3LFYA

Ctd of tarocystatin in complex with papain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex structure of tarocystatin with papain and characterization of tarocystatin proposed the role of C-terminal extension for inhibitory mechanism of group-2 phytocystatins
rcsb
molecule tags Hydrolase
molecule keywords Papain
total genus 61
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lfyA00
1AU2A 2AVWA 3BCNA 2XU1A 4DMXA 1SNKA 4HWYA 3PW3A 2P7UA 3N3KA 4YYRA 4N8WA 3QJ3A 2PBHA 3PNRA 5CVNB 3CH2X 3P5UA 2AYNA 3K9MA 1MEGA 1STFE 1QDQA 2DCDA 3GCBA 2XU4A 2DZYA 1YT7A 2R9FA 1QXPA 1POPA 1EWLA 4YYQA 4K7CA 4I07A 1EF7A 1FH0A 3N4CA 3BPMA 3IOQA 3H8BA 3KKUA 3F5VA 3E1ZB 5A24A 2AS8A 1QMYA 2YJBA 2AYOA 4Q8HA 3MORA 3TNXA 3CBKA 1S4VA 4I05A 3S3QA 3P5VA 1THEA 2HXZA 3BPFA 4CDDB 3DF0A 1ME3A 1ME4A 3MTNA 2JQFR 1BQIA 3V6CA 2BDZA 2BDLA 2DC7A 2XU3A 2P0RA 2OZ2A 1QOLA 4QRGA 1TU6A 1YVBA 4ZUXU 1PBHA 3KFQA 3ERVA 4CDFB 5K16A 4KLBA 1PE6A 4QH6A 4DMYA 1MHWA 3IHPA 1GECE 5J94A 4WA6A 1PPNA 1MS6A 1EWPA 1TL9A 4BQVA 2HD5A 4X6JA 4QRXA 3K24A 1Y4HA 2JQGR 3N3GA 2AU1A 8PCHA 1Q6KA 4YYVA 2NQAA 5F02A 4QRVA 1NL6A 2C0YA 4BS5A 3RVVA 4FIPA 2DC8A 2DJGB 3RVXA 3WXFA 3HD3A 5JA7A 1GCBA 2AUXA 3H89A 3RVWA 2R9OA 2E00A 1YALA 3OF9A 3F75A 1U5IA 3PDFA 4MZOA 2WBFX 2R9MA 3P5XA 5CHTA 1A6RA 2DCBA 1AYWA 5CVOB 4YV8A 1NQCA 3H6SA 1PIPA 1HUCB 4XUIA 4PP1A 1KHPA 2DCCA 2FYEA 4N79A 3BC3A 1TLOA 3KW9A 3BOWA 1YK8A 2CIOA 2DJFB 2ATOA 1GLOA 1X9YA 3PBHA 1EWOA 2NQGA 6PADA 2VHFA 1CV8A 4YYWA 1U9XA 9PAPA 2PADA 3B79A 1CVZA 1CS8A 3MHSA 4Q8GA 1ZIVA 1AU4A 2G6DA 4BS6A 1JQPA 3H7DA 1AU0A 4CDEB 3IUTA 4AXLA 1F2CA 1CJLA 1F2AA 3IEJA 1DEUA 3K8UA 3QSDA 3CH3X 3HHAA 1VSNA 1CSBB 2HH5A 2GFOA 3KSEA 1BGOA 5FPWA 2AUZA 2AIMA 2B1NA 2FUDA 2DC9A 1U9VA 2FTDA 1K3BB 3O1GA 1KFXL 4PP2E 2OP3A 4BPVA 1AIMA 2PNSA 4P6GA 1M6DA 3QT4A 1MDWA 2YJCA 3HHIA 1CB5A 1U9QX 2FRAA 3WXEA 3S3RA 3CBJA 1NB5A 4X6IA 1NLJA 2G8EA 3OF8A 2NQDB 3AI8A 4N4ZA 4RY2A 4FJCA 2OULA 2F1GA 3USVA 5JH3A 3IMAA 4YVAA 2E01A 2IBIA 5CHVA 2DCAA 3KWZA 4QBBA 1AYVA 1KXRA 2Y6EA 3OVXA 1AECA 3KX1A 4MZSA 3I3TA 4G54A 1F29A 3U8EA 3HWNA 2R6NA 4X6HA 1PPPA 3P5WA 4W4UA 1KHQA 4OELA 2G8JA 1PPDA 1XKGA 2YJ8A 2FO5A 1PCIA 2E03A 2GHUA 3BWKA 3IV2A 4CDCB 2F7DA 2G7YA 2FT2A 1ITOA 2FQ9A 3C9EA 1DF0A 2PREA 1CPJA 2Y5BA 3OISA 2O6XA 2H7JA 1ICFA 4PI3A 1KFUL 1IWDA 1EWMA 1SP4B 4BSQA 1AYUA 3LXSA 5PADA 2YJ2A 2IPPB 2CB5A 3D6SA 2B1MA 2P86A 2YJ9A 4YYSA 1ZCMA 4P6EA 2XU5A 4PADA 3WXGA 1YK7A 2ACTA 4I04A 2R9NA 3ZUAA 1PXVA 4AXMA 7PCKA 1CQDA 3NHEA 2VHSA 4FK5A 1BP4A 4OEMA 3LFYA 2DC6A 4MSXA 2E02A 1NPZA 1PPOA 2DZZA 2HHNA 4W5CA 1VJVA 4YYUA 3M99A 5EGWA 1AU3A 1U9WA 2NQIA 3O0UA 1O0EA 3I06A 3MHHA 2R9CA 1BY8A 3OVZA 1PADA 4W5BA 3V6EA 3KWBX 1GMYA 1ATKA 2FRQA 4CZWA 1F2BA 1MIRA 4XR7A 2ARYA 1NB3A 1CTEA 1MEMA 1Y08A 5EF4A 3H8CA 5CVMA
