3LFYA

Ctd of tarocystatin in complex with papain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Papain
publication title Complex structure of tarocystatin with papain and characterization of tarocystatin proposed the role of C-terminal extension for inhibitory mechanism of group-2 phytocystatins
rcsb
total genus 61
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lfyA00
4OELA 4CDFB 1EF7A 2CIOA 3WXFA 1YVBA 1O0EA 1PXVA 2YJ8A 3LFYA 2PNSA 1CTEA 2AU1A 2G7YA 5CHVA 1XKGA 2XU5A 3I3TA 1KFUL 4AXMA 2IBIA 4YYRA 3OVZA 4KLBA 1YT7A 1PPDA 5CVOB 3H7DA 2AS8A 2G8JA 2WBFX 3H6SA 3M99A 1QDQA 1YK8A 1CVZA 3CH2X 1QOLA 3CBKA 3IEJA 3HWNA 2AYOA 2HHNA 1CSBB 1AU2A 1ZIVA 4YYQA 5K16A 2P86A 1EWMA 1NPZA 1HUCB 2P7UA 8PCHA 1KHPA 2R9MA 5PADA 2AIMA 2DC8A 2HXZA 4W5BA 2DZZA 1YALA 1PBHA 2NQDB 1CJLA 1GCBA 2NQAA 2NQGA 3F75A 3KWBX 3HD3A 3LXSA 6PADA 1NB3A 3NHEA 2ARYA 4X6JA 3H8CA 3CBJA 3USVA 4W5CA 2E02A 1SNKA 3PDFA 1MIRA 3P5XA 1F2BA 2E01A 2FO5A 4K7CA 3E1ZB 2CB5A 5CHTA 1ATKA 2XU4A 3IUTA 4WA6A 2YJCA 4PP1A 2GFOA 1JQPA 1S4VA 3N3GA 3D6SA 2AVWA 1DEUA 4PP2E 1GECE 4N4ZA 1IWDA 1TU6A 1PE6A 2PREA 1TLOA 3IMAA 2BDZA 2C0YA 3WXEA 1CB5A 4W4UA 1CPJA 1PPNA 2DZYA 5EF4A 4YVAA 4MZOA 3K24A 3BPMA 1PADA 3N4CA 3IHPA 3F5VA 1K3BB 2DC7A 3BPFA 4YYSA 1U9VA 1M6DA 5A24A 2F1GA 1KFXL 3I06A 2FRAA 2FQ9A 2B1MA 2HH5A 4X6HA 2YJ9A 1U5IA 3OF9A 4ZUXU 4CDEB 3KKUA 1DF0A 3BWKA 1KXRA 1U9XA 5CVNB 4YYUA 2R9FA 1Q6KA 5FPWA 1TL9A 4DMXA 3P5UA 4YYVA 2XU3A 4CZWA 1AU3A 1YK7A 1GLOA 1PCIA 1AIMA 2AYNA 1EWPA 3H89A 4QRXA 1EWLA 1ME4A 2DCCA 1X9YA 1CS8A 1U9QX 2OP3A 2PADA 2JQGR 2BDLA 4YYWA 3C9EA 3RVVA 1POPA 3HHIA 4BS5A 3HHAA 2ATOA 2AUXA 4HWYA 4G54A 1PPOA 2F7DA 1GMYA 3H8BA 1PIPA 3KW9A 4FIPA 2FTDA 3DF0A 4BPVA 1MHWA 2E03A 1AYWA 1BY8A 2OULA 1NB5A 3PNRA 2B1NA 2FT2A 3ZUAA 5J94A 1SP4B 3U8EA 2YJBA 4BS6A 1CV8A 3S3QA 4Q8GA 1AU4A 7PCKA 2ACTA 3MHSA 1QXPA 4FJCA 2PBHA 2FYEA 3QT4A 5EGWA 3PBHA 1ME3A 1NLJA 2XU1A 2DCBA 3CH3X 2JQFR 3KFQA 3OVXA 3BC3A 2FUDA 5JA7A 2DC9A 4N8WA 4OEMA 4PADA 3K8UA 4X6IA 3KSEA 5CVMA 1AECA 2FRQA 3PW3A 3OISA 1THEA 2DC6A 4MSXA 3O0UA 3WXGA 1MEGA 2R9NA 3O1GA 1BP4A 2R6NA 4MZSA 2DCDA 4DMYA 1BQIA 2HD5A 3S3RA 3P5VA 4Q8HA 3K9MA 4YV8A 4QRVA 2DCAA 4QH6A 2Y5BA 1BGOA 1F2CA 1F29A 4I05A 1QMYA 3IV2A 3AI8A 2E00A 2IPPB 4QBBA 4AXLA 2NQIA 4XR7A 1NQCA 4QRGA 3MHHA 1AYUA 3OF8A 3QJ3A 1ZCMA 1F2AA 2GHUA 1VJVA 9PAPA 2H7JA 2P0RA 3BOWA 1MDWA 2DJFB 3P5WA 4XUIA 3IOQA 3RVWA 1AYVA 2VHFA 4PI3A 3N3KA 1KHQA 3MORA 2G6DA 2G8EA 4FK5A 1Y4HA 4BQVA 1AU0A 3MTNA 1Y08A 1ITOA 2DJGB 1MEMA 1FH0A 5F02A 3GCBA 1PPPA 5JH3A 4I07A 2R9OA 3RVXA 3ERVA 2VHSA 1ICFA 4RY2A 1STFE 4I04A 3QSDA 2OZ2A 3KWZA 4CDDB 1MS6A 1CQDA 2Y6EA 4BSQA 2O6XA 1NL6A 4CDCB 3BCNA 1A6RA 3TNXA 3KX1A 1VSNA 3B79A 4N79A 3V6CA 3V6EA 2R9CA 4P6GA 2AUZA 2YJ2A 1U9WA 4P6EA 1EWOA
