3LFYA

Ctd of tarocystatin in complex with papain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
212
structure length
211
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Papain
publication title Complex structure of tarocystatin with papain and characterization of tarocystatin proposed the role of C-terminal extension for inhibitory mechanism of group-2 phytocystatins
rcsb
molecule tags Hydrolase
total genus 61
structure length 211
sequence length 212
chains with identical sequence C
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 2010-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3lfyA00
4BS5A 1VSNA 4X6JA 2DC7A 1DEUA 1POPA 4CDEB 3K8UA 3O0UA 4N79A 5F02A 2F7DA 1NLJA 2XU3A 4YYQA 1BGOA 2CB5A 5A24A 2R9MA 3QT4A 3OVZA 1FH0A 1STFE 3N3GA 3BC3A 4PP1A 2FQ9A 1MIRA 2YJ9A 2DC6A 1AU0A 4CDDB 1KFUL 3KX1A 5EGWA 1GLOA 1QMYA 1GECE 2PBHA 4BQVA 1U5IA 3RVWA 3QSDA 1K3BB 3V6CA 3QJ3A 3KKUA 4QRXA 1EWLA 1TLOA 3WXGA 3K9MA 2XU5A 3IUTA 1AU2A 2R9FA 3KW9A 1ITOA 4WA6A 1YALA 1PPPA 4QRGA 2ATOA 3NHEA 2YJCA 4K7CA 1THEA 2YJ8A 2NQIA 2FUDA 1QOLA 1MEGA 2DCBA 2HXZA 2PNSA 1NQCA 3BOWA 1MDWA 3BCNA 1A6RA 4XR7A 4W4UA 4YYRA 2AUXA 2OULA 4I07A 2R9OA 3LXSA 3P5XA 1PIPA 2OZ2A 4P6GA 3HD3A 1CV8A 1AECA 1CPJA 4MSXA 2DZYA 4PP2E 2FO5A 2P0RA 1QXPA 2GHUA 4BSQA 2B1MA 2BDZA 2WBFX 3IMAA 3I3TA 1PADA 1AIMA 1M6DA 2C0YA 1AYWA 4MZOA 1PPOA 4YYSA 3K24A 4Q8GA 3N3KA 8PCHA 2FT2A 3H7DA 3IEJA 2DCDA 3P5UA 2VHFA 3B79A 4RY2A 4PADA 3DF0A 1ZCMA 3O1GA 3MTNA 2FYEA 2R9NA 1CSBB 1HUCB 3BPMA 3P5VA 2DC8A 1F29A 3V6EA 4BPVA 2R6NA 1U9VA 2XU1A 3H89A 1CB5A 2P86A 1AYUA 2AS8A 3BWKA 2XU4A 1AU3A 1XKGA 4OEMA 3GCBA 1MEMA 3OVXA 1U9QX 2FRQA 2PADA 3PDFA 3OF9A 4N4ZA 3MHSA 1QDQA 4DMYA 1BQIA 4N8WA 2IBIA 2CIOA 4CDFB 2AIMA 2DJGB 1ZIVA 3PNRA 1GMYA 4CZWA 3I06A 2HD5A 4W5BA 4X6IA 1AYVA 5CVOB 3PW3A 4YYVA 2AUZA 5CVMA 3KSEA 1VJVA 1CVZA 3S3QA 1MS6A 2F1GA 2DCCA 1F2CA 3H8CA 3M99A 2G8JA 1PBHA 4PI3A 1SP4B 1PXVA 3LFYA 3WXFA 2DJFB 4QRVA 1NPZA 3N4CA 2NQDB 5CHVA 2YJ2A 1CS8A 4Q8HA 1BP4A 1Y08A 4FJCA 2E03A 1AU4A 4G54A 3IV2A 4YYWA 3KWZA 4AXLA 3HHAA 1CJLA 1GCBA 3RVXA 2G7YA 3ERVA 4QBBA 1S4VA 2FTDA 4P6EA 3BPFA 2BDLA 1PPDA 2AYNA 3CH3X 4I05A 2E00A 2DCAA 2JQFR 2Y5BA 2VHSA 2PREA 5J94A 1PE6A 1CTEA 3CBKA 4QH6A 1Q6KA 2G6DA 2DC9A 3IHPA 2ACTA 4YYUA 1EF7A 1MHWA 3U8EA 3USVA 3RVVA 4YV8A 1ATKA 2NQAA 4HWYA 3F75A 4FIPA 3CH2X 2AVWA 3MHHA 1Y4HA 1NB3A 5CVNB 5EF4A 1IWDA 2NQGA 4X6HA 2HH5A 5K16A 2G8EA 3OISA 3S3RA 4YVAA 2GFOA 3KFQA 4W5CA 1JQPA 1KXRA 3OF8A 4XUIA 3WXEA 4CDCB 1CQDA 1X9YA 3IOQA 