chains in the Genus database with same CATH superfamily
1AU2A 3B21A 2AVWA 3PT2A 3BCNA 2XU1A 4DMXA 1SNKA 1UKFA 4HWYA 4RF0A 3PW3A 2P7UA 3N3KA 4IUMA 4YYRA 4N8WA 3QJ3A 2PBHA 3PNRA 5CVNB 3C0RA 3CH2X 3P5UA 2AYNA 3K9MA 1MEGA 1STFE 1QDQA 2DCDA 3GCBA 2XU4A 2DZYA 1YT7A 2R9FA 5EZQA 1QXPA 1POPA 1EWLA 4YYQA 4K7CA 2Z84A 4I07A 1EF7A 1FH0A 3N4CA 3BPMA 3IOQA 3H8BA 3KKUA 4OVZA 3F5VA 3E1ZB 5A24A 2AS8A 1QMYA 2YJBA 2AYOA 4Q8HA 3MORA 3TNXA 3E9SA 3CBKA 1S4VA 4RF1A 4I05A 3S3QA 3P5VA 1THEA 2HXZA 4D8BA 3BPFA 4CDDB 3DF0A 1ME3A 1ME4A 3MTNA 2JQFR 1BQIA 3V6CA 2BDZA 2BDLA 2DC7A 2XU3A 2P0RA 2DOSA 4ZTBA 2OZ2A 1QOLA 3MJ5A 4QRGA 1TU6A 1YVBA 4ZUXU 1PBHA 3KFQA 3ERVA 4CDFB 5K16A 4KLBA 1PE6A 4QH6A 4DMYA 1MHWA 3IHPA 1GECE 5J94A 4WA6A 1PPNA 1MS6A 1EWPA 1TL9A 4BQVA 4MM3B 2HD5A 4X6JA 1YZBA 4QRXA 3K24A 1Y4HA 2JQGR 3N3GA 2AU1A 8PCHA 1Q6KA 2JRIA 4YYVA 2NQAA 5F02A 4QRVA 3RNVA 1NL6A 2C0YA 4BS5A 3RVVA 4FIPA 2DC8A 2DJGB 3RVXA 3WXFA 3HD3A 5JA7A 1GCBA 2AUXA 3H89A 3RVWA 4WURA 2R9OA 2E00A 1YALA 3OF9A 5E6JA 3F75A 1U5IA 3PDFA 4MZOA 2WBFX 2R9MA 3P5XA 5CHTA 1A6RA 2DCBA 1AYWA 5CVOB 4YV8A 1NQCA 3H6SA 4R3DA 1PIPA 1HUCB 4XUIA 4PP1A 5EZSA 1KHPA 2DCCA 2FYEA 4N79A 3BC3A 1TLOA 3PHXA 3KW9A 3BOWA 1YK8A 2CIOA 2DJFB 2ATOA 1GLOA 1X9YA 3PBHA 4D8IA 1EWOA 2NQGA 6PADA 2VHFA 4XZXA 1CV8A 4YYWA 1U9XA 9PAPA 2PADA 3B79A 3TRKA 1CVZA 1CS8A 3MHSA 4Q8GA 3PRMA 1ZIVA 1AU4A 2G6DA 4BS6A 3BBAA 4MI7A 1JQPA 3H7DA 1AU0A 4CDEB 3IUTA 4AXLA 1F2CA 1CJLA 1F2AA 3IEJA 1DEUA 3K8UA 3QSDA 3CH3X 3HHAA 1VSNA 1CSBB 2HH5A 2GFOA 3KSEA 1BGOA 5FPWA 2AUZA 2AIMA 2B1NA 4OW0A 4P16A 2FUDA 2DC9A 3PRPA 1U9VA 2JTCA 2FTDA 1K3BB 3O1GA 1KFXL 4PP2E 3PHUA 2OP3A 4BPVA 1AIMA 2PNSA 4P6GA 1M6DA 3QT4A 1MDWA 2YJCA 3HHIA 1CB5A 1U9QX 2FRAA 3WXEA 3S3RA 3CBJA 5KO3A 1NB5A 4X6IA 1NLJA 2G8EA 3OF8A 2NQDB 3AI8A 4N4ZA 4RY2A 3W30A 4FJCA 2OULA 2F1GA 3USVA 5JH3A 3IMAA 4YVAA 2E01A 2IBIA 5CHVA 2DCAA 3KWZA 3PHWA 2BTWB 4QBBA 3OQCA 1AYVA 1KXRA 2Y6EA 3OVXA 4GUAA 1AECA 3KX1A 4RNAA 4MZSA 3I3TA 4G54A 4REZA 1F29A 3U8EA 3HWNA 2R6NA 4X6HA 3ZNHA 4OVZB 1PPPA 2BU3A 3P5WA 4W4UA 2HWKA 1KHQA 4OELA 4HXDB 2G8JA 1PPDA 1XKGA 2YJ8A 2FO5A 1PCIA 2E03A 2UZJA 3MP2A 2GHUA 3BWKA 3IV2A 4CDCB 1DKIA 3BB7A 2F7DA 4BOSA 2G7YA 2FE8A 2FT2A 