chains in the Genus database with same CATH superfamily
4OELA 4CDFB 1EF7A 3PSEA 2CIOA 3WXFA 3MP2A 1YVBA 1O0EA 1PXVA 2YJ8A 3LFYA 2PNSA 1CTEA 2AU1A 2UZJA 2G7YA 5CHVA 1XKGA 2XU5A 3I3TA 1KFUL 4AXMA 2IBIA 4YYRA 3OVZA 3O65A 4KLBA 1YT7A 1PPDA 5CVOB 4OVZA 3H7DA 2AS8A 2G8JA 2J7QC 2WBFX 3H6SA 3PHWA 3M99A 1QDQA 1YK8A 1PVJA 1CVZA 2AGAA 3CH2X 4RKXA 1QOLA 3CBKA 3PT2A 3OQCA 3IEJA 3HWNA 2AYOA 2HHNA 1CSBB 1AU2A 1ZIVA 4YYQA 4D8BA 5K16A 2P86A 4RF0A 1EWMA 1NPZA 4D8EA 1HUCB 2P7UA 8PCHA 1KHPA 2R9MA 5PADA 2AIMA 3RNVA 2DC8A 3PHXA 2HXZA 4W5BA 2DZZA 1YALA 3C0RA 1PBHA 2NQDB 1CJLA 1GCBA 2NQAA 4IUMA 2NQGA 3F75A 3KWBX 3HD3A 3LXSA 6PADA 1NB3A 3NHEA 2ARYA 4X6JA 3H8CA 3BY4A 3CBJA 5E6JA 3USVA 4W5CA 2E02A 1SNKA 3PDFA 1MIRA 3P5XA 1F2BA 2E01A 2FO5A 4K7CA 3E1ZB 2CB5A 5CHTA 1ATKA 2XU4A 3IUTA 4WA6A 2YJCA 4PP1A 2GFOA 1JQPA 3TMPA 1S4VA 3BB7A 3N3GA 3D6SA 2AVWA 4WURA 1DEUA 3IFUA 4PP2E 1GECE 4N4ZA 1IWDA 4RF1A 1TU6A 1PE6A 2PREA 1TLOA 3IMAA 2BDZA 2C0YA 3WXEA 1CB5A 4W4UA 1CPJA 1PPNA 2DZYA 5KO3A 4M0WA 5EF4A 3PHUA 4YVAA 4MZOA 3K24A 3BPMA 3W30A 1PADA 3N4CA 3IHPA 3F5VA 1K3BB 2DC7A 3BPFA 4YYSA 1U9VA 1M6DA 2J7QA 5A24A 2F1GA 1KFXL 3I06A 2FRAA 2FQ9A 2B1MA 2HH5A 4X6HA 3TRKA 2YJ9A 1U5IA 3OF9A 4ZUXU 4CDEB 3KKUA 1DF0A 3BWKA 1KXRA 1U9XA 5CVNB 4YYUA 4P16A 2R9FA 1Q6KA 5FPWA 1TL9A 4DMXA 3P5UA 4YYVA 2XU3A 3PRMA 4RNAA 4CZWA 1AU3A 1YK7A 1GLOA 1PCIA 1AIMA 2AYNA 1DKIA 4BOZA 4GUAA 1EWPA 3H89A 4QRXA 1EWLA 1ME4A 2DCCA 1X9YA 1CS8A 1U9QX 2OP3A 2PADA 2JQGR 4BOUA 2BDLA 4YYWA 3C9EA 3RVVA 1POPA 3HHIA 4BS5A 3HHAA 4BOPA 2ATOA 2AUXA 4HWYA 4BOQA 4G54A 1PPOA 2F7DA 1GMYA 3H8BA 1PIPA 3KW9A 4FIPA 2FTDA 3DF0A 4BPVA 1MHWA 2E03A 1AYWA 1BY8A 5EZSA 2OULA 1NB5A 3PNRA 2B1NA 2FT2A 3ZUAA 2JTCA 5J94A 4OW0A 1SP4B 3U8EA 2YJBA 4BS6A 5JZEA 1CV8A 3S3QA 4XZXA 4Q8GA 1AU4A 7PCKA 2ACTA 3MHSA 1QXPA 4FJCA 2HWKA 2PBHA 2FYEA 3QT4A 5EGWA 3PBHA 1ME3A 1EWOA 1NLJA 3CH3X 2DCBA 2XU1A 2JQFR 3KFQA 3OVXA 3BC3A 2FUDA 5JA7A 3BBAA 2DC9A 3MTVA 4N8WA 4OEMA 4PADA 3K8UA 4X6IA 3KSEA 5CVMA 1AECA 2FRQA 3PW3A 3OISA 1THEA 4D8IA 2DC6A 4MSXA 3O0UA 3WXGA 1MEGA 2R9NA 3PRPA 3O1GA 1BP4A 2R6NA 3ZNHA 4MZSA 2DCDA 4DMYA 1BQIA 2HD5A 3S3RA 2JRIA 3P5VA 4Q8HA 3K9MA 4YV8A 4QRVA 2DCAA 4QH6A 2Y5BA 1BGOA 1F2CA 1F29A 4I05A 