1NL6A 1TU6A 1BY8A 3H8BA 2OP3A 2R9CA 1ICFA 1EWOA 1TL9A 1KHPA 1EWPA 3CBJA 9PAPA 3TNXA 1YK7A 1F2AA 4KLBA 2ARYA 3P5WA 7PCKA 2E02A 2AYOA 1YVBA 3PBHA 1PCIA 2H7JA 4MZSA 1YK8A 1YT7A 1F2BA 2AU1A 6PADA 2IPPB 1U9WA 2O6XA 3C9EA 4FK5A 5PADA 3D6SA 3E1ZB 4I04A 2HHNA 4AXMA 5JH3A 3KWBX 2P7UA 4DMXA 2FRAA 1SNKA 3F5VA 4OELA 1PPNA 2B1NA 2JQGR 2E01A 1DF0A 1ME3A 2YJBA 5FPWA 5CHTA 2Y6EA 1O0EA 3HHIA 3ZUAA 1U9XA 4BS6A 1NB5A 1ME4A 3MORA 1EWMA 2DZZA 4ZUXU 3AI8A 5JA7A 1KFXL 3HWNA 1KHQA 3H6SA
chains in the Genus database with same CATH superfamily
4BS5A 1VSNA 4X6JA 4ZTBA 2DC7A 1DEUA 1POPA 4CDEB 3K8UA 3O0UA 4N79A 4OW0A 5F02A 2F7DA 1NLJA 2XU3A 4BOQA 4YYQA 3B21A 1BGOA 2CB5A 5A24A 2R9MA 3QT4A 4M0WA 3OVZA 1FH0A 2JRIA 1STFE 3N3GA 4BOZA 3BC3A 4PP1A 2FQ9A 1MIRA 2YJ9A 2DC6A 1AU0A 4CDDB 1KFUL 3KX1A 5EGWA 4GUAA 1GLOA 1QMYA 1GECE 2PBHA 4BQVA 1U5IA 3RVWA 3QSDA 1K3BB 3V6CA 3QJ3A 3KKUA 2BTWB 4BOSA 4QRXA 1EWLA 1TLOA 3E9SA 4RNAA 3MTVA 4HXDB 3WXGA 3K9MA 2XU5A 4PT5A 3IUTA 1AU2A 2R9FA 3KW9A 1ITOA 4WA6A 1YALA 1PPPA 4QRGA 2ATOA 3NHEA 2YJCA 4K7CA 1THEA 2YJ8A 2NQIA 2FUDA 1QOLA 3PSEA 1MEGA 2DCBA 2HXZA 2PNSA 4MI7A 1NQCA 3BOWA 1MDWA 3BCNA 2AGAA 1A6RA 4XR7A 4W4UA 4D8BA 4YYRA 2AUXA 2J7QA 2OULA 1PVJA 4I07A 3W31A 2R9OA 3LXSA 3P5XA 2UZJA 1PIPA 2OZ2A 4P6GA 3HD3A 1UKFA 1CV8A 1AECA 4RF1A 1CPJA 4MSXA 2DZYA 4PP2E 2FO5A 2P0RA 1QXPA 2GHUA 4BSQA 2B1MA 2BDZA 3MP2A 2J7QC 2WBFX 3IMAA 3I3TA 1PADA 1AIMA 1M6DA 4D8EA 2C0YA 1AYWA 4MZOA 1PPOA 4YYSA 3K24A 3MJ5A 4Q8GA 3N3KA 8PCHA 2FT2A 3H7DA 3IEJA 2DCDA 3P5UA 2VHFA 3B79A 4RY2A 4PADA 3DF0A 1ZCMA 3O1GA 3MTNA 2FYEA 2R9NA 1CSBB 1HUCB 3BPMA 3P5VA 2DC8A 1F29A 3V6EA 4BPVA 2R6NA 1U9VA 2XU1A 3H89A 3PT2A 1CB5A 3PHUA 3TMPA 2P86A 1AYUA 2AS8A 3BWKA 2XU4A 1AU3A 1XKGA 4OEMA 3GCBA 1MEMA 3OVXA 1U9QX 4WURA 2FRQA 2PADA 3PDFA 3OF9A 4N4ZA 3MHSA 1QDQA 4RKXA 4DMYA 1BQIA 4P16A 3BY4A 2IBIA 4N8WA 2CIOA 4CDFB 2AIMA 2DJGB 1ZIVA 3PNRA 1GMYA 4CZWA 3RNVA 3I06A 2HD5A 4W5BA 4X6IA 1AYVA 5CVOB 3PW3A 4YYVA 2AUZA 5CVMA 3KSEA 5E6JA 1VJVA 4OVZB 1CVZA 3S3QA 1MS6A 2F1GA 2DCCA 1F2CA 3H8CA 3M99A 2G8JA 1PBHA 4R3DA 4RF0A 4PI3A 1SP4B 5EZSA 1PXVA 3LFYA 3WXFA 2DJFB 2DOSA 4QRVA 3BB7A 1NPZA 3N4CA 2NQDB 5CHVA 2YJ2A 1CS8A 4Q8HA 1BP4A 4IUMA 4XZXA 1Y08A 4FJCA 2E03A 1AU4A 4G54A 3IV2A 4YYWA 3KWZA 4AXLA 3HHAA 4REZA 1CJLA 1GCBA 3RVXA 2G7YA 5JZEA 3ERVA 4QBBA 1S4VA 2FTDA 4P6EA 3BPFA 4OVZA 2BDLA 1PPDA 2AYNA 3CH3X 4I05A 5EZQA 2E00A 2DCAA 3PHWA 2HWKA 2JQFR 2Y5BA 2VHSA 2PREA 5J94A 2FE8A 1PE6A 2JTCA 1CTEA 3C0RA 3CBKA 2G6DA 1Q6KA 3IHPA 2DC9A 4QH6A 2ACTA 4YYUA 3IFUA 1EF7A 1MHWA 3OQCA 4MM3B 4IP3A 3U8EA 3USVA 3RVVA 4YV8A 1ATKA 2NQAA 4HWYA 3F75A 4FIPA 3CH2X 2AVWA 3MHHA 1Y4HA 1NB3A 5CVNB 5EF4A 1IWDA 2NQGA 4X6HA 2HH5A 5K16A 2G8EA 3OISA 3S3RA 4YVAA 2GFOA 3KFQA 4W5CA 1JQPA 1KXRA 3OF8A 4XUIA 3WXEA 4CDCB 1CQDA 1X9YA 3IOQA 1NL6A 1TU6A 1BY8A 3H8BA 2OP3A 2R9CA 1ICFA 1EWOA 1TL9A 1KHPA 1EWPA 3CBJA 9PAPA 3PRPA 3TRKA 3TNXA 1YK7A 1F2AA 4KLBA 2ARYA 3P5WA 7PCKA 2E02A 2AYOA 1YVBA 3PBHA 1PCIA 2H7JA 4MZSA 1YK8A 5KO3A 1YT7A 1F2BA 2AU1A 6PADA 2IPPB 1U9WA 2O6XA 3C9EA 4FK5A 2Z84A 5PADA 3D6SA 3E1ZB 4I04A 2HHNA 4AXMA 5JH3A 3KWBX 2P7UA 3W30A 4DMXA 1DKIA 3BBAA 2FRAA 3O65A 4BOPA 1SNKA 3F5VA 3PRMA 4OELA 1PPNA 2B1NA 2JQGR 2E01A 1DF0A 1ME3A 2YJBA 5FPWA 5CHTA 2BTWA 1YZBA 2Y6EA 1O0EA 3HHIA 3ZUAA 1U9XA 4BS6A 1NB5A 4D8IA 1ME4A 3MORA 1EWMA 3ZNHA 2BU3A 2DZZA 4BOUA 4ZUXU 4A5UA 3AI8A 5JA7A 1KFXL 3HWNA 3PHXA 1KHQA 3H6SA
chains in the Genus database with same CATH topology
4BS5A 1VSNA 4X6JA 2DC7A 1DEUA 1POPA 4CDEB 3K8UA 3O0UA 4N79A 5F02A 2F7DA 1NLJA 2XU3A 4YYQA 1BGOA 2CB5A 5A24A 2R9MA 3QT4A 3OVZA 1FH0A 1STFE 3N3GA 3BC3A 4PP1A 2FQ9A 1MIRA 2YJ9A 2DC6A 1AU0A 4CDDB 1KFUL 1W5RA 3KX1A 5EGWA 1GLOA 1QMYA 1GECE 3D9WA 2PBHA 4BQVA 1U5IA 3RVWA 4B55A 3QSDA 1K3BB 3V6CA 3QJ3A 3KKUA 4QRXA 1EWLA 4NV7A 1TLOA 3WXGA 3K9MA 2XU5A 3IUTA 1AU2A 2R9FA 3KW9A 1ITOA 4WA6A 1YALA 1PPPA 4QRGA 2ATOA 4NV8A 3NHEA 2YJCA 4K7CA 1THEA 2YJ8A 2NQIA 2FUDA 1QOLA 1MEGA 2DCBA 2HXZA 2PNSA 1NQCA 3BOWA 1MDWA 3BCNA 1A6RA 4XR7A 4W4UA 4YYRA 2AUXA 2OULA 4I07A 2R9OA 3LXSA 3P5XA 1PIPA 2OZ2A 4P6GA 3HD3A 1CV8A 1AECA 1CPJA 1GX3A 4MSXA 2DZYA 4PP2E 2FO5A 2P0RA 1QXPA 2GHUA 4BSQA 2B1MA 2BDZA 2WBFX 3IMAA 3I3TA 1PADA 1AIMA 1M6DA 2C0YA 1AYWA 4MZOA 1PPOA 4YYSA 3K24A 4Q8GA 3N3KA 8PCHA 2FT2A 3H7DA 3IEJA 2DCDA 3P5UA 2VHFA 3B79A 4RY2A 4PADA 3DF0A 4C5PA 1ZCMA 3O1GA 3MTNA 2FYEA 2R9NA 1CSBB 1HUCB 3BPMA 3P5VA 2DC8A 1F29A 3V6EA 4BPVA 2R6NA 1U9VA 2XU1A 3H89A 1CB5A 2P86A 1AYUA 2AS8A 3BWKA 2XU4A 1AU3A 1XKGA 4OEMA 3GCBA 1MEMA 3OVXA 1U9QX 2FRQA 2PADA 3PDFA 3OF9A 4N4ZA 3MHSA 1QDQA 4DMYA 1BQIA 4N8WA 2IBIA 2CIOA 4CDFB 2AIMA 2DJGB 1ZIVA 3PNRA 1GMYA 4CZWA 1E2TA 3I06A 2HD5A 4W5BA 4X6IA 1AYVA 5CVOB 3PW3A 4YYVA 2AUZA 5CVMA 3KSEA 1VJVA 1CVZA 3S3QA 1MS6A 2F1GA 2DCCA 1F2CA 3H8CA 3M99A 2G8JA 4BGFA 1PBHA 4PI3A 1SP4B 1PXVA 3LFYA 3WXFA 2DJFB 4QRVA 1NPZA 3N4CA 2NQDB 5CHVA 2YJ2A 1CS8A 4Q8HA 1BP4A 1Y08A 4FJCA 2E03A 1AU4A 4G54A 3IV2A 4YYWA 3KWZA 4AXLA 3HHAA 1CJLA 1GCBA 3RVXA 2G7YA 3ERVA 4QBBA 1S4VA 2FTDA 4P6EA 3BPFA 2BDLA 1PPDA 2VFCA 2AYNA 3CH3X 4I05A 2E00A 