1ITOA 2FQ9A 3C9EA 1DF0A 4IP3A 2PREA 1CPJA 2Y5BA 4M0WA 3OISA 2O6XA 2H7JA 3O65A 3BY4A 1ICFA 4RKXA 4BOPA 4BOZA 3IFUA 4PI3A 1KFUL 4A5UA 1IWDA 1EWMA 1SP4B 4BSQA 1AYUA 3LXSA 5PADA 2YJ2A 2IPPB 2CB5A 3D6SA 2B1MA 2P86A 2YJ9A 4YYSA 1ZCMA 4P6EA 2XU5A 4PADA 3WXGA 1YK7A 2ACTA 4I04A 3PSEA 2R9NA 3ZUAA 1PXVA 4AXMA 7PCKA 1PVJA 1CQDA 3NHEA 2VHSA 4FK5A 1BP4A 4OEMA 3LFYA 2DC6A 4MSXA 2E02A 1NPZA 4BOUA 1PPOA 2DZZA 2HHNA 4W5CA 1VJVA 3MTVA 4YYUA 3W31A 3M99A 2AGAA 5EGWA 1AU3A 1U9WA 2NQIA 2J7QC 3O0UA 1O0EA 3I06A 3MHHA 2R9CA 2J7QA 1BY8A 3OVZA 4D8EA 3TMPA 1PADA 4W5BA 5JZEA 3V6EA 3KWBX 1GMYA 1ATKA 4PT5A 4BOQA 2FRQA 4CZWA 1F2BA 2BTWA 1MIRA 4XR7A 2ARYA 1NB3A 1CTEA 1MEMA 1Y08A 5EF4A 3H8CA 5CVMA
chains in the Genus database with same CATH topology
1AU2A 1W4TA 2AVWA 3BCNA 2XU1A 4DMXA 1SNKA 4HWYA 3PW3A 2P7UA 3N3KA 4YYRA 4N8WA 3QJ3A 2PBHA 3PNRA 5CVNB 3CH2X 3LTWA 3P5UA 2AYNA 3K9MA 1MEGA 1STFE 1QDQA 2DCDA 3GCBA 2XU4A 2DZYA 1YT7A 2R9FA 1QXPA 1POPA 1EWLA 4YYQA 4K7CA 4I07A 1EF7A 1FH0A 3N4CA 3BPMA 4GUZA 3IOQA 3H8BA 3KKUA 3F5VA 3E1ZB 5A24A 2AS8A 1QMYA 4B55A 2YJBA 2AYOA 4Q8HA 3MORA 3TNXA 3CBKA 1S4VA 4I05A 3S3QA 3P5VA 1THEA 2HXZA 3BPFA 4CDDB 3DF0A 1ME3A 1ME4A 3MTNA 2JQFR 1BQIA 3V6CA 2BDZA 2BDLA 2DC7A 2XU3A 2P0RA 2OZ2A 1QOLA 4QRGA 1TU6A 1YVBA 4ZUXU 1PBHA 3KFQA 3ERVA 4CDFB 5K16A 4KLBA 1PE6A 4QH6A 4DMYA 1MHWA 3IHPA 1GECE 5J94A 4WA6A 1PPNA 1MS6A 1EWPA 1TL9A 4BQVA 2HD5A 4X6JA 4QRXA 3K24A 1Y4HA 2JQGR 3N3GA 2AU1A 8PCHA 1Q6KA 4YYVA 2NQAA 5F02A 1W6FA 4QRVA 1NL6A 2C0YA 4BS5A 3RVVA 4FIPA 2DC8A 2DJGB 3RVXA 3WXFA 3HD3A 5JA7A 1GCBA 2AUXA 3H89A 3RVWA 2R9OA 2E00A 1YALA 3OF9A 3F75A 1U5IA 3PDFA 4MZOA 2WBFX 2R9MA 3P5XA 5CHTA 1A6RA 2DCBA 1AYWA 5CVOB 4YV8A 1NQCA 3H6SA 1PIPA 1HUCB 4XUIA 4PP1A 4NV8A 1KHPA 2DCCA 2FYEA 4N79A 3BC3A 1TLOA 3KW9A 3BOWA 1YK8A 2CIOA 2DJFB 2ATOA 1GLOA 1X9YA 3PBHA 1EWOA 2NQGA 6PADA 2VHFA 1CV8A 4YYWA 1U9XA 9PAPA 2PADA 4C5PA 3B79A 1CVZA 1CS8A 3MHSA 4Q8GA 1ZIVA 1AU4A 2G6DA 4BS6A 1JQPA 3H7DA 4BGFA 1AU0A 4CDEB 3IUTA 4AXLA 1F2CA 1CJLA 1F2AA 3IEJA 1DEUA 3K8UA 3QSDA 3CH3X 3HHAA 1VSNA 1CSBB 2HH5A 2GFOA 3KSEA 1BGOA 5FPWA 3D9WA 2AUZA 2AIMA 2B1NA 2FUDA 2DC9A 1U9VA 2FTDA 1K3BB 3O1GA 1KFXL 4PP2E 2OP3A 4BPVA 1AIMA 2PNSA 4P6GA 1M6DA 3QT4A 1MDWA 2YJCA 3HHIA 1CB5A 1U9QX 2FRAA 3WXEA 3S3RA 3CBJA 1NB5A 4X6IA 1NLJA 2G8EA 3OF8A 2NQDB 3AI8A 4N4ZA 4RY2A 4FJCA 2OULA 2F1GA 3USVA 5JH3A 3IMAA 4YVAA 2E01A 2IBIA 5CHVA 2DCAA 3KWZA 4QBBA 1AYVA 1KXRA 2Y6EA 3OVXA 1AECA 3KX1A 1E2TA 4MZSA 3I3TA 4G54A 1F29A 3U8EA 