2ARYA

Catalytic domain of human calpain-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
322
structure length
322
Chain Sequence
NAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Calpain-1 catalytic subunit
publication title The Crystal Structures of Human Calpains 1 and 9 Imply Diverse Mechanisms of Action and Auto-inhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 3.4.22.52: Calpain-1.
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aryA02
2R9FA 1U9VA 1NB3A 2G6DA 2NQDB 5CHVA 5J94A 4CDEB 1F2CA 2DZYA 2HXZA 3KX1A 3D6SA 2XU4A 3CH3X 3KWZA 3QJ3A 4YVAA 1FH0A 4I07A 2H7JA 2WBFX 4YYUA 2FO5A 1GCBA 4YYWA 1NPZA 1AU0A 2HH5A 4BSQA 4RY2A 2ARYA 1PPOA 3KW9A 1CJLA 3O0UA 4PADA 3USVA 2DC6A 1F29A 3OVXA 2B1NA 1F2AA 2DCDA 2R6NA 1CV8A 4FJCA 2YJ9A 2YJ8A 2FRQA 9PAPA 4X6IA 2E01A 3ZUAA 4AXLA 3IEJA 1ATKA 4QRVA 1BY8A 1YALA 1S4VA 3M99A 3CH2X 2XU3A 4CDFB 1XKGA 2F1GA 2DCCA 2OZ2A 4PP1A 2CIOA 4YYVA 3H8BA 1DEUA 4G54A 1SP4B 3IOQA 2AUZA 4N4ZA 1QMYA 3HWNA 2NQGA 4BPVA 3KFQA 3V6CA 1AU3A 3IHPA 4DMXA 3MHSA 4W4UA 7PCKA 2PNSA 4PP2E 3F5VA 2DZZA 3PW3A 1TU6A 2DC9A 1GECE 3CBJA 2ATOA 1YK7A 2PBHA 1DF0A 5CVMA 5PADA 3LXSA 3OISA 2HHNA 1MDWA 1M6DA 1NQCA 2P86A 1HUCB 3I06A 1ME3A 1KHPA 1PPPA 1A6RA 2JQGR 4OELA 3DF0A 3PDFA 4ZUXU 1BQIA 4QBBA 5EGWA 4YV8A 1YT7A 4P6EA 1QOLA 3WXEA 5A24A 1TLOA 3IV2A 4KLBA 5K16A 4W5BA 1PPNA 4OEMA 3O1GA 1QXPA 1AU4A 4Q8HA 3CBKA 2OULA 3H6SA 4DMYA 1PBHA 2BDZA 4Q8GA 1Q6KA 2G8JA 1K3BB 2IBIA 3BPMA 4YYSA 2JQFR 1Y4HA 6PADA 2C0YA 3RVWA 3U8EA 2DJGB 2R9NA 1AYWA 2P0RA 2R9OA 1U9WA 3KWBX 1GLOA 1GMYA 3RVVA 1EWPA 1MEMA 1TL9A 1EWMA 3OF9A 1AECA 3HD3A 3P5VA 2OP3A 5CVOB 2E00A 4MZOA 4N8WA 4XR7A 1PADA 1O0EA 2GHUA 3MORA 2AS8A 1MS6A 3NHEA 2R9CA 3V6EA 2F7DA 2P7UA 3MHHA 2DC7A 4MSXA 3H8CA 3MTNA 4PI3A 3KSEA 4N79A 2XU5A 4FK5A 3IMAA 1THEA 3PBHA 4BS5A 3BPFA 1U5IA 2Y6EA 1KFUL 3BOWA 1Y08A 4QRXA 2NQIA 2HD5A 3K8UA 3N3KA 1PXVA 3OVZA 3QSDA 4X6HA 1BGOA 2DJFB 1POPA 2AYNA 2PREA 2YJ2A 4W5CA 3BWKA 1ITOA 3GCBA 5CHTA 1CSBB 1CB5A 2PADA 4CDDB 1AU2A 1BP4A 3K24A 1AIMA 1YVBA 3KKUA 4WA6A 3OF8A 4I04A 4MZSA 1KFXL 4I05A 1CTEA 1QDQA 3TNXA 3LFYA 1AYUA 1VSNA 1PPDA 1CPJA 1ZIVA 4BS6A 4FIPA 3H89A 2G7YA 3P5WA 1NLJA 4BQVA 3B79A 3HHAA 1MHWA 2FYEA 3P5UA 3S3QA 2ACTA 1STFE 3BCNA 1SNKA 1CVZA 2E03A 2AIMA 4XUIA 4P6GA 1EWOA 3E1ZB 2R9MA 2AUXA 3ERVA 3S3RA 3P5XA 1U9QX 2BDLA 3N4CA 1PIPA 1PE6A 3QT4A 2DCBA 1CQDA 