2DCAA 2JQFR 2Y5BA 2VFBA 1W6FA 2VHSA 2PREA 5J94A 1PE6A 1CTEA 3CBKA 2G6DA 1Q6KA 3IHPA 2DC9A 4QH6A 2ACTA 4YYUA 1EF7A 1MHWA 3U8EA 3USVA 3RVVA 4YV8A 1ATKA 2NQAA 4HWYA 3F75A 4FIPA 3CH2X 2AVWA 3MHHA 1Y4HA 1NB3A 5CVNB 5EF4A 1IWDA 2NQGA 4X6HA 2HH5A 5K16A 2G8EA 3OISA 3S3RA 4YVAA 2GFOA 3KFQA 4W5CA 1JQPA 1KXRA 3OF8A 4XUIA 3WXEA 4CDCB 1CQDA 1X9YA 3IOQA 1NL6A 1TU6A 1BY8A 3H8BA 2OP3A 2R9CA 1ICFA 1EWOA 1TL9A 1KHPA 1EWPA 3CBJA 9PAPA 3TNXA 1YK7A 1F2AA 4KLBA 2ARYA 3P5WA 7PCKA 2E02A 2AYOA 1YVBA 3PBHA 1PCIA 2H7JA 4MZSA 1YK8A 1YT7A 1F2BA 2AU1A 6PADA 1W4TA 2IPPB 1U9WA 2O6XA 3C9EA 4FK5A 5PADA 3D6SA 3E1ZB 4I04A 2HHNA 4AXMA 5JH3A 3KWBX 2P7UA 4DMXA 4GUZA 2FRAA 1SNKA 3F5VA 4OELA 1PPNA 2B1NA 2JQGR 2E01A 1DF0A 1ME3A 2YJBA 5FPWA 5CHTA 2Y6EA 1O0EA 3HHIA 3ZUAA 1U9XA 4BS6A 1NB5A 3LTWA 1ME4A 3MORA 1EWMA 2DZZA 4ZUXU 3AI8A 5JA7A 1KFXL 3HWNA 1KHQA 2BSZA 3H6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BS5 A;  1VSN A;  4X6J A;  2DC7 A;  1DEU A;  1POP A;  4CDE B;  3K8U A;  3O0U A;  4N79 A;  5F02 A;  2F7D A;  1NLJ A;  2XU3 A;  4YYQ A;  1BGO A;  2CB5 A;  5A24 A;  2R9M A;  3QT4 A;  3OVZ A;  1FH0 A;  1STF E;  3N3G A;  3BC3 A;  4PP1 A;  2FQ9 A;  1MIR A;  2YJ9 A;  2DC6 A;  1AU0 A;  4CDD B;  1KFU L;  3KX1 A;  5EGW A;  1GLO A;  1QMY A;  1GEC E;  2PBH A;  4BQV A;  1U5I A;  3RVW A;  3QSD A;  1K3B B;  3V6C A;  3QJ3 A;  3KKU A;  4QRX A;  1EWL A;  1TLO A;  3WXG A;  3K9M A;  2XU5 A;  3IUT A;  1AU2 A;  2R9F A;  3KW9 A;  1ITO A;  4WA6 A;  1YAL A;  1PPP A;  4QRG A;  2ATO A;  3NHE A;  2YJC A;  4K7C A;  1THE A;  2YJ8 A;  2NQI A;  2FUD A;  1QOL A;  1MEG A;  2DCB A;  2HXZ A;  2PNS A;  1NQC A;  3BOW A;  1MDW A;  3BCN A;  1A6R A;  4XR7 A;  4W4U A;  4YYR A;  2AUX A;  2OUL A;  4I07 A;  2R9O A;  3LXS A;  3P5X A;  1PIP A;  2OZ2 A;  4P6G A;  3HD3 A;  1CV8 A;  1AEC A;  1CPJ A;  4MSX A;  2DZY A;  4PP2 E;  2FO5 A;  2P0R A;  1QXP A;  2GHU A;  4BSQ A;  2B1M A;  2BDZ A;  2WBF X;  3IMA A;  3I3T A;  1PAD A;  1AIM A;  1M6D A;  2C0Y A;  1AYW A;  4MZO A;  1PPO A;  4YYS A;  3K24 A;  4Q8G A;  3N3K A;  8PCH A;  2FT2 A;  3H7D A;  3IEJ A;  2DCD A;  3P5U A;  2VHF A;  3B79 A;  4RY2 A;  4PAD A;  3DF0 A;  1ZCM A;  3O1G A;  3MTN A;  2FYE A;  2R9N A;  1CSB B;  1HUC B;  3BPM A;  3P5V A;  2DC8 A;  1F29 A;  3V6E A;  4BPV A;  2R6N A;  1U9V A;  2XU1 A;  3H89 A;  1CB5 A;  2P86 A;  1AYU A;  2AS8 A;  3BWK A;  2XU4 A;  1AU3 A;  1XKG A;  4OEM A;  3GCB A;  1MEM A;  3OVX A;  1U9Q X;  2FRQ A;  2PAD A;  3PDF A;  3OF9 A;  4N4Z A;  3MHS A;  1QDQ A;  4DMY A;  