3HWNA 2R6NA 4X6HA 1PPPA 3P5WA 4W4UA 1KHQA 4OELA 2G8JA 1PPDA 1XKGA 2YJ8A 2VFBA 2FO5A 1PCIA 2E03A 2GHUA 3BWKA 3IV2A 4CDCB 2F7DA 2G7YA 2FT2A 1ITOA 2FQ9A 3C9EA 1DF0A 2PREA 1CPJA 2Y5BA 3OISA 2O6XA 2H7JA 1ICFA 4PI3A 1KFUL 1IWDA 1EWMA 1SP4B 4BSQA 1AYUA 3LXSA 5PADA 2YJ2A 2IPPB 2CB5A 3D6SA 2B1MA 1GX3A 2P86A 2YJ9A 4YYSA 1ZCMA 4P6EA 2XU5A 4PADA 3WXGA 1YK7A 2ACTA 4I04A 2R9NA 3ZUAA 1PXVA 4AXMA 7PCKA 1CQDA 3NHEA 2VHSA 4FK5A 1BP4A 4NV7A 4OEMA 3LFYA 2DC6A 4MSXA 2E02A 1NPZA 2VFCA 1PPOA 2DZZA 2HHNA 4W5CA 1VJVA 4YYUA 3M99A 5EGWA 1AU3A 1U9WA 2NQIA 3O0UA 1O0EA 3I06A 3MHHA 2R9CA 1BY8A 3OVZA 2BSZA 1PADA 4W5BA 3V6EA 3KWBX 1GMYA 1ATKA 2FRQA 4CZWA 1F2BA 1MIRA 4XR7A 2ARYA 1NB3A 1CTEA 1MEMA 1Y08A 5EF4A 3H8CA 5CVMA 1W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AU2 A;  2AVW A;  3BCN A;  2XU1 A;  4DMX A;  1SNK A;  4HWY A;  3PW3 A;  2P7U A;  3N3K A;  4YYR A;  4N8W A;  3QJ3 A;  2PBH A;  3PNR A;  5CVN B;  3CH2 X;  3P5U A;  2AYN A;  3K9M A;  1MEG A;  1STF E;  1QDQ A;  2DCD A;  3GCB A;  2XU4 A;  2DZY A;  1YT7 A;  2R9F A;  1QXP A;  1POP A;  1EWL A;  4YYQ A;  4K7C A;  4I07 A;  1EF7 A;  1FH0 A;  3N4C A;  3BPM A;  3IOQ A;  3H8B A;  3KKU A;  3F5V A;  3E1Z B;  5A24 A;  2AS8 A;  1QMY A;  2YJB A;  2AYO A;  4Q8H A;  3MOR A;  3TNX A;  3CBK A;  1S4V A;  4I05 A;  3S3Q A;  3P5V A;  1THE A;  2HXZ A;  3BPF A;  4CDD B;  3DF0 A;  1ME3 A;  1ME4 A;  3MTN A;  2JQF R;  1BQI A;  3V6C A;  2BDZ A;  2BDL A;  2DC7 A;  2XU3 A;  2P0R A;  2OZ2 A;  1QOL A;  4QRG A;  1TU6 A;  1YVB A;  4ZUX U;  1PBH A;  3KFQ A;  3ERV A;  4CDF B;  5K16 A;  4KLB A;  1PE6 A;  4QH6 A;  4DMY A;  1MHW A;  3IHP A;  1GEC E;  5J94 A;  4WA6 A;  1PPN A;  1MS6 A;  1EWP A;  1TL9 A;  4BQV A;  2HD5 A;  4X6J A;  4QRX A;  3K24 A;  1Y4H A;  2JQG R;  3N3G A;  2AU1 A;  8PCH A;  1Q6K A;  4YYV A;  2NQA A;  5F02 A;  4QRV A;  1NL6 A;  2C0Y A;  4BS5 A;  3RVV A;  4FIP A;  2DC8 A;  2DJG B;  3RVX A;  3WXF A;  3HD3 A;  5JA7 A;  1GCB A;  2AUX A;  3H89 A;  3RVW A;  2R9O A;  2E00 A;  1YAL A;  3OF9 A;  3F75 A;  1U5I A;  3PDF A;  4MZO A;  2WBF X;  2R9M A;  3P5X A;  5CHT A;  1A6R A;  2DCB A;  1AYW A;  5CVO B;  4YV8 A;  1NQC A;  3H6S A;  1PIP A;  1HUC B;  4XUI A;  4PP1 A;  1KHP A;  2DCC A;  2FYE A;  4N79 A;  3BC3 A;  1TLO A;  3KW9 A;  3BOW A;  1YK8 A;  2CIO A;  2DJF B;  2ATO A;  1GLO A;  1X9Y A;  3PBH A;  1EWO A;  2NQG A;  6PAD A;  2VHF A;  1CV8 A;  4YYW A;  1U9X A;  9PAP A;  2PAD A;  3B79 A;  1CVZ A;  1CS8 A;  3MHS A;  4Q8G A;  1ZIV A;  1AU4 A;  