2VHSA 5FPWA 4YYRA 3I3TA 1ZCMA 2E02A 2FT2A 8PCHA 3WXGA 3H7DA 1ME4A 5CVNB 2GFOA 2FQ9A 2DCAA 1KXRA 5F02A 3BC3A 2IPPB 2AU1A 4YYQA 4QH6A 1YK8A 2AYOA 3PNRA 2XU1A 2DC8A 2FTDA 2Y5BA 5JA7A 4CDCB 1VJVA 1EWLA 1PCIA 1MEGA 1NL6A 1X9YA 1IWDA 4AXMA 5JH3A 2YJBA 2G8EA 4K7CA 2B1MA 3F75A 2VHFA 1ICFA 3HHIA 1F2BA 3IUTA 4HWYA 2FUDA 3WXFA 2NQAA 3K9MA 3RVXA 5EF4A 1EF7A 2O6XA 2FRAA 1NB5A 4QRGA 4CZWA 4X6JA 1CS8A 3N3GA 1JQPA 1MIRA 3AI8A 1KHQA 2YJCA 2AVWA 1U9XA 1AYVA 2CB5A 3C9EA
chains in the Genus database with same CATH superfamily
2R9FA 1U9VA 1NB3A 2G6DA 2NQDB 5CHVA 5J94A 4CDEB 1F2CA 2DZYA 2HXZA 3KX1A 3D6SA 4M0WA 2XU4A 3CH3X 3KWZA 3QJ3A 4YVAA 4IP3A 1FH0A 4I07A 2H7JA 2WBFX 4OW0A 4YYUA 2FO5A 1GCBA 4YYWA 1NPZA 1AU0A 2HH5A 3BB7A 4BSQA 4RY2A 2ARYA 1PPOA 3KW9A 1CJLA 3O0UA 4PADA 3USVA 2DC6A 1F29A 2J7QC 3OVXA 2B1NA 1F2AA 2DCDA 2R6NA 1CV8A 4FJCA 2YJ9A 2YJ8A 2DOSA 2FRQA 9PAPA 4X6IA 2E01A 3ZUAA 4AXLA 5E6JA 3IEJA 1ATKA 4QRVA 1BY8A 1YALA 1S4VA 3M99A 3CH2X 2XU3A 4CDFB 4RF1A 1XKGA 2F1GA 2DCCA 2OZ2A 4R3DA 4PP1A 2CIOA 2JRIA 4YYVA 3C0RA 3H8BA 1DEUA 4G54A 1SP4B 3IOQA 2AUZA 4N4ZA 1QMYA 3HWNA 2NQGA 3BBAA 3PRPA 4BPVA 1DKIA 3KFQA 5KO3A 3V6CA 1AU3A 3W30A 3IHPA 4DMXA 3MHSA 1UKFA 4W4UA 7PCKA 2PNSA 4PP2E 3F5VA 2DZZA 3PW3A 2HWKA 1TU6A 2DC9A 1GECE 3CBJA 2ATOA 1YK7A 2PBHA 1DF0A 5CVMA 5PADA 3LXSA 3OISA 4OVZA 2HHNA 1MDWA 1M6DA 1NQCA 2P86A 1HUCB 3I06A 3MP2A 1ME3A 2Z84A 1KHPA 4XZXA 4MI7A 1PPPA 1A6RA 2JQGR 4OELA 3DF0A 3PDFA 4ZUXU 1BQIA 4QBBA 5EGWA 4YV8A 1YT7A 4P6EA 1QOLA 3WXEA 5A24A 1TLOA 3IV2A 4KLBA 5K16A 4W5BA 1PPNA 4OEMA 4P16A 3O1GA 1QXPA 1AU4A 3PRMA 4D8BA 4Q8HA 3BY4A 2OULA 3CBKA 3H6SA 4DMYA 3W31A 1PBHA 2BDZA 4Q8GA 1Q6KA 2G8JA 1K3BB 2IBIA 3BPMA 4YYSA 2JQFR 1Y4HA 4BOUA 6PADA 2C0YA 3RVWA 3U8EA 2DJGB 2R9NA 1AYWA 2P0RA 2R9OA 2FE8A 3E9SA 1U9WA 3KWBX 1GLOA 1GMYA 3RVVA 4D8IA 1EWPA 1MEMA 1TL9A 1EWMA 3OF9A 1AECA 3HD3A 4BOQA 3P5VA 2OP3A 4REZA 5CVOB 2E00A 4MZOA 4N8WA 4BOSA 4XR7A 1PADA 1O0EA 2GHUA 3MORA 2AS8A 1MS6A 3NHEA 2R9CA 3V6EA 2F7DA 2P7UA 3MHHA 2DC7A 4MSXA 3TRKA 3H8CA 3MTNA 4PI3A 3KSEA 4N79A 3PSEA 2UZJA 2XU5A 4FK5A 3IMAA 1THEA 3PBHA 4BS5A 3BPFA 1U5IA 4RNAA 4ZTBA 2Y6EA 1KFUL 3BOWA 4OVZB 1Y08A 4QRXA 4RF0A 4A5UA 2NQIA 2HD5A 3K8UA 3N3KA 3O65A 1PXVA 3OVZA 4RKXA 3TMPA 3QSDA 4X6HA 1BGOA 2DJFB 1POPA 2AYNA 5EZQA 2PREA 2YJ2A 4W5CA 2JTCA 3BWKA 1ITOA 3GCBA 5CHTA 1CSBB 1CB5A 2PADA 5EZSA 4CDDB 1AU2A 1BP4A 