1BQI A;  4N8W A;  2IBI A;  2CIO A;  4CDF B;  2AIM A;  2DJG B;  1ZIV A;  3PNR A;  1GMY A;  4CZW A;  3I06 A;  2HD5 A;  4W5B A;  4X6I A;  1AYV A;  5CVO B;  3PW3 A;  4YYV A;  2AUZ A;  5CVM A;  3KSE A;  1VJV A;  1CVZ A;  3S3Q A;  1MS6 A;  2F1G A;  2DCC A;  1F2C A;  3H8C A;  3M99 A;  2G8J A;  1PBH A;  4PI3 A;  1SP4 B;  1PXV A;  3LFY A;  3WXF A;  2DJF B;  4QRV A;  1NPZ A;  3N4C A;  2NQD B;  5CHV A;  2YJ2 A;  1CS8 A;  4Q8H A;  1BP4 A;  1Y08 A;  4FJC A;  2E03 A;  1AU4 A;  4G54 A;  3IV2 A;  4YYW A;  3KWZ A;  4AXL A;  3HHA A;  1CJL A;  1GCB A;  3RVX A;  2G7Y A;  3ERV A;  4QBB A;  1S4V A;  2FTD A;  4P6E A;  3BPF A;  2BDL A;  1PPD A;  2AYN A;  3CH3 X;  4I05 A;  2E00 A;  2DCA A;  2JQF R;  2Y5B A;  2VHS A;  2PRE A;  5J94 A;  1PE6 A;  1CTE A;  3CBK A;  4QH6 A;  1Q6K A;  2G6D A;  2DC9 A;  3IHP A;  2ACT A;  4YYU A;  1EF7 A;  1MHW A;  3U8E A;  3USV A;  3RVV A;  4YV8 A;  1ATK A;  2NQA A;  4HWY A;  3F75 A;  4FIP A;  3CH2 X;  2AVW A;  3MHH A;  1Y4H A;  1NB3 A;  5CVN B;  5EF4 A;  1IWD A;  2NQG A;  4X6H A;  2HH5 A;  5K16 A;  2G8E A;  3OIS A;  3S3R A;  4YVA A;  2GFO A;  3KFQ A;  4W5C A;  1JQP A;  1KXR A;  3OF8 A;  4XUI A;  3WXE A;  4CDC B;  1CQD A;  1X9Y A;  3IOQ A;  1NL6 A;  1TU6 A;  1BY8 A;  3H8B A;  2OP3 A;  2R9C A;  1ICF A;  1EWO A;  1TL9 A;  1KHP A;  1EWP A;  3CBJ A;  9PAP A;  3TNX A;  1YK7 A;  1F2A A;  4KLB A;  2ARY A;  3P5W A;  7PCK A;  2E02 A;  2AYO A;  1YVB A;  3PBH A;  1PCI A;  2H7J A;  4MZS A;  1YK8 A;  1YT7 A;  1F2B A;  2AU1 A;  6PAD A;  2IPP B;  1U9W A;  2O6X A;  3C9E A;  4FK5 A;  5PAD A;  3D6S A;  3E1Z B;  4I04 A;  2HHN A;  4AXM A;  5JH3 A;  3KWB X;  2P7U A;  4DMX A;  2FRA A;  1SNK A;  3F5V A;  4OEL A;  1PPN A;  2B1N A;  2JQG R;  2E01 A;  1DF0 A;  1ME3 A;  2YJB A;  5FPW A;  5CHT A;  2Y6E A;  1O0E A;  3HHI A;  3ZUA A;  1U9X A;  4BS6 A;  1NB5 A;  1ME4 A;  3MOR A;  1EWM A;  2DZZ A;  4ZUX U;  3AI8 A;  5JA7 A;  1KFX L;  3HWN A;  1KHQ A;  3H6S A; 
#chains in the Genus database with same CATH topology
 4BS5 A;  1VSN A;  4X6J A;  4ZTB A;  2DC7 A;  1DEU A;  1POP A;  4CDE B;  3K8U A;  3O0U A;  4N79 A;  4OW0 A;  5F02 A;  2F7D A;  1NLJ A;  2XU3 A;  4BOQ A;  4YYQ A;  3B21 A;  1BGO A;  2CB5 A;  5A24 A;  2R9M A;  3QT4 A;  4M0W A;  3OVZ A;  1FH0 A;  2JRI A;  1STF E;  3N3G A;  4BOZ A;  3BC3 A;  4PP1 A;  2FQ9 A;  1MIR A;  2YJ9 A;  2DC6 A;  1AU0 A;  4CDD B;  1KFU L;  3KX1 A;  5EGW A;  4GUA A;  1GLO A;  1QMY A;  1GEC E;  2PBH A;  4BQV A;  1U5I A;  3RVW A;  3QSD A;  1K3B B;  3V6C A;  3QJ3 A;  3KKU