2G6D A;  4BS6 A;  1JQP A;  3H7D A;  1AU0 A;  4CDE B;  3IUT A;  4AXL A;  1F2C A;  1CJL A;  1F2A A;  3IEJ A;  1DEU A;  3K8U A;  3QSD A;  3CH3 X;  3HHA A;  1VSN A;  1CSB B;  2HH5 A;  2GFO A;  3KSE A;  1BGO A;  5FPW A;  2AUZ A;  2AIM A;  2B1N A;  2FUD A;  2DC9 A;  1U9V A;  2FTD A;  1K3B B;  3O1G A;  1KFX L;  4PP2 E;  2OP3 A;  4BPV A;  1AIM A;  2PNS A;  4P6G A;  1M6D A;  3QT4 A;  1MDW A;  2YJC A;  3HHI A;  1CB5 A;  1U9Q X;  2FRA A;  3WXE A;  3S3R A;  3CBJ A;  1NB5 A;  4X6I A;  1NLJ A;  2G8E A;  3OF8 A;  2NQD B;  3AI8 A;  4N4Z A;  4RY2 A;  4FJC A;  2OUL A;  2F1G A;  3USV A;  5JH3 A;  3IMA A;  4YVA A;  2E01 A;  2IBI A;  5CHV A;  2DCA A;  3KWZ A;  4QBB A;  1AYV A;  1KXR A;  2Y6E A;  3OVX A;  1AEC A;  3KX1 A;  4MZS A;  3I3T A;  4G54 A;  1F29 A;  3U8E A;  3HWN A;  2R6N A;  4X6H A;  1PPP A;  3P5W A;  4W4U A;  1KHQ A;  4OEL A;  2G8J A;  1PPD A;  1XKG A;  2YJ8 A;  2FO5 A;  1PCI A;  2E03 A;  2GHU A;  3BWK A;  3IV2 A;  4CDC B;  2F7D A;  2G7Y A;  2FT2 A;  1ITO A;  2FQ9 A;  3C9E A;  1DF0 A;  2PRE A;  1CPJ A;  2Y5B A;  3OIS A;  2O6X A;  2H7J A;  1ICF A;  4PI3 A;  1KFU L;  1IWD A;  1EWM A;  1SP4 B;  4BSQ A;  1AYU A;  3LXS A;  5PAD A;  2YJ2 A;  2IPP B;  2CB5 A;  3D6S A;  2B1M A;  2P86 A;  2YJ9 A;  4YYS A;  1ZCM A;  4P6E A;  2XU5 A;  4PAD A;  3WXG A;  1YK7 A;  2ACT A;  4I04 A;  2R9N A;  3ZUA A;  1PXV A;  4AXM A;  7PCK A;  1CQD A;  3NHE A;  2VHS A;  4FK5 A;  1BP4 A;  4OEM A;  3LFY A;  2DC6 A;  4MSX A;  2E02 A;  1NPZ A;  1PPO A;  2DZZ A;  2HHN A;  4W5C A;  1VJV A;  4YYU A;  3M99 A;  5EGW A;  1AU3 A;  1U9W A;  2NQI A;  3O0U A;  1O0E A;  3I06 A;  3MHH A;  2R9C A;  1BY8 A;  3OVZ A;  1PAD A;  4W5B A;  3V6E A;  3KWB X;  1GMY A;  1ATK A;  2FRQ A;  4CZW A;  1F2B A;  1MIR A;  4XR7 A;  2ARY A;  1NB3 A;  1CTE A;  1MEM A;  1Y08 A;  5EF4 A;  3H8C A;  5CVM A; 
#chains in the Genus database with same CATH topology
 1AU2 A;  3B21 A;  2AVW A;  3PT2 A;  3BCN A;  2XU1 A;  4DMX A;  1SNK A;  1UKF A;  4HWY A;  4RF0 A;  3PW3 A;  2P7U A;  3N3K A;  4IUM A;  4YYR A;  4N8W A;  3QJ3 A;  2PBH A;  3PNR A;  5CVN B;  3C0R A;  3CH2 X;  3P5U A;  2AYN A;  3K9M A;  1MEG A;  1STF E;  1QDQ A;  2DCD A;  3GCB A;  2XU4 A;  2DZY A;  1YT7 A;  2R9F A;  5EZQ A;  1QXP A;  1POP A;  1EWL A;  4YYQ A;  4K7C A;  2Z84 A;  4I07 A;  1EF7 A;  1FH0 A;  3N4C A;  3BPM A;  3IOQ A;  3H8B A;  3KKU A;  4OVZ A;  3F5V A;  3E1Z B;  5A24 A;  2AS8 A;  1QMY A;  2YJB A;  2AYO A;  4Q8H A;  3MOR A;  3TNX A;  3E9S A;  3CBK A;  1S4V