1QMYA 3IV2A 4PT5A 3AI8A 4A5UA 2E00A 2DOSA 2IPPB 4QBBA 4AXLA 2NQIA 4XR7A 1NQCA 4OVZB 4QRGA 3MHHA 1AYUA 3OF8A 3QJ3A 1ZCMA 1F2AA 2GHUA 1VJVA 2FE8A 9PAPA 2BTWA 3W31A 2BTWB 2H7JA 2P0RA 4REZA 4BOSA 3BOWA 1MDWA 2DJFB 3P5WA 4XUIA 3IOQA 2Z84A 4R3DA 3RVWA 1AYVA 2VHFA 4PI3A 3N3KA 1KHQA 3MORA 2G6DA 2G8EA 4HXDB 4FK5A 1Y4HA 4BQVA 4IP3A 1AU0A 3MTNA 4MM3B 1Y08A 1ITOA 2DJGB 1MEMA 4MI7A 1YZBA 1FH0A 5F02A 3GCBA 1PPPA 5JH3A 2R9OA 4I07A 3RVXA 3ERVA 2VHSA 3MJ5A 5EZQA 1ICFA 4RY2A 1STFE 4I04A 3QSDA 2OZ2A 3KWZA 4CDDB 2BU3A 1MS6A 1CQDA 2Y6EA 3E9SA 4BSQA 2O6XA 1NL6A 1UKFA 4CDCB 3BCNA 1A6RA 3TNXA 3KX1A 1VSNA 3B79A 4N79A 4ZTBA 3V6CA 3V6EA 2R9CA 4P6GA 2AUZA 2YJ2A 1U9WA 4P6EA 3B21A
chains in the Genus database with same CATH topology
4OELA 4CDFB 1EF7A 2CIOA 3WXFA 1YVBA 1O0EA 1PXVA 2YJ8A 3LFYA 2PNSA 1CTEA 2AU1A 2G7YA 5CHVA 1XKGA 2XU5A 3I3TA 1KFUL 4AXMA 2IBIA 4YYRA 3OVZA 4KLBA 1YT7A 1PPDA 5CVOB 3H7DA 2AS8A 2G8JA 2WBFX 3H6SA 3M99A 1QDQA 1YK8A 1CVZA 3CH2X 1W5RA 1QOLA 3CBKA 3IEJA 3HWNA 2AYOA 2HHNA 1CSBB 1AU2A 1ZIVA 4YYQA 5K16A 2P86A 1EWMA 1NPZA 1HUCB 2P7UA 8PCHA 1KHPA 2R9MA 5PADA 2AIMA 2DC8A 2HXZA 4W5BA 2DZZA 1YALA 1W6FA 1PBHA 2NQDB 1CJLA 2BSZA 1GCBA 2NQAA 2NQGA 3F75A 3KWBX 3HD3A 3LXSA 6PADA 1NB3A 3NHEA 2ARYA 4X6JA 3H8CA 4NV7A 3CBJA 3USVA 4W5CA 2E02A 1SNKA 3PDFA 1MIRA 3P5XA 1F2BA 2E01A 2FO5A 4K7CA 3E1ZB 2CB5A 5CHTA 1ATKA 2XU4A 3IUTA 4WA6A 2YJCA 4PP1A 2GFOA 1JQPA 1S4VA 3N3GA 3D6SA 2AVWA 1DEUA 4PP2E 1GECE 4N4ZA 1IWDA 1TU6A 1PE6A 2PREA 1TLOA 3IMAA 2BDZA 2C0YA 3WXEA 1CB5A 4W4UA 1CPJA 1PPNA 2DZYA 4B55A 5EF4A 4YVAA 4MZOA 3K24A 3BPMA 1PADA 3N4CA 3IHPA 3F5VA 1K3BB 2DC7A 3BPFA 4YYSA 1U9VA 1M6DA 5A24A 2F1GA 1KFXL 3I06A 2FRAA 2FQ9A 2B1MA 2HH5A 4X6HA 4BGFA 2YJ9A 4NV8A 1U5IA 3OF9A 4ZUXU 4CDEB 3KKUA 1DF0A 3BWKA 1KXRA 1U9XA 5CVNB 4YYUA 2R9FA 1Q6KA 5FPWA 1TL9A 4DMXA 3P5UA 4YYVA 2XU3A 4CZWA 1AU3A 1YK7A 1GLOA 3D9WA 1PCIA 1AIMA 2AYNA 1EWPA 3H89A 4QRXA 1EWLA 1ME4A 2DCCA 1X9YA 1CS8A 1U9QX 2OP3A 2PADA 2JQGR 2BDLA 4YYWA 4C5PA 3C9EA 3RVVA 1POPA 3HHIA 4BS5A 3HHAA 2ATOA 2AUXA 4HWYA 4G54A 1PPOA 2F7DA 1GMYA 3H8BA 1PIPA 3KW9A 4FIPA 2FTDA 3DF0A 4BPVA 1MHWA 2E03A 1AYWA 1BY8A 2OULA 1NB5A 3PNRA 2B1NA 1W4TA 2FT2A 3ZUAA 5J94A 1SP4B 3U8EA 2YJBA 4BS6A 1CV8A 3S3QA 4Q8GA 1AU4A 7PCKA 2ACTA 3MHSA 1QXPA 4FJCA 2PBHA 2FYEA 3QT4A 5EGWA 3PBHA 1ME3A 1NLJA 2XU1A 2DCBA 3CH3X 2JQFR 3KFQA 3OVXA 3BC3A 2FUDA 5JA7A 2DC9A 4N8WA 4OEMA 4PADA 3K8UA 4X6IA 3KSEA 5CVMA 1AECA 2FRQA 3PW3A 3OISA 1THEA 2DC6A 4MSXA 3O0UA 3WXGA 1MEGA 