5PADA 3P5UA 4PADA 4CDEB 1KFUL 1CJLA 4X6IA 1MEMA 3AI8A 1CB5A 1YT7A 3RVVA 2DJGB 4YYRA 3RVWA 3P5VA 1JQPA 1QXPA 1F2BA 4N79A 1AU4A 2NQIA 3KW9A 1DF0A 1F2AA 3H6SA 1CSBB 4X6HA 4C5PA 2AVWA 2HH5A 2ATOA 1GECE 4DMXA 1KHPA 1YALA 3D9WA 1ME4A 1YVBA 2AUXA 3LTWA 3I06A 3WXFA 2C0YA 1VSNA 4X6JA 1THEA 1U5IA 2H7JA 5F02A 1W6FA 6PADA 3KKUA 5CHVA 4W5CA 3OISA 1IWDA 2R9CA 1ZIVA 4YV8A 2HD5A 1FH0A 4YYQA 4I07A 1AU2A 4N8WA 3ZUAA 1AYWA 2E00A 1MIRA 3LFYA 3BPMA 1K3BB 1AYVA 1KHQA 2P86A 4QBBA 2E02A 3K24A 4YYVA 4P6GA 1AYUA 3I3TA 3OVXA 4YYUA 4FJCA 2G8JA 4MSXA 2DCDA 2R9FA 2PNSA 3H8BA 4BGFA 4NV8A 1PPPA 4HWYA 2E01A 2B1MA 3QJ3A 1ITOA 1O0EA 3OF9A 4QRVA 2F1GA 1GX3A 4B55A 3V6CA 1TU6A 1MEGA 1PE6A 3BPFA 3E1ZB 5EF4A 3LXSA 4WA6A 5CVNB 1TL9A 3U8EA 1BP4A 2FT2A 3OF8A 1U9XA 1ATKA 2P7UA 4P6EA 1PADA 3PDFA 5CHTA 3KWZA 4BS6A 2OP3A 3HD3A 3WXEA 2HXZA 1CS8A 2AIMA 2AS8A 2XU1A 2NQAA 2G6DA 3CBKA 3H7DA 3P5XA 2G7YA 4W5BA 3RVXA 1A6RA 2FTDA 3CBJA 2YJ2A 2XU3A 4W4UA 4QH6A 3IOQA 3N4CA 2VFCA 3MTNA 1NPZA 3H8CA 3N3GA 1TLOA 1XKGA 3HHIA 1AU3A 2R9MA 1PBHA 4MZSA 1HUCB 1GCBA 1EWOA 1STFE 5JH3A 2VHFA 1QDQA 4KLBA 2G8EA 2R9OA 4FIPA 3BOWA 3OVZA 1NB3A 4CZWA 1ICFA 4I04A 2F7DA 2ACTA 3TNXA 8PCHA 1F2CA 2Y6EA 2OZ2A 2DC8A 1KXRA 2YJ8A 2IBIA 3CH2X 1U9QX 3NHEA 4FK5A 1GMYA 1M6DA 1PXVA 2HHNA 3MHSA 1QOLA 3CH3X 1BQIA 1CQDA 2DZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXL A;  5CVM A;  4YVA A;  2FYE A;  2R6N A;  5JA7 A;  4YYS A;  2DC6 A;  5FPW A;  9PAP A;  3PNR A;  1KFX L;  1PCI A;  2PBH A;  2R9N A;  1ME3 A;  5K16 A;  2DJF B;  4CDC B;  4CDF B;  3PW3 A;  1Y08 A;  4PP1 A;  1MHW A;  2AYN A;  2XU5 A;  3BC3 A;  3KFQ A;  1EF7 A;  2JQF R;  1VJV A;  1NL6 A;  2DC9 A;  4N4Z A;  3O0U A;  4BPV A;  1PPN A;  2IPP B;  4PP2 E;  4XR7 A;  2YJ9 A;  2BDL A;  3PBH A;  1X9Y A;  3QSD A;  1BY8 A;  1PPO A;  2FRQ A;  1EWP A;  1CVZ A;  2VHS A;  4CDD B;  1SP4 B;  2E03 A;  2CB5 A;  3KWB X;  1POP A;  3H89 A;  1ZCM A;  3KSE A;  3KX1 A;  1QMY A;  2YJB A;  2O6X A;  3DF0 A;  2JQG R;  3BWK A;  2YJC A;  4K7C A;  4Q8G A;  5CVO B;  2AYO A;  3K8U A;  1MDW A;  2FQ9 A;  1EWM A;  1U9W A;  1CPJ A;  2WBF X;  1AEC A;  2P0R A;  2DZZ A;  1NQC A;  1AIM A;  5J94 A;  3USV A;  