A;  4RF1 A;  4I05 A;  3S3Q A;  3P5V A;  1THE A;  2HXZ A;  4D8B A;  3BPF A;  4CDD B;  3DF0 A;  1ME3 A;  1ME4 A;  3MTN A;  2JQF R;  1BQI A;  3V6C A;  2BDZ A;  2BDL A;  2DC7 A;  2XU3 A;  2P0R A;  2DOS A;  4ZTB A;  2OZ2 A;  1QOL A;  3MJ5 A;  4QRG A;  1TU6 A;  1YVB A;  4ZUX U;  1PBH A;  3KFQ A;  3ERV A;  4CDF B;  5K16 A;  4KLB A;  1PE6 A;  4QH6 A;  4DMY A;  1MHW A;  3IHP A;  1GEC E;  5J94 A;  4WA6 A;  1PPN A;  1MS6 A;  1EWP A;  1TL9 A;  4BQV A;  4MM3 B;  2HD5 A;  4X6J A;  1YZB A;  4QRX A;  3K24 A;  1Y4H A;  2JQG R;  3N3G A;  2AU1 A;  8PCH A;  1Q6K A;  2JRI A;  4YYV A;  2NQA A;  5F02 A;  4QRV A;  3RNV A;  1NL6 A;  2C0Y A;  4BS5 A;  3RVV A;  4FIP A;  2DC8 A;  2DJG B;  3RVX A;  3WXF A;  3HD3 A;  5JA7 A;  1GCB A;  2AUX A;  3H89 A;  3RVW A;  4WUR A;  2R9O A;  2E00 A;  1YAL A;  3OF9 A;  5E6J A;  3F75 A;  1U5I A;  3PDF A;  4MZO A;  2WBF X;  2R9M A;  3P5X A;  5CHT A;  1A6R A;  2DCB A;  1AYW A;  5CVO B;  4YV8 A;  1NQC A;  3H6S A;  4R3D A;  1PIP A;  1HUC B;  4XUI A;  4PP1 A;  5EZS A;  1KHP A;  2DCC A;  2FYE A;  4N79 A;  3BC3 A;  1TLO A;  3PHX A;  3KW9 A;  3BOW A;  1YK8 A;  2CIO A;  2DJF B;  2ATO A;  1GLO A;  1X9Y A;  3PBH A;  4D8I A;  1EWO A;  2NQG A;  6PAD A;  2VHF A;  4XZX A;  1CV8 A;  4YYW A;  1U9X A;  9PAP A;  2PAD A;  3B79 A;  3TRK A;  1CVZ A;  1CS8 A;  3MHS A;  4Q8G A;  3PRM A;  1ZIV A;  1AU4 A;  2G6D A;  4BS6 A;  3BBA A;  4MI7 A;  1JQP A;  3H7D A;  1AU0 A;  4CDE B;  3IUT A;  4AXL A;  1F2C A;  1CJL A;  1F2A A;  3IEJ A;  1DEU A;  3K8U A;  3QSD A;  3CH3 X;  3HHA A;  1VSN A;  1CSB B;  2HH5 A;  2GFO A;  3KSE A;  1BGO A;  5FPW A;  2AUZ A;  2AIM A;  2B1N A;  4OW0 A;  4P16 A;  2FUD A;  2DC9 A;  3PRP A;  1U9V A;  2JTC A;  2FTD A;  1K3B B;  3O1G A;  1KFX L;  4PP2 E;  3PHU A;  2OP3 A;  4BPV A;  1AIM A;  2PNS A;  4P6G A;  1M6D A;  3QT4 A;  1MDW A;  2YJC A;  3HHI A;  1CB5 A;  1U9Q X;  2FRA A;  3WXE A;  3S3R A;  3CBJ A;  5KO3 A;  1NB5 A;  4X6I A;  1NLJ A;  2G8E A;  3OF8 A;  2NQD B;  3AI8 A;  4N4Z A;  4RY2 A;  3W30 A;  4FJC A;  2OUL A;  2F1G A;  3USV A;  5JH3 A;  3IMA A;  4YVA A;  2E01 A;  2IBI A;  5CHV A;  2DCA A;  3KWZ A;  3PHW A;  2BTW B;  4QBB A;  3OQC A;  1AYV A;  1KXR A;  2Y6E A;  3OVX A;  4GUA A;  1AEC A;  3KX1 A;  4RNA A;  4MZS A;  3I3T A;  4G54 A;  4REZ A;  1F29 A;  3U8E A;  3HWN A;  2R6N A;  4X6H A;  3ZNH A;  4OVZ B;  1PPP A;  2BU3 A;  3P5W A;  4W4U A;  2HWK A;  1KHQ A;  4OEL A;  4HXD B;  2G8J A;  1PPD A;  1XKG A;  2YJ8 A;  2FO5 A;  1PCI A;  2E03 A;  