2R9NA 3O1GA 1BP4A 2R6NA 4MZSA 2DCDA 4DMYA 1BQIA 2HD5A 1GX3A 3S3RA 3P5VA 4Q8HA 3K9MA 4YV8A 4QRVA 2DCAA 4QH6A 2Y5BA 1BGOA 1F2CA 1F29A 4I05A 1QMYA 3IV2A 3AI8A 2E00A 2IPPB 2VFBA 4QBBA 4AXLA 2NQIA 4XR7A 1NQCA 4QRGA 3MHHA 1AYUA 3OF8A 3QJ3A 1ZCMA 1F2AA 2GHUA 1VJVA 9PAPA 2H7JA 2P0RA 4GUZA 3BOWA 1MDWA 2DJFB 3P5WA 4XUIA 3IOQA 3RVWA 1AYVA 2VHFA 4PI3A 3N3KA 1KHQA 3MORA 2G6DA 2G8EA 4FK5A 1Y4HA 4BQVA 1AU0A 3MTNA 1Y08A 1ITOA 2DJGB 1MEMA 3LTWA 1FH0A 5F02A 3GCBA 1PPPA 5JH3A 4I07A 2R9OA 3RVXA 3ERVA 2VHSA 1E2TA 1ICFA 4RY2A 1STFE 4I04A 3QSDA 2OZ2A 3KWZA 4CDDB 1MS6A 1CQDA 2Y6EA 4BSQA 2O6XA 1NL6A 4CDCB 2VFCA 3BCNA 1A6RA 3TNXA 3KX1A 1VSNA 3B79A 4N79A 3V6CA 3V6EA 2R9CA 4P6GA 2AUZA 2YJ2A 1U9WA 4P6EA 1EWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEL A;  4CDF B;  1EF7 A;  2CIO A;  3WXF A;  1YVB A;  1O0E A;  1PXV A;  2YJ8 A;  3LFY A;  2PNS A;  1CTE A;  2AU1 A;  2G7Y A;  5CHV A;  1XKG A;  2XU5 A;  3I3T A;  1KFU L;  4AXM A;  2IBI A;  4YYR A;  3OVZ A;  4KLB A;  1YT7 A;  1PPD A;  5CVO B;  3H7D A;  2AS8 A;  2G8J A;  2WBF X;  3H6S A;  3M99 A;  1QDQ A;  1YK8 A;  1CVZ A;  3CH2 X;  1QOL A;  3CBK A;  3IEJ A;  3HWN A;  2AYO A;  2HHN A;  1CSB B;  1AU2 A;  1ZIV A;  4YYQ A;  5K16 A;  2P86 A;  1EWM A;  1NPZ A;  1HUC B;  2P7U A;  8PCH A;  1KHP A;  2R9M A;  5PAD A;  2AIM A;  2DC8 A;  2HXZ A;  4W5B A;  2DZZ A;  1YAL A;  1PBH A;  2NQD B;  1CJL A;  1GCB A;  2NQA A;  2NQG A;  3F75 A;  3KWB X;  3HD3 A;  3LXS A;  6PAD A;  1NB3 A;  3NHE A;  2ARY A;  4X6J A;  3H8C A;  3CBJ A;  3USV A;  4W5C A;  2E02 A;  1SNK A;  3PDF A;  1MIR A;  3P5X A;  1F2B A;  2E01 A;  2FO5 A;  4K7C A;  3E1Z B;  2CB5 A;  5CHT A;  1ATK A;  2XU4 A;  3IUT A;  4WA6 A;  2YJC A;  4PP1 A;  2GFO A;  1JQP A;  1S4V A;  3N3G A;  3D6S A;  2AVW A;  1DEU A;  4PP2 E;  1GEC E;  4N4Z A;  1IWD A;  1TU6 A;  1PE6 A;  2PRE A;  1TLO A;  3IMA A;  2BDZ A;  2C0Y A;  3WXE A;  1CB5 A;  4W4U A;  1CPJ A;  1PPN A;  2DZY A;  5EF4 A;  4YVA A;  4MZO A;  3K24 A;  3BPM A;  1PAD A;  3N4C A;  3IHP A;  3F5V A;  1K3B B;  2DC7 A;  3BPF A;  4YYS A;  1U9V A;  1M6D A;  5A24 A;  2F1G A;  1KFX L;  3I06 A;  2FRA A;  2FQ9 A;  2B1M A;  2HH5 A;  4X6H A;  2YJ9 A;  1U5I A;  3OF9 A;  4ZUX U;  4CDE B;  3KKU A;  1DF0 A;  3BWK A;  1KXR A;  1U9X A;  5CVN B;  4YYU A;  2R9F A;  1Q6K A;  5FPW A;  1TL9 A;  4DMX A;  3P5U A;  4YYV A;  2XU3 A;  4CZW A;  1AU3 A;  1YK7 A;  1GLO A;  1PCI A;  1AIM A;  2AYN A;  1EWP A;  3H89 A;  4QRX A;  1EWL A;  1ME4 A;  2DCC A;  1X9Y A;  1CS8 