A;  2BTW B;  4BOS A;  4QRX A;  1EWL A;  1TLO A;  3E9S A;  4RNA A;  3MTV A;  4HXD B;  3WXG A;  3K9M A;  2XU5 A;  4PT5 A;  3IUT A;  1AU2 A;  2R9F A;  3KW9 A;  1ITO A;  4WA6 A;  1YAL A;  1PPP A;  4QRG A;  2ATO A;  3NHE A;  2YJC A;  4K7C A;  1THE A;  2YJ8 A;  2NQI A;  2FUD A;  1QOL A;  3PSE A;  1MEG A;  2DCB A;  2HXZ A;  2PNS A;  4MI7 A;  1NQC A;  3BOW A;  1MDW A;  3BCN A;  2AGA A;  1A6R A;  4XR7 A;  4W4U A;  4D8B A;  4YYR A;  2AUX A;  2J7Q A;  2OUL A;  1PVJ A;  4I07 A;  3W31 A;  2R9O A;  3LXS A;  3P5X A;  2UZJ A;  1PIP A;  2OZ2 A;  4P6G A;  3HD3 A;  1UKF A;  1CV8 A;  1AEC A;  4RF1 A;  1CPJ A;  4MSX A;  2DZY A;  4PP2 E;  2FO5 A;  2P0R A;  1QXP A;  2GHU A;  4BSQ A;  2B1M A;  2BDZ A;  3MP2 A;  2J7Q C;  2WBF X;  3IMA A;  3I3T A;  1PAD A;  1AIM A;  1M6D A;  4D8E A;  2C0Y A;  1AYW A;  4MZO A;  1PPO A;  4YYS A;  3K24 A;  3MJ5 A;  4Q8G A;  3N3K A;  8PCH A;  2FT2 A;  3H7D A;  3IEJ A;  2DCD A;  3P5U A;  2VHF A;  3B79 A;  4RY2 A;  4PAD A;  3DF0 A;  1ZCM A;  3O1G A;  3MTN A;  2FYE A;  2R9N A;  1CSB B;  1HUC B;  3BPM A;  3P5V A;  2DC8 A;  1F29 A;  3V6E A;  4BPV A;  2R6N A;  1U9V A;  2XU1 A;  3H89 A;  3PT2 A;  1CB5 A;  3PHU A;  3TMP A;  2P86 A;  1AYU A;  2AS8 A;  3BWK A;  2XU4 A;  1AU3 A;  1XKG A;  4OEM A;  3GCB A;  1MEM A;  3OVX A;  1U9Q X;  4WUR A;  2FRQ A;  2PAD A;  3PDF A;  3OF9 A;  4N4Z A;  3MHS A;  1QDQ A;  4RKX A;  4DMY A;  1BQI A;  4P16 A;  3BY4 A;  2IBI A;  4N8W A;  2CIO A;  4CDF B;  2AIM A;  2DJG B;  1ZIV A;  3PNR A;  1GMY A;  4CZW A;  3RNV A;  3I06 A;  2HD5 A;  4W5B A;  4X6I A;  1AYV A;  5CVO B;  3PW3 A;  4YYV A;  2AUZ A;  5CVM A;  3KSE A;  5E6J A;  1VJV A;  4OVZ B;  1CVZ A;  3S3Q A;  1MS6 A;  2F1G A;  2DCC A;  1F2C A;  3H8C A;  3M99 A;  2G8J A;  1PBH A;  4R3D A;  4RF0 A;  4PI3 A;  1SP4 B;  5EZS A;  1PXV A;  3LFY A;  3WXF A;  2DJF B;  2DOS A;  4QRV A;  3BB7 A;  1NPZ A;  3N4C A;  2NQD B;  5CHV A;  2YJ2 A;  1CS8 A;  4Q8H A;  1BP4 A;  4IUM A;  4XZX A;  1Y08 A;  4FJC A;  2E03 A;  1AU4 A;  4G54 A;  3IV2 A;  4YYW A;  3KWZ A;  4AXL A;  3HHA A;  4REZ A;  1CJL A;  1GCB A;  3RVX A;  2G7Y A;  5JZE A;  3ERV A;  4QBB A;  1S4V A;  2FTD A;  4P6E A;  3BPF A;  4OVZ A;  2BDL A;  1PPD A;  2AYN A;  3CH3 X;  4I05 A;  5EZQ A;  2E00 A;  2DCA A;  3PHW A;  2HWK A;  2JQF R;  2Y5B A;  2VHS A;  2PRE A;  5J94 A;  2FE8 A;  1PE6 A;  2JTC A;  1CTE A;  3C0R A;  3CBK A;  2G6D A;  1Q6K A;  3IHP A;  2DC9 A;  4QH6 A;  2ACT A;  4YYU A;  3IFU A;  1EF7 A;  1MHW A;  3OQC A;  4MM3 B;  4IP3 A;  3U8E A;  3USV A;  