1U9V A;  3F5V A;  4Q8H A;  1NB5 A;  5A24 A;  1Y4H A;  1SNK A;  4QRX A;  4I05 A;  3P5W A;  1NLJ A;  1DEU A;  3ERV A;  2DCC A;  2AU1 A;  1PPD A;  3V6E A;  3C9E A;  2B1N A;  3IUT A;  4RY2 A;  3B79 A;  3M99 A;  1EWL A;  3O1G A;  2BDZ A;  2ARY A;  1Q6K A;  3GCB A;  2GHU A;  4XUI A;  1GLO A;  2Y5B A;  2FO5 A;  3QT4 A;  3IEJ A;  3N3K A;  1CTE A;  4BQV A;  4YYW A;  1AU0 A;  4ZUX U;  2NQD B;  3K9M A;  3MHH A;  4OEM A;  2FUD A;  1YK7 A;  4AXM A;  3S3Q A;  4BS5 A;  2DCA A;  1BGO A;  1PIP A;  1CV8 A;  2DC7 A;  2GFO A;  3HHA A;  7PCK A;  2PAD A;  4PI3 A;  4MZO A;  5EGW A;  2XU4 A;  2FRA A;  4BSQ A;  2NQG A;  1S4V A;  2CIO A;  2AUZ A;  3IHP A;  3IV2 A;  3MOR A;  4QRG A;  1MS6 A;  4DMY A;  3HWN A;  2OUL A;  3F75 A;  1YK8 A;  2DCB A;  4OEL A;  3D6S A;  4G54 A;  1F29 A;  3S3R A;  3IMA A;  2PRE A;  3BCN A;  3WXG A;  5PAD A;  3P5U A;  4PAD A;  4CDE B;  1KFU L;  1CJL A;  4X6I A;  1MEM A;  3AI8 A;  1CB5 A;  1YT7 A;  3RVV A;  2DJG B;  4YYR A;  3RVW A;  3P5V A;  1JQP A;  1QXP A;  1F2B A;  4N79 A;  1AU4 A;  2NQI A;  3KW9 A;  1DF0 A;  1F2A A;  3H6S A;  1CSB B;  4X6H A;  2AVW A;  2HH5 A;  2ATO A;  1GEC E;  4DMX A;  1KHP A;  1YAL A;  1ME4 A;  1YVB A;  2AUX A;  3I06 A;  3WXF A;  2C0Y A;  1VSN A;  4X6J A;  1THE A;  1U5I A;  2H7J A;  5F02 A;  6PAD A;  3KKU A;  5CHV A;  4W5C A;  3OIS A;  1IWD A;  2R9C A;  1ZIV A;  4YV8 A;  2HD5 A;  1FH0 A;  4YYQ A;  4I07 A;  1AU2 A;  4N8W A;  3ZUA A;  1AYW A;  2E00 A;  1MIR A;  3LFY A;  3BPM A;  1K3B B;  1AYV A;  1KHQ A;  2P86 A;  4QBB A;  2E02 A;  3K24 A;  4YYV A;  4P6G A;  1AYU A;  3I3T A;  3OVX A;  4YYU A;  4FJC A;  2G8J A;  4MSX A;  2DCD A;  2R9F A;  2PNS A;  3H8B A;  1PPP A;  4HWY A;  2E01 A;  2B1M A;  3QJ3 A;  1ITO A;  1O0E A;  3OF9 A;  4QRV A;  2F1G A;  3V6C A;  1TU6 A;  1MEG A;  1PE6 A;  3BPF A;  3E1Z B;  5EF4 A;  3LXS A;  4WA6 A;  5CVN B;  1TL9 A;  3U8E A;  1BP4 A;  2FT2 A;  3OF8 A;  1U9X A;  1ATK A;  2P7U A;  4P6E A;  1PAD A;  3PDF A;  5CHT A;  3KWZ A;  4BS6 A;  2OP3 A;  3HD3 A;  3WXE A;  2HXZ A;  1CS8 A;  2AIM A;  2AS8 A;  2XU1 A;  2NQA A;  2G6D A;  3CBK A;  3H7D A;  3P5X A;  2G7Y A;  4W5B A;  3RVX A;  1A6R A;  2FTD A;  3CBJ A;  2YJ2 A;  2XU3 A;  4W4U A;  4QH6 A;  3IOQ A;  3N4C A;  3MTN A;  1NPZ A;  3H8C A;  3N3G A;  1TLO A;  1XKG A;  3HHI A;  1AU3 A;  2R9M A;  1PBH A;  4MZS A;  1HUC B;  1GCB A;  1EWO A;  1STF E;  5JH3 A;  2VHF A;  1QDQ A;  4KLB A;  2G8E A;  2R9O A;  4FIP A;  3BOW A;  3OVZ A;  1NB3 A;  4CZW A;  1ICF A;  4I04 A;  2F7D A;  2ACT A;  3TNX A;  8PCH A;  1F2C A;  2Y6E A;  2OZ2 A;  2DC8 A;  1KXR A;  2YJ8 A;  2IBI A;  3CH2 X;  1U9Q X;  3NHE A;  4FK5 A;  1GMY A;  1M6D A;  1PXV A;  2HHN A;  3MHS A;  1QOL A;  3CH3 X;  1BQI A;  1CQD A;  2DZY A; 
#chains in the Genus database with same CATH topology
 4AXL A;  5CVM A;  4YVA A;  3MTV A;  2FYE A;  2R6N A;  5JA7 A;  4YYS A;  2DC6 A;  5FPW A;  3PHX A;  3PNR A;  9PAP A;  1KFX L;  1PCI A;  1PVJ A;  2PBH A;  4REZ A;  2R9N A;  1ME3 A;  5K16 A;  2DJF B;  4CDC B;  3BY4 A;  3PHW A;  4CDF B;  3PW3 A;  1Y08 A;  4PP1 A;  1MHW A;  2AYN A;  2XU5 A;  3BC3 A;  3KFQ A;  1EF7 A;  2JQF R;  1VJV A;  1NL6 A;  2DC9 A;  4N4Z A;  3O0U A;  4BPV A;  1PPN A;  2IPP B;  4PP2 E;  4XR7 A;  2YJ9 A;  2BDL A;  3PBH A;  1X9Y A;  3QSD A;  1BY8 A;  1PPO A;  2FRQ A;  4IP3 A;  1EWP A;  1CVZ A;  2VHS A;  4CDD B;  1SP4 B;  2E03 A;  2CB5 A;  2FE8 A;  3KWB X;  1POP A;  3H89 A;  1ZCM A;  3KSE A;  3KX1 A;  4PT5 A;  1QMY A;  2YJB A;  2O6X A;  3DF0 A;  2JQG R;  3PSE A;  3BWK A;  2YJC A;  4K7C A;  4Q8G A;  5CVO B;  2AYO A;  3K8U A;  1MDW A;  2FQ9 A;  3PHU A;  1EWM A;  1DKI A;  1U9W A;  1CPJ A;  2WBF X;  1AEC A;  2P0R A;  4R3D A;  2DZZ A;  1NQC A;  1AIM A;  5J94 A;  3USV A;  4A5U A;  1U9V A;  3F5V A;  4Q8H A;  1NB5 A;  5A24 A;  1Y4H A;  1SNK A;  4QRX A;  4I05 A;  3P5W A;  4RF0 A;  1NLJ A;  1DEU A;  3ERV A;  3W30 A;  2DCC A;  2AU1 A;  1PPD A;  3V6E A;  3C9E A;  2B1N A;  2J7Q C;  3IUT A;  4RY2 A;  3B79 A;  4HXD B;  3B21 A;  3M99 A;  1EWL A;  3O1G A;  2BDZ A;  2ARY A;  1Q6K A;  3W31 A;  3GCB A;  2GHU A;  4XUI A;  1GLO A;  2Y5B A;  2FO5 A;  3QT4 A;  3IEJ A;  3N3K A;  1CTE A;  4BQV A;  4YYW A;  1AU0 A;  4ZUX U;  4D8B A;  2NQD B;  3K9M A;  3MHH A;  4OEM A;  2FUD A;  1YK7 A;  4AXM A;  3S3Q A;  4BS5 A;  4IUM A;  2DCA A;  1BGO A;  1PIP A;  1CV8 A;  2DC7 A;  4RKX A;  