A;  1U9Q X;  2OP3 A;  2PAD A;  2JQG R;  2BDL A;  4YYW A;  3C9E A;  3RVV A;  1POP A;  3HHI A;  4BS5 A;  3HHA A;  2ATO A;  2AUX A;  4HWY A;  4G54 A;  1PPO A;  2F7D A;  1GMY A;  3H8B A;  1PIP A;  3KW9 A;  4FIP A;  2FTD A;  3DF0 A;  4BPV A;  1MHW A;  2E03 A;  1AYW A;  1BY8 A;  2OUL A;  1NB5 A;  3PNR A;  2B1N A;  2FT2 A;  3ZUA A;  5J94 A;  1SP4 B;  3U8E A;  2YJB A;  4BS6 A;  1CV8 A;  3S3Q A;  4Q8G A;  1AU4 A;  7PCK A;  2ACT A;  3MHS A;  1QXP A;  4FJC A;  2PBH A;  2FYE A;  3QT4 A;  5EGW A;  3PBH A;  1ME3 A;  1NLJ A;  2XU1 A;  2DCB A;  3CH3 X;  2JQF R;  3KFQ A;  3OVX A;  3BC3 A;  2FUD A;  5JA7 A;  2DC9 A;  4N8W A;  4OEM A;  4PAD A;  3K8U A;  4X6I A;  3KSE A;  5CVM A;  1AEC A;  2FRQ A;  3PW3 A;  3OIS A;  1THE A;  2DC6 A;  4MSX A;  3O0U A;  3WXG A;  1MEG A;  2R9N A;  3O1G A;  1BP4 A;  2R6N A;  4MZS A;  2DCD A;  4DMY A;  1BQI A;  2HD5 A;  3S3R A;  3P5V A;  4Q8H A;  3K9M A;  4YV8 A;  4QRV A;  2DCA A;  4QH6 A;  2Y5B A;  1BGO A;  1F2C A;  1F29 A;  4I05 A;  1QMY A;  3IV2 A;  3AI8 A;  2E00 A;  2IPP B;  4QBB A;  4AXL A;  2NQI A;  4XR7 A;  1NQC A;  4QRG A;  3MHH A;  1AYU A;  3OF8 A;  3QJ3 A;  1ZCM A;  1F2A A;  2GHU A;  1VJV A;  9PAP A;  2H7J A;  2P0R A;  3BOW A;  1MDW A;  2DJF B;  3P5W A;  4XUI A;  3IOQ A;  3RVW A;  1AYV A;  2VHF A;  4PI3 A;  3N3K A;  1KHQ A;  3MOR A;  2G6D A;  2G8E A;  4FK5 A;  1Y4H A;  4BQV A;  1AU0 A;  3MTN A;  1Y08 A;  1ITO A;  2DJG B;  1MEM A;  1FH0 A;  5F02 A;  3GCB A;  1PPP A;  5JH3 A;  4I07 A;  2R9O A;  3RVX A;  3ERV A;  2VHS A;  1ICF A;  4RY2 A;  1STF E;  4I04 A;  3QSD A;  2OZ2 A;  3KWZ A;  4CDD B;  1MS6 A;  1CQD A;  2Y6E A;  4BSQ A;  2O6X A;  1NL6 A;  4CDC B;  3BCN A;  1A6R A;  3TNX A;  3KX1 A;  1VSN A;  3B79 A;  4N79 A;  3V6C A;  3V6E A;  2R9C A;  4P6G A;  2AUZ A;  2YJ2 A;  1U9W A;  4P6E A;  1EWO A; 
#chains in the Genus database with same CATH topology
 4OEL A;  4CDF B;  1EF7 A;  3PSE A;  2CIO A;  3WXF A;  3MP2 A;  1YVB A;  1O0E A;  1PXV A;  2YJ8 A;  3LFY A;  2PNS A;  1CTE A;  2AU1 A;  2UZJ A;  2G7Y A;  5CHV A;  1XKG A;  2XU5 A;  3I3T A;  1KFU L;  4AXM A;  2IBI A;  4YYR A;  3OVZ A;  3O65 A;  4KLB A;  1YT7 A;  1PPD A;  5CVO B;  4OVZ A;  3H7D A;  2AS8 A;  2G8J A;  2J7Q C;  2WBF X;  3H6S A;  3PHW A;  3M99 A;  1QDQ A;  1YK8 A;  1PVJ A;  1CVZ A;  2AGA A;  3CH2 X;  4RKX A;  1QOL A;  3CBK A;  3PT2 A;  3OQC A;  3IEJ A;  3HWN A;  2AYO A;  2HHN A;  1CSB B;  1AU2 A;  1ZIV A;  4YYQ A;  4D8B A;  5K16 A;  2P86 A;  4RF0 A;  1EWM A;  1NPZ A;  4D8E A;  1HUC B;  2P7U A;  8PCH A;  1KHP A;  2R9M A;  5PAD A;  2AIM A;  3RNV A;  2DC8 A;  3PHX A;  2HXZ A;  4W5B A;  2DZZ A;  1YAL A;  3C0R A;  1PBH A;  2NQD B;  1CJL A;  1GCB A;  2NQA A;  4IUM A;  2NQG A;  3F75 A;  3KWB X;  3HD3 A;  3LXS A;  6PAD A;  1NB3 A;  3NHE A;  2ARY A;  4X6J A;  3H8C A;  3BY4 A;  3CBJ A;  5E6J A;  3USV A;  4W5C A;  2E02 A;  1SNK A;  3PDF A;  1MIR A;  3P5X A;  1F2B A;  2E01 A;  2FO5 A;  4K7C A;  3E1Z B;  2CB5 A;  5CHT A;  1ATK A;  2XU4 A;  3IUT A;  4WA6 A;  2YJC A;  4PP1 A;  2GFO A;  1JQP A;  3TMP A;  1S4V A;  3BB7 A;  3N3G A;  3D6S A;  2AVW A;  4WUR A;  1DEU A;  3IFU A;  4PP2 E;  1GEC E;  4N4Z A;  1IWD A;  4RF1 A;  1TU6 A;  1PE6 A;  2PRE A;  1TLO A;  3IMA A;  2BDZ A;  2C0Y A;  3WXE A;  1CB5 A;  4W4U A;  1CPJ A;  1PPN A;  2DZY A;  5KO3 A;  4M0W A;  5EF4 A;  3PHU A;  4YVA A;  4MZO A;  3K24 A;  3BPM A;  3W30 A;  1PAD A;  3N4C A;  3IHP A;  3F5V A;  1K3B B;  2DC7 A;  3BPF A;  4YYS A;  1U9V A;  1M6D A;  2J7Q A;  5A24 A;  2F1G A;  1KFX L;  3I06 A;  2FRA A;  2FQ9 A;  2B1M A;  2HH5 A;  4X6H A;  3TRK A;  2YJ9 A;  1U5I A;  3OF9 A;  4ZUX U;  4CDE B;  3KKU A;  1DF0 A;  3BWK A;  1KXR A;  1U9X A;  5CVN B;  4YYU A;  4P16 A;  2R9F A;  1Q6K A;  5FPW A;  1TL9 A;  4DMX A;  3P5U A;  4YYV A;  2XU3 A;  3PRM A;  4RNA A;  4CZW A;  1AU3 A;  1YK7 A;  1GLO A;  1PCI A;  1AIM A;  2AYN A;  1DKI A;  4BOZ A;  4GUA A;  1EWP A;  3H89 A;  4QRX A;  1EWL A;  1ME4 A;  2DCC A;  1X9Y A;  1CS8 A;  1U9Q X;  2OP3 A;  2PAD A;  2JQG R;  4BOU A;  2BDL A;  4YYW A;  3C9E A;  3RVV A;  1POP A;  3HHI A;  4BS5 A;  3HHA A;  4BOP A;  2ATO A;  2AUX A;  4HWY A;  4BOQ A;  4G54 A;  1PPO A;  2F7D A;  1GMY A;  3H8B A;  1PIP A;  3KW9 A;  4FIP A;  2FTD A;  3DF0 A;  4BPV A;  1MHW A;  2E03 A;  1AYW A;  1BY8 A;  5EZS A;  2OUL A;  1NB5 A;  3PNR A;  2B1N A;  2FT2 A;  3ZUA A;  2JTC A;  5J94 A;  4OW0 A;  1SP4 B;  3U8E A;  2YJB A;  4BS6 A;  5JZE A;  1CV8 A;  3S3Q A;  4XZX A;  4Q8G A;  1AU4 A;  7PCK A;  2ACT A;  3MHS A;  1QXP A;  4FJC A;  2HWK A;  2PBH A;  2FYE A;  3QT4 A;  5EGW A;  3PBH A;  1ME3 A;  1EWO A;  1NLJ A;  3CH3 X;  2DCB A;  2XU1 A;  2JQF R;  3KFQ A;  3OVX A;  3BC3 A;  2FUD A;  5JA7 A;  3BBA A;  2DC9 A;  3MTV A;  4N8W A;  4OEM A;  4PAD A;  3K8U A;  4X6I A;  3KSE A;  5CVM A;  1AEC A;  2FRQ A;  3PW3 A;  3OIS A;  1THE A;  4D8I A;  2DC6 A;  4MSX A;  3O0U A;  3WXG A;  1MEG A;  2R9N A;  3PRP A;  3O1G A;  1BP4 A;  2R6N A;  3ZNH A;  4MZS A;  2DCD A;  4DMY A;  1BQI A;  2HD5 