2BU3A 3K24A 1AIMA 2BTWA 1YVBA 3B21A 3KKUA 3PHXA 4WA6A 4BOZA 3OF8A 4WURA 4HXDB 4I04A 4MM3B 4MZSA 1KFXL 4I05A 1CTEA 1QDQA 3TNXA 2J7QA 3LFYA 1AYUA 1VSNA 1PPDA 1CPJA 1ZIVA 4BS6A 4FIPA 3H89A 2G7YA 3P5WA 1NLJA 4IUMA 4BQVA 3B79A 3HHAA 1MHWA 2FYEA 3P5UA 3S3QA 2ACTA 1STFE 3BCNA 3IFUA 1SNKA 1CVZA 2E03A 2AIMA 3PHUA 4XUIA 3MTVA 4P6GA 1EWOA 3E1ZB 3RNVA 2R9MA 2AUXA 3ERVA 3S3RA 3P5XA 1U9QX 2BDLA 3N4CA 1PIPA 1PE6A 3QT4A 2DCBA 1CQDA 2VHSA 5FPWA 4YYRA 3I3TA 1ZCMA 2E02A 2FT2A 4PT5A 8PCHA 3WXGA 3H7DA 1ME4A 5CVNB 4GUAA 2GFOA 2FQ9A 2DCAA 1KXRA 5F02A 3BC3A 2IPPB 2AU1A 4YYQA 4QH6A 1YK8A 2AYOA 3PNRA 4D8EA 2XU1A 2DC8A 2FTDA 2Y5BA 5JA7A 5JZEA 4CDCB 1VJVA 1YZBA 1EWLA 1PCIA 1MEGA 1NL6A 1X9YA 1IWDA 4AXMA 5JH3A 4BOPA 2YJBA 2BTWB 2G8EA 4K7CA 2B1MA 3PHWA 3MJ5A 3F75A 2VHFA 1ICFA 3HHIA 1F2BA 3IUTA 4HWYA 2FUDA 3PT2A 3WXFA 1PVJA 2NQAA 3K9MA 3RVXA 5EF4A 1EF7A 2O6XA 3OQCA 2FRAA 1NB5A 3ZNHA 4QRGA 4CZWA 4X6JA 1CS8A 3N3GA 1JQPA 1MIRA 3AI8A 2AGAA 1KHQA 2YJCA 2AVWA 1U9XA 1AYVA 2CB5A 3C9EA
chains in the Genus database with same CATH topology
2R9FA 1U9VA 1NB3A 2G6DA 2NQDB 5CHVA 5J94A 4CDEB 1F2CA 2DZYA 2HXZA 3KX1A 3D6SA 2XU4A 3CH3X 3KWZA 3QJ3A 4YVAA 1FH0A 4I07A 2H7JA 2WBFX 4YYUA 2FO5A 1GCBA 4YYWA 1NPZA 1AU0A 4BGFA 2HH5A 4BSQA 4RY2A 2ARYA 1PPOA 3KW9A 1CJLA 3O0UA 4PADA 3USVA 2BSZA 2DC6A 1F29A 3OVXA 2B1NA 1F2AA 2DCDA 2R6NA 1CV8A 4FJCA 2YJ9A 2YJ8A 2FRQA 9PAPA 4X6IA 2E01A 3ZUAA 4AXLA 3IEJA 1ATKA 4QRVA 1BY8A 1YALA 1S4VA 3M99A 3CH2X 2XU3A 4CDFB 1XKGA 2F1GA 2DCCA 2OZ2A 4PP1A 2CIOA 4YYVA 3H8BA 1DEUA 4G54A 1SP4B 3IOQA 2AUZA 4N4ZA 1QMYA 3HWNA 2NQGA 4BPVA 3KFQA 4C5PA 3V6CA 1AU3A 3IHPA 4DMXA 3MHSA 4W4UA 7PCKA 2PNSA 4PP2E 3F5VA 2DZZA 3PW3A 1TU6A 2DC9A 1GECE 3CBJA 2ATOA 1YK7A 2PBHA 1DF0A 5CVMA 4NV8A 5PADA 3LXSA 3OISA 2HHNA 1MDWA 1M6DA 1NQCA 4GUZA 2P86A 1HUCB 3I06A 1ME3A 1KHPA 1PPPA 1A6RA 2JQGR 1W6FA 4OELA 3DF0A 3PDFA 4ZUXU 1BQIA 4QBBA 5EGWA 4YV8A 1YT7A 4P6EA 1QOLA 3WXEA 5A24A 1TLOA 3IV2A 4KLBA 5K16A 4W5BA 1PPNA 1GX3A 4OEMA 3O1GA 1QXPA 1AU4A 4Q8HA 3CBKA 2OULA 3H6SA 4DMYA 1PBHA 2BDZA 4Q8GA 1Q6KA 2G8JA 1K3BB 3LTWA 2IBIA 3BPMA 4YYSA 2JQFR 1Y4HA 6PADA 2C0YA 3RVWA 3U8EA 2DJGB 2R9NA 1AYWA 2P0RA 2R9OA 1U9WA 3KWBX 1GLOA 1GMYA 3RVVA 2VFBA 1EWPA 1MEMA 1TL9A 1EWMA 3OF9A 1AECA 3HD3A 3P5VA 2OP3A 5CVOB 2E00A 4MZOA 4N8WA 4XR7A 1PADA 1O0EA 2GHUA 3MORA 2AS8A 1MS6A 3NHEA 2R9CA 3V6EA 2F7DA 2P7UA 3MHHA 2DC7A 