2GFO A;  3HHA A;  4D8I A;  7PCK A;  2PAD A;  4PI3 A;  4MZO A;  5EGW A;  2XU4 A;  4BOU A;  2FRA A;  4BSQ A;  2DOS A;  2NQG A;  1S4V A;  2CIO A;  3MJ5 A;  2AUZ A;  3IHP A;  3IV2 A;  3BBA A;  3MOR A;  4QRG A;  1MS6 A;  4MM3 B;  4DMY A;  3HWN A;  2OUL A;  3F75 A;  1YK8 A;  2DCB A;  4OEL A;  3D6S A;  4G54 A;  4RNA A;  1F29 A;  3S3R A;  3IMA A;  2PRE A;  3BCN A;  3WXG A;  5PAD A;  3P5U A;  4PAD A;  2J7Q A;  4CDE B;  1KFU L;  1CJL A;  4X6I A;  1MEM A;  3AI8 A;  1CB5 A;  1YT7 A;  3RVV A;  2DJG B;  4YYR A;  3RVW A;  3P5V A;  1JQP A;  1QXP A;  1F2B A;  2BU3 A;  4N79 A;  1AU4 A;  2NQI A;  3KW9 A;  1DF0 A;  1F2A A;  3H6S A;  1CSB B;  4X6H A;  2AVW A;  2HH5 A;  2ATO A;  1YZB A;  1GEC E;  4DMX A;  1KHP A;  1YAL A;  1ME4 A;  1YVB A;  5JZE A;  2AUX A;  3I06 A;  3WXF A;  2C0Y A;  1VSN A;  4X6J A;  5EZQ A;  1THE A;  1U5I A;  2H7J A;  3IFU A;  3PT2 A;  5F02 A;  6PAD A;  3KKU A;  5CHV A;  4W5C A;  3OIS A;  1IWD A;  2R9C A;  1ZIV A;  4YV8 A;  2HD5 A;  1FH0 A;  4XZX A;  4YYQ A;  4I07 A;  4N8W A;  1AU2 A;  3ZUA A;  1AYW A;  2E00 A;  2JRI A;  1MIR A;  3ZNH A;  3LFY A;  3BPM A;  1K3B B;  3PRP A;  1AYV A;  1KHQ A;  2P86 A;  2BTW B;  2AGA A;  4P16 A;  4QBB A;  2E02 A;  3K24 A;  4YYV A;  4P6G A;  1AYU A;  3I3T A;  3OQC A;  3OVX A;  4YYU A;  3O65 A;  4FJC A;  2G8J A;  4MSX A;  3PRM A;  2DCD A;  2R9F A;  2JTC A;  2PNS A;  3H8B A;  1PPP A;  4HWY A;  2HWK A;  2E01 A;  2B1M A;  3QJ3 A;  4MI7 A;  1ITO A;  1O0E A;  3OF9 A;  4QRV A;  2F1G A;  1UKF A;  3V6C A;  1TU6 A;  1MEG A;  1PE6 A;  3BPF A;  3E1Z B;  5EF4 A;  3LXS A;  4WA6 A;  5CVN B;  1TL9 A;  3U8E A;  4OVZ A;  1BP4 A;  2FT2 A;  3OF8 A;  1U9X A;  3BB7 A;  1ATK A;  2P7U A;  4P6E A;  1PAD A;  3PDF A;  5CHT A;  2Z84 A;  3KWZ A;  4BS6 A;  2OP3 A;  3HD3 A;  4D8E A;  3E9S A;  3WXE A;  2HXZ A;  1CS8 A;  2AIM A;  2AS8 A;  2XU1 A;  2NQA A;  2G6D A;  3CBK A;  3H7D A;  4RF1 A;  3P5X A;  2G7Y A;  4W5B A;  3RVX A;  1A6R A;  2FTD A;  3CBJ A;  4BOQ A;  2YJ2 A;  2XU3 A;  4M0W A;  4W4U A;  3RNV A;  4BOP A;  4QH6 A;  3IOQ A;  3N4C A;  3MTN A;  1NPZ A;  3H8C A;  3N3G A;  1TLO A;  1XKG A;  3C0R A;  2UZJ A;  3HHI A;  1AU3 A;  2R9M A;  4ZTB A;  4WUR A;  4GUA A;  3TRK A;  3TMP A;  1PBH A;  4MZS A;  4BOS A;  1HUC B;  1GCB A;  1EWO A;  5EZS A;  1STF E;  5JH3 A;  2VHF A;  1QDQ A;  4OW0 A;  4KLB A;  2BTW A;  2G8E A;  2R9O A;  4FIP A;  3BOW A;  3OVZ A;  1NB3 A;  4CZW A;  1ICF A;  5KO3 A;  4I04 A;  2F7D A;  2ACT A;  3TNX A;  8PCH A;  1F2C A;  2Y6E A;  2OZ2 A;  2DC8 A;  1KXR A;  2YJ8 A;  2IBI A;  3CH2 X;  1U9Q X;  3NHE A;  4FK5 A;  1GMY A;  1M6D A;  1PXV A;  2HHN A;  4BOZ A;  3MP2 A;  5E6J A;  3MHS A;  1QOL A;  3CH3 X;  1BQI A;  1CQD A;  2DZY A;  4OVZ B; 
#chains in the Genus database with same CATH homology
 4AXL A;  5CVM A;  4YVA A;  2FYE A;  2R6N A;  5JA7 A;  4YYS A;  2DC6 A;  5FPW A;  9PAP A;  3PNR A;  1KFX L;  1PCI A;  2PBH A;  2R9N A;  1ME3 A;  5K16 A;  2DJF B;  4CDC B;  4CDF B;  3PW3 A;  1Y08 A;  4PP1 A;  1MHW A;  2AYN A;  2XU5 A;  3BC3 A;  3KFQ A;  1EF7 A;  2JQF R;  1VJV A;  1NL6 A;  2DC9 A;  4N4Z A;  3O0U A;  4BPV A;  1PPN A;  2IPP B;  4PP2 E;  4XR7 A;  2YJ9 A;  2BDL A;  3PBH A;  1X9Y A;  3QSD A;  1BY8 A;  1PPO A;  2FRQ A;  1EWP A;  1CVZ A;  2VHS A;  4CDD B;  1SP4 B;  2E03 A;  2CB5 A;  2BSZ A;  3KWB X;  1POP A;  3H89 A;  1ZCM A;  3KSE A;  3KX1 A;  1QMY A;  2YJB A;  2O6X A;  3DF0 A;  2JQG R;  3BWK A;  2YJC A;  4K7C A;  4Q8G A;  5CVO B;  2AYO A;  3K8U A;  1MDW A;  2FQ9 A;  1EWM A;  1U9W A;  1CPJ A;  2WBF X;  1AEC A;  2P0R A;  2DZZ A;  1NQC A;  1AIM A;  5J94 A;  3USV A;  4NV7 A;  4GUZ A;  1U9V A;  3F5V A;  4Q8H A;  1NB5 A;  5A24 A;  1Y4H A;  1SNK A;  4QRX A;  4I05 A;  3P5W A;  1NLJ A;  1DEU A;  3ERV A;  2DCC A;  2AU1 A;  1PPD A;  3V6E A;  3C9E A;  2B1N A;  3IUT A;  4RY2 A;  3B79 A;  1W4T A;  3M99 A;  1EWL A;  3O1G A;  2BDZ A;  2ARY A;  1Q6K A;  3GCB A;  2GHU A;  4XUI A;  1GLO A;  2Y5B A;  2FO5 A;  3QT4 A;  3IEJ A;  3N3K A;  1CTE A;  4BQV A;  4YYW A;  1AU0 A;  4ZUX U;  2NQD B;  3K9M A;  3MHH A;  4OEM A;  2FUD A;  1YK7 A;  4AXM A;  3S3Q A;  4BS5 A;  2DCA A;  2VFB A;  1BGO A;  1PIP A;  1CV8 A;  2DC7 A;  2GFO A;  3HHA A;  7PCK A;  2PAD A;  4PI3 A;  4MZO A;  5EGW A;  2XU4 A;  2FRA A;  4BSQ A;  1W5R A;  2NQG A;  1E2T A;  1S4V A;  2CIO A;  2AUZ A;  3IHP A;  3IV2 A;  3MOR A;  4QRG A;  