3RVV A;  4YV8 A;  1ATK A;  2NQA A;  4HWY A;  3F75 A;  4FIP A;  3CH2 X;  2AVW A;  3MHH A;  1Y4H A;  1NB3 A;  5CVN B;  5EF4 A;  1IWD A;  2NQG A;  4X6H A;  2HH5 A;  5K16 A;  2G8E A;  3OIS A;  3S3R A;  4YVA A;  2GFO A;  3KFQ A;  4W5C A;  1JQP A;  1KXR A;  3OF8 A;  4XUI A;  3WXE A;  4CDC B;  1CQD A;  1X9Y A;  3IOQ A;  1NL6 A;  1TU6 A;  1BY8 A;  3H8B A;  2OP3 A;  2R9C A;  1ICF A;  1EWO A;  1TL9 A;  1KHP A;  1EWP A;  3CBJ A;  9PAP A;  3PRP A;  3TRK A;  3TNX A;  1YK7 A;  1F2A A;  4KLB A;  2ARY A;  3P5W A;  7PCK A;  2E02 A;  2AYO A;  1YVB A;  3PBH A;  1PCI A;  2H7J A;  4MZS A;  1YK8 A;  5KO3 A;  1YT7 A;  1F2B A;  2AU1 A;  6PAD A;  2IPP B;  1U9W A;  2O6X A;  3C9E A;  4FK5 A;  2Z84 A;  5PAD A;  3D6S A;  3E1Z B;  4I04 A;  2HHN A;  4AXM A;  5JH3 A;  3KWB X;  2P7U A;  3W30 A;  4DMX A;  1DKI A;  3BBA A;  2FRA A;  3O65 A;  4BOP A;  1SNK A;  3F5V A;  3PRM A;  4OEL A;  1PPN A;  2B1N A;  2JQG R;  2E01 A;  1DF0 A;  1ME3 A;  2YJB A;  5FPW A;  5CHT A;  2BTW A;  1YZB A;  2Y6E A;  1O0E A;  3HHI A;  3ZUA A;  1U9X A;  4BS6 A;  1NB5 A;  4D8I A;  1ME4 A;  3MOR A;  1EWM A;  3ZNH A;  2BU3 A;  2DZZ A;  4BOU A;  4ZUX U;  4A5U A;  3AI8 A;  5JA7 A;  1KFX L;  3HWN A;  3PHX A;  1KHQ A;  3H6S A; 
#chains in the Genus database with same CATH homology
 4BS5 A;  1VSN A;  4X6J A;  2DC7 A;  1DEU A;  1POP A;  4CDE B;  3K8U A;  3O0U A;  4N79 A;  5F02 A;  2F7D A;  1NLJ A;  2XU3 A;  4YYQ A;  1BGO A;  2CB5 A;  5A24 A;  2R9M A;  3QT4 A;  3OVZ A;  1FH0 A;  1STF E;  3N3G A;  3BC3 A;  4PP1 A;  2FQ9 A;  1MIR A;  2YJ9 A;  2DC6 A;  1AU0 A;  4CDD B;  1KFU L;  1W5R A;  3KX1 A;  5EGW A;  1GLO A;  1QMY A;  1GEC E;  3D9W A;  2PBH A;  4BQV A;  1U5I A;  3RVW A;  4B55 A;  3QSD A;  1K3B B;  3V6C A;  3QJ3 A;  3KKU A;  4QRX A;  1EWL A;  4NV7 A;  1TLO A;  3WXG A;  3K9M A;  2XU5 A;  3IUT A;  1AU2 A;  2R9F A;  3KW9 A;  1ITO A;  4WA6 A;  1YAL A;  1PPP A;  4QRG A;  2ATO A;  4NV8 A;  3NHE A;  2YJC A;  4K7C A;  1THE A;  2YJ8 A;  2NQI A;  2FUD A;  1QOL A;  1MEG A;  2DCB A;  2HXZ A;  2PNS A;  1NQC A;  3BOW A;  1MDW A;  3BCN A;  1A6R A;  4XR7 A;  4W4U A;  4YYR A;  2AUX A;  2OUL A;  4I07 A;  2R9O A;  3LXS A;  3P5X A;  1PIP A;  2OZ2 A;  4P6G A;  3HD3 A;  1CV8 A;  1AEC A;  1CPJ A;  1GX3 A;  4MSX A;  2DZY A;  4PP2 E;  2FO5 A;  2P0R A;  1QXP A;  2GHU A;  4BSQ A;  2B1M A;  2BDZ A;  2WBF X;  3IMA A;  3I3T A;  1PAD A;  1AIM A;  1M6D A;  2C0Y A;  1AYW A;  4MZO A;  1PPO A;  4YYS A;  3K24 A;  4Q8G A;  3N3K A;  8PCH A;  2FT2 A;  3H7D A;  3IEJ A;  