4MSXA 3H8CA 3MTNA 4PI3A 3KSEA 4N79A 2XU5A 4FK5A 3IMAA 1THEA 3PBHA 4BS5A 3BPFA 1U5IA 2Y6EA 1KFUL 3BOWA 1Y08A 4QRXA 4B55A 2NQIA 2HD5A 3K8UA 3N3KA 1PXVA 3OVZA 3QSDA 1W4TA 4X6HA 1BGOA 2DJFB 1POPA 2AYNA 2PREA 2YJ2A 4W5CA 3BWKA 1ITOA 3GCBA 5CHTA 1CSBB 1CB5A 2PADA 4CDDB 1AU2A 1BP4A 3K24A 1AIMA 1YVBA 3KKUA 4WA6A 3OF8A 4I04A 4MZSA 1KFXL 4I05A 1CTEA 1QDQA 3TNXA 3LFYA 1AYUA 1VSNA 1PPDA 1CPJA 1ZIVA 4BS6A 4FIPA 3H89A 2G7YA 3P5WA 1NLJA 4BQVA 3B79A 3HHAA 1MHWA 2FYEA 3P5UA 3S3QA 2ACTA 1STFE 3BCNA 1SNKA 1CVZA 2E03A 2AIMA 4XUIA 4P6GA 1EWOA 3E1ZB 2R9MA 2AUXA 3ERVA 3S3RA 1W5RA 3P5XA 1U9QX 2BDLA 3N4CA 1PIPA 1PE6A 3QT4A 2DCBA 1CQDA 2VHSA 5FPWA 4YYRA 3I3TA 1ZCMA 2E02A 2FT2A 8PCHA 3WXGA 3H7DA 1ME4A 5CVNB 2GFOA 2FQ9A 2DCAA 1KXRA 5F02A 3BC3A 2IPPB 2AU1A 4YYQA 4QH6A 1YK8A 2AYOA 3PNRA 2XU1A 2DC8A 2FTDA 2Y5BA 5JA7A 4CDCB 1VJVA 1EWLA 1PCIA 1MEGA 1NL6A 1X9YA 1IWDA 4AXMA 5JH3A 2YJBA 3D9WA 2G8EA 4K7CA 2B1MA 3F75A 2VHFA 4NV7A 1ICFA 3HHIA 1F2BA 3IUTA 1E2TA 4HWYA 2FUDA 3WXFA 2NQAA 3K9MA 3RVXA 2VFCA 5EF4A 1EF7A 2O6XA 2FRAA 1NB5A 4QRGA 4CZWA 4X6JA 1CS8A 3N3GA 1JQPA 1MIRA 3AI8A 1KHQA 2YJCA 2AVWA 1U9XA 1AYVA 2CB5A 3C9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9F A;  1U9V A;  1NB3 A;  2G6D A;  2NQD B;  5CHV A;  5J94 A;  4CDE B;  1F2C A;  2DZY A;  2HXZ A;  3KX1 A;  3D6S A;  2XU4 A;  3CH3 X;  3KWZ A;  3QJ3 A;  4YVA A;  1FH0 A;  4I07 A;  2H7J A;  2WBF X;  4YYU A;  2FO5 A;  1GCB A;  4YYW A;  1NPZ A;  1AU0 A;  2HH5 A;  4BSQ A;  4RY2 A;  2ARY A;  1PPO A;  3KW9 A;  1CJL A;  3O0U A;  4PAD A;  3USV A;  2DC6 A;  1F29 A;  3OVX A;  2B1N A;  1F2A A;  2DCD A;  2R6N A;  1CV8 A;  4FJC A;  2YJ9 A;  2YJ8 A;  2FRQ A;  9PAP A;  4X6I A;  2E01 A;  3ZUA A;  4AXL A;  3IEJ A;  1ATK A;  4QRV A;  1BY8 A;  1YAL A;  1S4V A;  3M99 A;  3CH2 X;  2XU3 A;  4CDF B;  1XKG A;  2F1G A;  2DCC A;  2OZ2 A;  4PP1 A;  2CIO A;  4YYV A;  3H8B A;  1DEU A;  4G54 A;  1SP4 B;  3IOQ A;  2AUZ A;  4N4Z A;  1QMY A;  3HWN A;  2NQG A;  4BPV A;  3KFQ A;  3V6C A;  1AU3 A;  3IHP A;  4DMX A;  3MHS A;  4W4U A;  7PCK A;  2PNS A;  4PP2 E;  3F5V A;  2DZZ A;  3PW3 A;  1TU6 A;  2DC9 A;  1GEC E;  3CBJ A;  2ATO A;  1YK7 A;  2PBH A;  1DF0 A;  5CVM A;  5PAD A;  3LXS A;  3OIS A;  2HHN A;  1MDW A;  1M6D A;  1NQC A;  2P86 A;  1HUC B;  3I06 A;  1ME3 A;  1KHP A;  1PPP A;  1A6R A;  2JQG R;  4OEL A;  3DF0 A;  3PDF A;  4ZUX U;  1BQI A;  4QBB A;  5EGW A;  4YV8 A;  1YT7 A;  4P6E A;  1QOL A;  3WXE A;  5A24 A;  1TLO A;  3IV2 A;  4KLB A;  5K16 A;  4W5B A;  1PPN A;  4OEM A;  3O1G A;  1QXP A;  1AU4 A;  4Q8H A;  3CBK A;  2OUL A;  3H6S A;  4DMY A;  1PBH A;  2BDZ A;  4Q8G A;  1Q6K A;  2G8J A;  1K3B B;  2IBI A;  3BPM A;  4YYS A;  2JQF R;  1Y4H A;  6PAD A;  2C0Y A;  3RVW A;  3U8E A;  2DJG B;  2R9N A;  1AYW A;  2P0R A;  2R9O A;  1U9W A;  3KWB X;  1GLO A;  1GMY A;  3RVV A;  1EWP A;  1MEM A;  1TL9 A;  1EWM A;  3OF9 A;  1AEC A;  3HD3 A;  3P5V A;  2OP3 A;  5CVO B;  2E00 A;  4MZO A;  4N8W A;  4XR7 A;  1PAD A;  1O0E A;  2GHU A;  3MOR A;  2AS8 A;  1MS6 A;  3NHE A;  2R9C A;  3V6E A;  2F7D A;  2P7U A;  3MHH A;  2DC7 A;  4MSX A;  3H8C A;  3MTN A;  4PI3 A;  3KSE A;  4N79 A;  2XU5 A;  4FK5 A;  3IMA A;  1THE A;  3PBH A;  4BS5 A;  3BPF A;  1U5I A;  2Y6E A;  1KFU L;  3BOW A;  1Y08 A;  4QRX A;  2NQI A;  2HD5 A;  3K8U A;  3N3K A;  1PXV A;  3OVZ A;  3QSD A;  4X6H A;  1BGO A;  2DJF B;  1POP A;  2AYN A;  2PRE A;  2YJ2 A;  4W5C A;  3BWK A;  1ITO A;  3GCB A;  5CHT A;  1CSB B;  1CB5 A;  2PAD A;  4CDD B;  1AU2 A;  1BP4 A;  3K24 A;  1AIM A;  1YVB A;  3KKU A;  4WA6 A;  3OF8 A;  4I04 A;  4MZS A;  1KFX L;  4I05 A;  1CTE A;  1QDQ A;  3TNX A;  3LFY A;  1AYU A;  1VSN A;  1PPD A;  1CPJ A;  1ZIV A;  4BS6 A;  4FIP A;  3H89 A;  2G7Y A;  3P5W A;  1NLJ A;  4BQV A;  3B79 A;  3HHA A;  1MHW A;  2FYE A;  3P5U A;  3S3Q A;  2ACT A;  1STF E;  3BCN A;  1SNK A;  1CVZ A;  2E03 A;  2AIM A;  4XUI A;  4P6G A;  1EWO A;  3E1Z B;  2R9M A;  2AUX A;  3ERV A;  3S3R A;  3P5X A;  1U9Q X;  2BDL A;  3N4C A;  1PIP A;  1PE6 A;  3QT4 A;  2DCB A;  1CQD A;  2VHS A;  5FPW A;  4YYR A;  3I3T A;  1ZCM A;  2E02 A;  2FT2 A;  8PCH A;  3WXG A;  3H7D A;  1ME4 A;  5CVN B;  2GFO A;  2FQ9 A;  2DCA A;  1KXR A;  5F02 A;  3BC3 A;  2IPP B;  2AU1 A;  4YYQ A;  4QH6 A;  1YK8 A;  2AYO A;  3PNR A;  2XU1 A;  2DC8 A;  2FTD A;  2Y5B A;  5JA7 A;  4CDC B;  1VJV A;  1EWL A;  1PCI A;  1MEG A;  1NL6 A;  1X9Y A;  1IWD A;  4AXM A;  5JH3 A;  2YJB A;  2G8E A;  4K7C A;  2B1M A;  3F75 A;  2VHF A;  1ICF A;  3HHI A;  1F2B A;  3IUT A;  4HWY A;  2FUD A;  3WXF A;  2NQA A;  3K9M A;  3RVX A;  5EF4 A;  1EF7 A;  2O6X A;  2FRA A;  1NB5 A;  4QRG A;  4CZW A;  4X6J A;  1CS8 A;  3N3G A;  1JQP A;  1MIR A;  3AI8 A;  1KHQ A;  2YJC A;  2AVW A;  1U9X A;  1AYV A;  2CB5 A;  3C9E A; 