1MS6 A;  4DMY A;  3HWN A;  2OUL A;  3F75 A;  1YK8 A;  2DCB A;  4OEL A;  3D6S A;  4G54 A;  1F29 A;  3S3R A;  3IMA A;  2PRE A;  3BCN A;  3WXG A;  5PAD A;  3P5U A;  4PAD A;  4CDE B;  1KFU L;  1CJL A;  4X6I A;  1MEM A;  3AI8 A;  1CB5 A;  1YT7 A;  3RVV A;  2DJG B;  4YYR A;  3RVW A;  3P5V A;  1JQP A;  1QXP A;  1F2B A;  4N79 A;  1AU4 A;  2NQI A;  3KW9 A;  1DF0 A;  1F2A A;  3H6S A;  1CSB B;  4X6H A;  4C5P A;  2AVW A;  2HH5 A;  2ATO A;  1GEC E;  4DMX A;  1KHP A;  1YAL A;  3D9W A;  1ME4 A;  1YVB A;  2AUX A;  3LTW A;  3I06 A;  3WXF A;  2C0Y A;  1VSN A;  4X6J A;  1THE A;  1U5I A;  2H7J A;  5F02 A;  1W6F A;  6PAD A;  3KKU A;  5CHV A;  4W5C A;  3OIS A;  1IWD A;  2R9C A;  1ZIV A;  4YV8 A;  2HD5 A;  1FH0 A;  4YYQ A;  4I07 A;  1AU2 A;  4N8W A;  3ZUA A;  1AYW A;  2E00 A;  1MIR A;  3LFY A;  3BPM A;  1K3B B;  1AYV A;  1KHQ A;  2P86 A;  4QBB A;  2E02 A;  3K24 A;  4YYV A;  4P6G A;  1AYU A;  3I3T A;  3OVX A;  4YYU A;  4FJC A;  2G8J A;  4MSX A;  2DCD A;  2R9F A;  2PNS A;  3H8B A;  4BGF A;  4NV8 A;  1PPP A;  4HWY A;  2E01 A;  2B1M A;  3QJ3 A;  1ITO A;  1O0E A;  3OF9 A;  4QRV A;  2F1G A;  1GX3 A;  4B55 A;  3V6C A;  1TU6 A;  1MEG A;  1PE6 A;  3BPF A;  3E1Z B;  5EF4 A;  3LXS A;  4WA6 A;  5CVN B;  1TL9 A;  3U8E A;  1BP4 A;  2FT2 A;  3OF8 A;  1U9X A;  1ATK A;  2P7U A;  4P6E A;  1PAD A;  3PDF A;  5CHT A;  3KWZ A;  4BS6 A;  2OP3 A;  3HD3 A;  3WXE A;  2HXZ A;  1CS8 A;  2AIM A;  2AS8 A;  2XU1 A;  2NQA A;  2G6D A;  3CBK A;  3H7D A;  3P5X A;  2G7Y A;  4W5B A;  3RVX A;  1A6R A;  2FTD A;  3CBJ A;  2YJ2 A;  2XU3 A;  4W4U A;  4QH6 A;  3IOQ A;  3N4C A;  2VFC A;  3MTN A;  1NPZ A;  3H8C A;  3N3G A;  1TLO A;  1XKG A;  3HHI A;  1AU3 A;  2R9M A;  1PBH A;  4MZS A;  1HUC B;  1GCB A;  1EWO A;  1STF E;  5JH3 A;  2VHF A;  1QDQ A;  4KLB A;  2G8E A;  2R9O A;  4FIP A;  3BOW A;  3OVZ A;  1NB3 A;  4CZW A;  1ICF A;  4I04 A;  2F7D A;  2ACT A;  3TNX A;  8PCH A;  1F2C A;  2Y6E A;  2OZ2 A;  2DC8 A;  1KXR A;  2YJ8 A;  2IBI A;  3CH2 X;  1U9Q X;  3NHE A;  4FK5 A;  1GMY A;  1M6D A;  1PXV A;  2HHN A;  3MHS A;  1QOL A;  3CH3 X;  1BQI A;  1CQD A;  2DZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...