2UZJ A;  3MP2 A;  2GHU A;  3BWK A;  3IV2 A;  4CDC B;  1DKI A;  3BB7 A;  2F7D A;  4BOS A;  2G7Y A;  2FE8 A;  2FT2 A;  1ITO A;  2FQ9 A;  3C9E A;  1DF0 A;  4IP3 A;  2PRE A;  1CPJ A;  2Y5B A;  4M0W A;  3OIS A;  2O6X A;  2H7J A;  3O65 A;  3BY4 A;  1ICF A;  4RKX A;  4BOP A;  4BOZ A;  3IFU A;  4PI3 A;  1KFU L;  4A5U A;  1IWD A;  1EWM A;  1SP4 B;  4BSQ A;  1AYU A;  3LXS A;  5PAD A;  2YJ2 A;  2IPP B;  2CB5 A;  3D6S A;  2B1M A;  2P86 A;  2YJ9 A;  4YYS A;  1ZCM A;  4P6E A;  2XU5 A;  4PAD A;  3WXG A;  1YK7 A;  2ACT A;  4I04 A;  3PSE A;  2R9N A;  3ZUA A;  1PXV A;  4AXM A;  7PCK A;  1PVJ A;  1CQD A;  3NHE A;  2VHS A;  4FK5 A;  1BP4 A;  4OEM A;  3LFY A;  2DC6 A;  4MSX A;  2E02 A;  1NPZ A;  4BOU A;  1PPO A;  2DZZ A;  2HHN A;  4W5C A;  1VJV A;  3MTV A;  4YYU A;  3W31 A;  3M99 A;  2AGA A;  5EGW A;  1AU3 A;  1U9W A;  2NQI A;  2J7Q C;  3O0U A;  1O0E A;  3I06 A;  3MHH A;  2R9C A;  2J7Q A;  1BY8 A;  3OVZ A;  4D8E A;  3TMP A;  1PAD A;  4W5B A;  5JZE A;  3V6E A;  3KWB X;  1GMY A;  1ATK A;  4PT5 A;  4BOQ A;  2FRQ A;  4CZW A;  1F2B A;  2BTW A;  1MIR A;  4XR7 A;  2ARY A;  1NB3 A;  1CTE A;  1MEM A;  1Y08 A;  5EF4 A;  3H8C A;  5CVM A; 
#chains in the Genus database with same CATH homology
 1AU2 A;  1W4T A;  2AVW A;  3BCN A;  2XU1 A;  4DMX A;  1SNK A;  4HWY A;  3PW3 A;  2P7U A;  3N3K A;  4YYR A;  4N8W A;  3QJ3 A;  2PBH A;  3PNR A;  5CVN B;  3CH2 X;  3LTW A;  3P5U A;  2AYN A;  3K9M A;  1MEG A;  1STF E;  1QDQ A;  2DCD A;  3GCB A;  2XU4 A;  2DZY A;  1YT7 A;  2R9F A;  1QXP A;  1POP A;  1EWL A;  4YYQ A;  4K7C A;  4I07 A;  1EF7 A;  1FH0 A;  3N4C A;  3BPM A;  4GUZ A;  3IOQ A;  3H8B A;  3KKU A;  3F5V A;  3E1Z B;  5A24 A;  2AS8 A;  1QMY A;  4B55 A;  2YJB A;  2AYO A;  4Q8H A;  3MOR A;  3TNX A;  3CBK A;  1S4V A;  4I05 A;  3S3Q A;  3P5V A;  1THE A;  2HXZ A;  3BPF A;  4CDD B;  3DF0 A;  1ME3 A;  1ME4 A;  3MTN A;  2JQF R;  1BQI A;  3V6C A;  2BDZ A;  2BDL A;  2DC7 A;  2XU3 A;  2P0R A;  2OZ2 A;  1QOL A;  4QRG A;  1TU6 A;  1YVB A;  4ZUX U;  1PBH A;  3KFQ A;  3ERV A;  4CDF B;  5K16 A;  4KLB A;  1PE6 A;  4QH6 A;  4DMY A;  1MHW A;  3IHP A;  1GEC E;  5J94 A;  4WA6 A;  1PPN A;  1MS6 A;  1EWP A;  1TL9 A;  4BQV A;  2HD5 A;  4X6J A;  4QRX A;  3K24 A;  1Y4H A;  2JQG R;  3N3G A;  2AU1 A;  8PCH A;  1Q6K A;  4YYV A;  2NQA A;  5F02 A;  1W6F A;  4QRV A;  1NL6 A;  2C0Y A;  4BS5 A;  3RVV A;  4FIP A;  2DC8 A;  2DJG B;  3RVX A;  3WXF A;  3HD3 A;  5JA7 A;  1GCB A;  2AUX A;  3H89 A;  3RVW A;  2R9O A;  