#chains in the Genus database with same CATH topology
 2R9F A;  1U9V A;  1NB3 A;  2G6D A;  2NQD B;  5CHV A;  5J94 A;  4CDE B;  1F2C A;  2DZY A;  2HXZ A;  3KX1 A;  3D6S A;  4M0W A;  2XU4 A;  3CH3 X;  3KWZ A;  3QJ3 A;  4YVA A;  4IP3 A;  1FH0 A;  4I07 A;  2H7J A;  2WBF X;  4OW0 A;  4YYU A;  2FO5 A;  1GCB A;  4YYW A;  1NPZ A;  1AU0 A;  2HH5 A;  3BB7 A;  4BSQ A;  4RY2 A;  2ARY A;  1PPO A;  3KW9 A;  1CJL A;  3O0U A;  4PAD A;  3USV A;  2DC6 A;  1F29 A;  2J7Q C;  3OVX A;  2B1N A;  1F2A A;  2DCD A;  2R6N A;  1CV8 A;  4FJC A;  2YJ9 A;  2YJ8 A;  2DOS A;  2FRQ A;  9PAP A;  4X6I A;  2E01 A;  3ZUA A;  4AXL A;  5E6J A;  3IEJ A;  1ATK A;  4QRV A;  1BY8 A;  1YAL A;  1S4V A;  3M99 A;  3CH2 X;  2XU3 A;  4CDF B;  4RF1 A;  1XKG A;  2F1G A;  2DCC A;  2OZ2 A;  4R3D A;  4PP1 A;  2CIO A;  2JRI A;  4YYV A;  3C0R A;  3H8B A;  1DEU A;  4G54 A;  1SP4 B;  3IOQ A;  2AUZ A;  4N4Z A;  1QMY A;  3HWN A;  2NQG A;  3BBA A;  3PRP A;  4BPV A;  1DKI A;  3KFQ A;  5KO3 A;  3V6C A;  1AU3 A;  3W30 A;  3IHP A;  4DMX A;  3MHS A;  1UKF A;  4W4U A;  7PCK A;  2PNS A;  4PP2 E;  3F5V A;  2DZZ A;  3PW3 A;  2HWK A;  1TU6 A;  2DC9 A;  1GEC E;  3CBJ A;  2ATO A;  1YK7 A;  2PBH A;  1DF0 A;  5CVM A;  5PAD A;  3LXS A;  3OIS A;  4OVZ A;  2HHN A;  1MDW A;  1M6D A;  1NQC A;  2P86 A;  1HUC B;  3I06 A;  3MP2 A;  1ME3 A;  2Z84 A;  1KHP A;  4XZX A;  4MI7 A;  1PPP A;  1A6R A;  2JQG R;  4OEL A;  3DF0 A;  3PDF A;  4ZUX U;  1BQI A;  4QBB A;  5EGW A;  4YV8 A;  1YT7 A;  4P6E A;  1QOL A;  3WXE A;  5A24 A;  1TLO A;  3IV2 A;  4KLB A;  5K16 A;  4W5B A;  1PPN A;  4OEM A;  4P16 A;  3O1G A;  1QXP A;  1AU4 A;  3PRM A;  4D8B A;  4Q8H A;  3BY4 A;  2OUL A;  3CBK A;  3H6S A;  4DMY A;  3W31 A;  1PBH A;  2BDZ A;  4Q8G A;  1Q6K A;  2G8J A;  1K3B B;  2IBI A;  3BPM A;  4YYS A;  2JQF R;  1Y4H A;  4BOU A;  6PAD A;  2C0Y A;  3RVW A;  3U8E A;  2DJG B;  2R9N A;  1AYW A;  2P0R A;  2R9O A;  2FE8 A;  3E9S A;  1U9W A;  3KWB X;  1GLO A;  1GMY A;  3RVV A;  4D8I A;  1EWP A;  1MEM A;  1TL9 A;  1EWM A;  3OF9 A;  1AEC A;  3HD3 A;  4BOQ A;  3P5V A;  2OP3 A;  4REZ A;  5CVO B;  2E00 A;  4MZO A;  4N8W A;  4BOS A;  4XR7 A;  1PAD A;  1O0E A;  2GHU A;  3MOR A;  2AS8 A;  1MS6 A;  3NHE A;  2R9C A;  3V6E A;  2F7D A;  2P7U A;  3MHH A;  2DC7 A;  4MSX A;  3TRK A;  3H8C A;  3MTN A;  4PI3 A;  3KSE A;  4N79 A;  3PSE A;  2UZJ A;  2XU5 A;  4FK5 A;  3IMA