2DCD A;  3P5U A;  2VHF A;  3B79 A;  4RY2 A;  4PAD A;  3DF0 A;  4C5P A;  1ZCM A;  3O1G A;  3MTN A;  2FYE A;  2R9N A;  1CSB B;  1HUC B;  3BPM A;  3P5V A;  2DC8 A;  1F29 A;  3V6E A;  4BPV A;  2R6N A;  1U9V A;  2XU1 A;  3H89 A;  1CB5 A;  2P86 A;  1AYU A;  2AS8 A;  3BWK A;  2XU4 A;  1AU3 A;  1XKG A;  4OEM A;  3GCB A;  1MEM A;  3OVX A;  1U9Q X;  2FRQ A;  2PAD A;  3PDF A;  3OF9 A;  4N4Z A;  3MHS A;  1QDQ A;  4DMY A;  1BQI A;  4N8W A;  2IBI A;  2CIO A;  4CDF B;  2AIM A;  2DJG B;  1ZIV A;  3PNR A;  1GMY A;  4CZW A;  1E2T A;  3I06 A;  2HD5 A;  4W5B A;  4X6I A;  1AYV A;  5CVO B;  3PW3 A;  4YYV A;  2AUZ A;  5CVM A;  3KSE A;  1VJV A;  1CVZ A;  3S3Q A;  1MS6 A;  2F1G A;  2DCC A;  1F2C A;  3H8C A;  3M99 A;  2G8J A;  4BGF A;  1PBH A;  4PI3 A;  1SP4 B;  1PXV A;  3LFY A;  3WXF A;  2DJF B;  4QRV A;  1NPZ A;  3N4C A;  2NQD B;  5CHV A;  2YJ2 A;  1CS8 A;  4Q8H A;  1BP4 A;  1Y08 A;  4FJC A;  2E03 A;  1AU4 A;  4G54 A;  3IV2 A;  4YYW A;  3KWZ A;  4AXL A;  3HHA A;  1CJL A;  1GCB A;  3RVX A;  2G7Y A;  3ERV A;  4QBB A;  1S4V A;  2FTD A;  4P6E A;  3BPF A;  2BDL A;  1PPD A;  2VFC A;  2AYN A;  3CH3 X;  4I05 A;  2E00 A;  2DCA A;  2JQF R;  2Y5B A;  2VFB A;  1W6F A;  2VHS A;  2PRE A;  5J94 A;  1PE6 A;  1CTE A;  3CBK A;  2G6D A;  1Q6K A;  3IHP A;  2DC9 A;  4QH6 A;  2ACT A;  4YYU A;  1EF7 A;  1MHW A;  3U8E A;  3USV A;  3RVV A;  4YV8 A;  1ATK A;  2NQA A;  4HWY A;  3F75 A;  4FIP A;  3CH2 X;  2AVW A;  3MHH A;  1Y4H A;  1NB3 A;  5CVN B;  5EF4 A;  1IWD A;  2NQG A;  4X6H A;  2HH5 A;  5K16 A;  2G8E A;  3OIS A;  3S3R A;  4YVA A;  2GFO A;  3KFQ A;  4W5C A;  1JQP A;  1KXR A;  3OF8 A;  4XUI A;  3WXE A;  4CDC B;  1CQD A;  1X9Y A;  3IOQ A;  1NL6 A;  1TU6 A;  1BY8 A;  3H8B A;  2OP3 A;  2R9C A;  1ICF A;  1EWO A;  1TL9 A;  1KHP A;  1EWP A;  3CBJ A;  9PAP A;  3TNX A;  1YK7 A;  1F2A A;  4KLB A;  2ARY A;  3P5W A;  7PCK A;  2E02 A;  2AYO A;  1YVB A;  3PBH A;  1PCI A;  2H7J A;  4MZS A;  1YK8 A;  1YT7 A;  1F2B A;  2AU1 A;  6PAD A;  1W4T A;  2IPP B;  1U9W A;  2O6X A;  3C9E A;  4FK5 A;  5PAD A;  3D6S A;  3E1Z B;  4I04 A;  2HHN A;  4AXM A;  5JH3 A;  3KWB X;  2P7U A;  4DMX A;  4GUZ A;  2FRA A;  1SNK A;  3F5V A;  4OEL A;  1PPN A;  2B1N A;  2JQG R;  2E01 A;  1DF0 A;  1ME3 A;  2YJB A;  5FPW A;  5CHT A;  2Y6E A;  1O0E A;  3HHI A;  3ZUA A;  1U9X A;  4BS6 A;  1NB5 A;  3LTW A;  1ME4 A;  3MOR A;  1EWM A;  2DZZ A;  4ZUX U;  3AI8 A;  5JA7 A;  1KFX L;  3HWN A;  1KHQ A;  2BSZ A;  3H6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...