2E00 A;  1YAL A;  3OF9 A;  3F75 A;  1U5I A;  3PDF A;  4MZO A;  2WBF X;  2R9M A;  3P5X A;  5CHT A;  1A6R A;  2DCB A;  1AYW A;  5CVO B;  4YV8 A;  1NQC A;  3H6S A;  1PIP A;  1HUC B;  4XUI A;  4PP1 A;  4NV8 A;  1KHP A;  2DCC A;  2FYE A;  4N79 A;  3BC3 A;  1TLO A;  3KW9 A;  3BOW A;  1YK8 A;  2CIO A;  2DJF B;  2ATO A;  1GLO A;  1X9Y A;  3PBH A;  1EWO A;  2NQG A;  6PAD A;  2VHF A;  1CV8 A;  4YYW A;  1U9X A;  9PAP A;  2PAD A;  4C5P A;  3B79 A;  1CVZ A;  1CS8 A;  3MHS A;  4Q8G A;  1ZIV A;  1AU4 A;  2G6D A;  4BS6 A;  1JQP A;  3H7D A;  4BGF A;  1AU0 A;  4CDE B;  3IUT A;  4AXL A;  1F2C A;  1CJL A;  1F2A A;  3IEJ A;  1DEU A;  3K8U A;  3QSD A;  3CH3 X;  3HHA A;  1VSN A;  1CSB B;  2HH5 A;  2GFO A;  3KSE A;  1BGO A;  5FPW A;  3D9W A;  2AUZ A;  2AIM A;  2B1N A;  2FUD A;  2DC9 A;  1U9V A;  2FTD A;  1K3B B;  3O1G A;  1KFX L;  4PP2 E;  2OP3 A;  4BPV A;  1AIM A;  2PNS A;  4P6G A;  1M6D A;  3QT4 A;  1MDW A;  2YJC A;  3HHI A;  1CB5 A;  1U9Q X;  2FRA A;  3WXE A;  3S3R A;  3CBJ A;  1NB5 A;  4X6I A;  1NLJ A;  2G8E A;  3OF8 A;  2NQD B;  3AI8 A;  4N4Z A;  4RY2 A;  4FJC A;  2OUL A;  2F1G A;  3USV A;  5JH3 A;  3IMA A;  4YVA A;  2E01 A;  2IBI A;  5CHV A;  2DCA A;  3KWZ A;  4QBB A;  1AYV A;  1KXR A;  2Y6E A;  3OVX A;  1AEC A;  3KX1 A;  1E2T A;  4MZS A;  3I3T A;  4G54 A;  1F29 A;  3U8E A;  3HWN A;  2R6N A;  4X6H A;  1PPP A;  3P5W A;  4W4U A;  1KHQ A;  4OEL A;  2G8J A;  1PPD A;  1XKG A;  2YJ8 A;  2VFB A;  2FO5 A;  1PCI A;  2E03 A;  2GHU A;  3BWK A;  3IV2 A;  4CDC B;  2F7D A;  2G7Y A;  2FT2 A;  1ITO A;  2FQ9 A;  3C9E A;  1DF0 A;  2PRE A;  1CPJ A;  2Y5B A;  3OIS A;  2O6X A;  2H7J A;  1ICF A;  4PI3 A;  1KFU L;  1IWD A;  1EWM A;  1SP4 B;  4BSQ A;  1AYU A;  3LXS A;  5PAD A;  2YJ2 A;  2IPP B;  2CB5 A;  3D6S A;  2B1M A;  1GX3 A;  2P86 A;  2YJ9 A;  4YYS A;  1ZCM A;  4P6E A;  2XU5 A;  4PAD A;  3WXG A;  1YK7 A;  2ACT A;  4I04 A;  2R9N A;  3ZUA A;  1PXV A;  4AXM A;  7PCK A;  1CQD A;  3NHE A;  2VHS A;  4FK5 A;  1BP4 A;  4NV7 A;  4OEM A;  3LFY A;  2DC6 A;  4MSX A;  2E02 A;  1NPZ A;  2VFC A;  1PPO A;  2DZZ A;  2HHN A;  4W5C A;  1VJV A;  4YYU A;  3M99 A;  5EGW A;  1AU3 A;  1U9W A;  2NQI A;  3O0U A;  1O0E A;  3I06 A;  3MHH A;  2R9C A;  1BY8 A;  3OVZ A;  2BSZ A;  1PAD A;  4W5B A;  3V6E A;  3KWB X;  1GMY A;  1ATK A;  2FRQ A;  4CZW A;  1F2B A;  1MIR A;  4XR7 A;  2ARY A;  1NB3 A;  1CTE A;  1MEM A;  1Y08 A;  5EF4 A;  3H8C A;  5CVM A;  1W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...