A;  3S3R A;  2JRI A;  3P5V A;  4Q8H A;  3K9M A;  4YV8 A;  4QRV A;  2DCA A;  4QH6 A;  2Y5B A;  1BGO A;  1F2C A;  1F29 A;  4I05 A;  1QMY A;  3IV2 A;  4PT5 A;  3AI8 A;  4A5U A;  2E00 A;  2DOS A;  2IPP B;  4QBB A;  4AXL A;  2NQI A;  4XR7 A;  1NQC A;  4OVZ B;  4QRG A;  3MHH A;  1AYU A;  3OF8 A;  3QJ3 A;  1ZCM A;  1F2A A;  2GHU A;  1VJV A;  2FE8 A;  9PAP A;  2BTW A;  3W31 A;  2BTW B;  2H7J A;  2P0R A;  4REZ A;  4BOS A;  3BOW A;  1MDW A;  2DJF B;  3P5W A;  4XUI A;  3IOQ A;  2Z84 A;  4R3D A;  3RVW A;  1AYV A;  2VHF A;  4PI3 A;  3N3K A;  1KHQ A;  3MOR A;  2G6D A;  2G8E A;  4HXD B;  4FK5 A;  1Y4H A;  4BQV A;  4IP3 A;  1AU0 A;  3MTN A;  4MM3 B;  1Y08 A;  1ITO A;  2DJG B;  1MEM A;  4MI7 A;  1YZB A;  1FH0 A;  5F02 A;  3GCB A;  1PPP A;  5JH3 A;  2R9O A;  4I07 A;  3RVX A;  3ERV A;  2VHS A;  3MJ5 A;  5EZQ A;  1ICF A;  4RY2 A;  1STF E;  4I04 A;  3QSD A;  2OZ2 A;  3KWZ A;  4CDD B;  2BU3 A;  1MS6 A;  1CQD A;  2Y6E A;  3E9S A;  4BSQ A;  2O6X A;  1NL6 A;  1UKF A;  4CDC B;  3BCN A;  1A6R A;  3TNX A;  3KX1 A;  1VSN A;  3B79 A;  4N79 A;  4ZTB A;  3V6C A;  3V6E A;  2R9C A;  4P6G A;  2AUZ A;  2YJ2 A;  1U9W A;  4P6E A;  3B21 A; 
#chains in the Genus database with same CATH homology
 4OEL A;  4CDF B;  1EF7 A;  2CIO A;  3WXF A;  1YVB A;  1O0E A;  1PXV A;  2YJ8 A;  3LFY A;  2PNS A;  1CTE A;  2AU1 A;  2G7Y A;  5CHV A;  1XKG A;  2XU5 A;  3I3T A;  1KFU L;  4AXM A;  2IBI A;  4YYR A;  3OVZ A;  4KLB A;  1YT7 A;  1PPD A;  5CVO B;  3H7D A;  2AS8 A;  2G8J A;  2WBF X;  3H6S A;  3M99 A;  1QDQ A;  1YK8 A;  1CVZ A;  3CH2 X;  1W5R A;  1QOL A;  3CBK A;  3IEJ A;  3HWN A;  2AYO A;  2HHN A;  1CSB B;  1AU2 A;  1ZIV A;  4YYQ A;  5K16 A;  2P86 A;  1EWM A;  1NPZ A;  1HUC B;  2P7U A;  8PCH A;  1KHP A;  2R9M A;  5PAD A;  2AIM A;  2DC8 A;  2HXZ A;  4W5B A;  2DZZ A;  1YAL A;  1W6F A;  1PBH A;  2NQD B;  1CJL A;  2BSZ A;  1GCB A;  2NQA A;  2NQG A;  3F75 A;  3KWB X;  3HD3 A;  3LXS A;  6PAD A;  1NB3 A;  3NHE A;  2ARY A;  4X6J A;  3H8C A;  4NV7 A;  3CBJ A;  3USV A;  4W5C A;  2E02 A;  1SNK A;  3PDF A;  1MIR A;  3P5X A;  1F2B A;  2E01 A;  2FO5 A;  4K7C A;  3E1Z B;  2CB5 A;  5CHT A;  1ATK A;  2XU4 A;  3IUT A;  4WA6 A;  2YJC A;  4PP1 A;  2GFO A;  1JQP A;  1S4V A;  3N3G A;  3D6S A;  2AVW A;  1DEU A;  4PP2 E;  1GEC E;  4N4Z A;  1IWD A;  1TU6 A;  1PE6 A;  2PRE A;  1TLO A;  3IMA A;  2BDZ A;  2C0Y A;  3WXE A;  1CB5 A;  4W4U A;  1CPJ A;  1PPN A;  2DZY A;  4B55 A;  5EF4 A;  4YVA A;  4MZO A;  3K24 A;  3BPM A;  1PAD A;  3N4C A;  3IHP A;  3F5V A;  1K3B B;  2DC7 A;  3BPF A;  4YYS A;  1U9V A;  1M6D A;  5A24 A;  2F1G A;  1KFX L;  3I06 A;  2FRA A;  2FQ9 A;  2B1M A;  2HH5 A;  4X6H A;  4BGF A;  2YJ9 A;  4NV8 A;  1U5I A;  3OF9 A;  4ZUX U;  4CDE B;  3KKU A;  1DF0 A;  3BWK A;  1KXR A;  1U9X A;  5CVN B;  4YYU A;  2R9F A;  1Q6K A;  5FPW A;  1TL9 A;  4DMX A;  3P5U A;  4YYV A;  2XU3 A;  4CZW A;  1AU3 A;  1YK7 A;  1GLO A;  3D9W A;  1PCI A;  1AIM A;  2AYN A;  1EWP A;  3H89 A;  4QRX A;  1EWL A;  1ME4 A;  2DCC A;  1X9Y A;  1CS8 A;  1U9Q X;  2OP3 A;  2PAD A;  2JQG R;  2BDL A;  4YYW A;  4C5P A;  3C9E A;  3RVV A;  1POP A;  3HHI A;  4BS5 A;  3HHA A;  2ATO A;  2AUX A;  4HWY A;  4G54 A;  1PPO A;  2F7D A;  1GMY A;  3H8B A;  1PIP A;  3KW9 A;  4FIP A;  2FTD A;  3DF0 A;  4BPV A;  1MHW A;  2E03 A;  1AYW A;  1BY8 A;  2OUL A;  1NB5 A;  3PNR A;  2B1N A;  1W4T A;  2FT2 A;  3ZUA A;  5J94 A;  1SP4 B;  3U8E A;  2YJB A;  4BS6 A;  1CV8 A;  3S3Q A;  4Q8G A;  1AU4 A;  7PCK A;  2ACT A;  3MHS A;  1QXP A;  4FJC A;  2PBH A;  2FYE A;  3QT4 A;  5EGW A;  3PBH A;  1ME3 A;  1NLJ A;  2XU1 A;  2DCB A;  3CH3 X;  2JQF R;  3KFQ A;  3OVX A;  3BC3 A;  2FUD A;  5JA7 A;  2DC9 A;  4N8W A;  4OEM A;  4PAD A;  3K8U A;  4X6I A;  3KSE A;  5CVM A;  1AEC A;  2FRQ A;  3PW3 A;  3OIS A;  1THE A;  2DC6 A;  4MSX A;  3O0U A;  3WXG A;  1MEG A;  2R9N A;  3O1G A;  1BP4 A;  2R6N A;  4MZS A;  2DCD A;  4DMY A;  1BQI A;  2HD5 A;  1GX3 A;  3S3R A;  3P5V A;  4Q8H A;  3K9M A;  4YV8 A;  4QRV A;  2DCA A;  4QH6 A;  2Y5B A;  1BGO A;  1F2C A;  1F29 A;  4I05 A;  1QMY A;  3IV2 A;  3AI8 A;  2E00 A;  2IPP B;  2VFB A;  4QBB A;  4AXL A;  2NQI A;  4XR7 A;  1NQC A;  4QRG A;  3MHH A;  1AYU A;  3OF8 A;  3QJ3 A;  1ZCM A;  1F2A A;  2GHU A;  1VJV A;  9PAP A;  2H7J A;  2P0R A;  4GUZ A;  3BOW A;  1MDW A;  2DJF B;  3P5W A;  4XUI A;  3IOQ A;  3RVW A;  1AYV A;  2VHF A;  4PI3 A;  3N3K A;  1KHQ A;  3MOR A;  2G6D A;  2G8E A;  4FK5 A;  1Y4H A;  4BQV A;  1AU0 A;  3MTN A;  1Y08 A;  1ITO A;  2DJG B;  1MEM A;  3LTW A;  1FH0 A;  5F02 A;  3GCB A;  1PPP A;  5JH3 A;  4I07 A;  2R9O A;  3RVX A;  3ERV A;  2VHS A;  1E2T A;  1ICF A;  4RY2 A;  1STF E;  4I04 A;  3QSD A;  2OZ2 A;  3KWZ A;  4CDD B;  1MS6 A;  1CQD A;  2Y6E A;  4BSQ A;  2O6X A;  1NL6 A;  4CDC B;  2VFC A;  3BCN A;  1A6R A;  3TNX A;  3KX1 A;  1VSN A;  3B79 A;  4N79 A;  3V6C A;  3V6E A;  2R9C A;  4P6G A;  2AUZ A;  2YJ2 A;  1U9W A;  4P6E A;  1EWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...