A;  1THE A;  3PBH A;  4BS5 A;  3BPF A;  1U5I A;  4RNA A;  4ZTB A;  2Y6E A;  1KFU L;  3BOW A;  4OVZ B;  1Y08 A;  4QRX A;  4RF0 A;  4A5U A;  2NQI A;  2HD5 A;  3K8U A;  3N3K A;  3O65 A;  1PXV A;  3OVZ A;  4RKX A;  3TMP A;  3QSD A;  4X6H A;  1BGO A;  2DJF B;  1POP A;  2AYN A;  5EZQ A;  2PRE A;  2YJ2 A;  4W5C A;  2JTC A;  3BWK A;  1ITO A;  3GCB A;  5CHT A;  1CSB B;  1CB5 A;  2PAD A;  5EZS A;  4CDD B;  1AU2 A;  1BP4 A;  2BU3 A;  3K24 A;  1AIM A;  2BTW A;  1YVB A;  3B21 A;  3KKU A;  3PHX A;  4WA6 A;  4BOZ A;  3OF8 A;  4WUR A;  4HXD B;  4I04 A;  4MM3 B;  4MZS A;  1KFX L;  4I05 A;  1CTE A;  1QDQ A;  3TNX A;  2J7Q A;  3LFY A;  1AYU A;  1VSN A;  1PPD A;  1CPJ A;  1ZIV A;  4BS6 A;  4FIP A;  3H89 A;  2G7Y A;  3P5W A;  1NLJ A;  4IUM A;  4BQV A;  3B79 A;  3HHA A;  1MHW A;  2FYE A;  3P5U A;  3S3Q A;  2ACT A;  1STF E;  3BCN A;  3IFU A;  1SNK A;  1CVZ A;  2E03 A;  2AIM A;  3PHU A;  4XUI A;  3MTV A;  4P6G A;  1EWO A;  3E1Z B;  3RNV A;  2R9M A;  2AUX A;  3ERV A;  3S3R A;  3P5X A;  1U9Q X;  2BDL A;  3N4C A;  1PIP A;  1PE6 A;  3QT4 A;  2DCB A;  1CQD A;  2VHS A;  5FPW A;  4YYR A;  3I3T A;  1ZCM A;  2E02 A;  2FT2 A;  4PT5 A;  8PCH A;  3WXG A;  3H7D A;  1ME4 A;  5CVN B;  4GUA A;  2GFO A;  2FQ9 A;  2DCA A;  1KXR A;  5F02 A;  3BC3 A;  2IPP B;  2AU1 A;  4YYQ A;  4QH6 A;  1YK8 A;  2AYO A;  3PNR A;  4D8E A;  2XU1 A;  2DC8 A;  2FTD A;  2Y5B A;  5JA7 A;  5JZE A;  4CDC B;  1VJV A;  1YZB A;  1EWL A;  1PCI A;  1MEG A;  1NL6 A;  1X9Y A;  1IWD A;  4AXM A;  5JH3 A;  4BOP A;  2YJB A;  2BTW B;  2G8E A;  4K7C A;  2B1M A;  3PHW A;  3MJ5 A;  3F75 A;  2VHF A;  1ICF A;  3HHI A;  1F2B A;  3IUT A;  4HWY A;  2FUD A;  3PT2 A;  3WXF A;  1PVJ A;  2NQA A;  3K9M A;  3RVX A;  5EF4 A;  1EF7 A;  2O6X A;  3OQC A;  2FRA A;  1NB5 A;  3ZNH A;  4QRG A;  4CZW A;  4X6J A;  1CS8 A;  3N3G A;  1JQP A;  1MIR A;  3AI8 A;  2AGA A;  1KHQ A;  2YJC A;  2AVW A;  1U9X A;  1AYV A;  2CB5 A;  3C9E A; 
#chains in the Genus database with same CATH homology
 2R9F A;  1U9V A;  1NB3 A;  2G6D A;  2NQD B;  5CHV A;  5J94 A;  4CDE B;  1F2C A;  2DZY A;  2HXZ A;  3KX1 A;  3D6S A;  2XU4 A;  3CH3 X;  3KWZ A;  3QJ3 A;  4YVA A;  1FH0 A;  4I07 A;  2H7J A;  2WBF X;  4YYU A;  2FO5 A;  1GCB A;  4YYW A;  1NPZ A;  1AU0 A;  4BGF A;  2HH5 A;  4BSQ A;  4RY2 A;  2ARY A;  1PPO A;  3KW9 A;  1CJL A;  3O0U A;  4PAD A;  3USV A;  2BSZ A;  2DC6 A;  1F29 A;  3OVX A;  2B1N A;  1F2A A;  2DCD A;  2R6N A;  1CV8 A;  4FJC A;  2YJ9 A;  2YJ8 A;  2FRQ A;  9PAP A;  4X6I A;  2E01 A;  3ZUA A;  4AXL A;  3IEJ A;  1ATK A;  4QRV A;  1BY8 A;  1YAL A;  1S4V A;  3M99 A;  3CH2 X;  2XU3 A;  4CDF B;  1XKG A;  2F1G A;  2DCC A;  2OZ2 A;  4PP1 A;  2CIO A;  4YYV A;  3H8B A;  1DEU A;  4G54 A;  1SP4 B;  3IOQ A;  2AUZ A;  4N4Z A;  1QMY A;  3HWN A;  2NQG A;  4BPV A;  3KFQ A;  4C5P A;  3V6C A;  1AU3 A;  3IHP A;  4DMX A;  3MHS A;  4W4U A;  7PCK A;  2PNS A;  4PP2 E;  3F5V A;  2DZZ A;  3PW3 A;  1TU6 A;  2DC9 A;  1GEC E;  3CBJ A;  2ATO A;  1YK7 A;  2PBH A;  1DF0 A;  5CVM A;  4NV8 A;  5PAD A;  3LXS A;  3OIS A;  2HHN A;  1MDW A;  1M6D A;  1NQC A;  4GUZ A;  2P86 A;  1HUC B;  3I06 A;  1ME3 A;  1KHP A;  1PPP A;  1A6R A;  2JQG R;  1W6F A;  4OEL A;  3DF0 A;  3PDF A;  4ZUX U;  1BQI A;  4QBB A;  5EGW A;  4YV8 A;  1YT7 A;  4P6E A;  1QOL A;  3WXE A;  5A24 A;  1TLO A;  3IV2 A;  4KLB A;  5K16 A;  4W5B A;  1PPN A;  1GX3 A;  4OEM A;  3O1G A;  1QXP A;  1AU4 A;  4Q8H A;  3CBK A;  2OUL A;  3H6S A;  4DMY A;  1PBH A;  2BDZ A;  4Q8G A;  1Q6K A;  2G8J A;  1K3B B;  3LTW A;  2IBI A;  3BPM A;  4YYS A;  2JQF R;  1Y4H A;  6PAD A;  2C0Y A;  3RVW A;  3U8E A;  2DJG B;  2R9N A;  1AYW A;  2P0R A;  2R9O A;  1U9W A;  3KWB X;  1GLO A;  1GMY A;  3RVV A;  2VFB A;  1EWP A;  1MEM A;  1TL9 A;  1EWM A;  3OF9 A;  1AEC A;  3HD3 A;  3P5V A;  2OP3 A;  5CVO B;  2E00 A;  4MZO A;  4N8W A;  4XR7 A;  1PAD A;  1O0E A;  2GHU A;  3MOR A;  2AS8 A;  1MS6 A;  3NHE A;  2R9C A;  3V6E A;  2F7D A;  2P7U A;  3MHH A;  2DC7 A;  4MSX A;  3H8C A;  3MTN A;  4PI3 A;  3KSE A;  4N79 A;  2XU5 A;  4FK5 A;  3IMA A;  1THE A;  3PBH A;  4BS5 A;  3BPF A;  1U5I A;  2Y6E A;  1KFU L;  3BOW A;  1Y08 A;  4QRX A;  4B55 A;  2NQI A;  2HD5 A;  3K8U A;  3N3K A;  1PXV A;  3OVZ A;  3QSD A;  1W4T A;  4X6H A;  1BGO A;  2DJF B;  1POP A;  2AYN A;  2PRE A;  2YJ2 A;  4W5C A;  3BWK A;  1ITO A;  3GCB A;  5CHT A;  1CSB B;  1CB5 A;  2PAD A;  4CDD B;  1AU2 A;  1BP4 A;  3K24 A;  1AIM A;  1YVB A;  3KKU A;  4WA6 A;  3OF8 A;  4I04 A;  4MZS A;  1KFX L;  4I05 A;  1CTE A;  1QDQ A;  3TNX A;  3LFY A;  1AYU A;  1VSN A;  1PPD A;  1CPJ A;  1ZIV A;  4BS6 A;  4FIP A;  3H89 A;  2G7Y A;  3P5W A;  1NLJ A;  4BQV A;  3B79 A;  3HHA A;  1MHW A;  2FYE A;  3P5U A;  3S3Q A;  2ACT A;  1STF E;  3BCN A;  1SNK A;  1CVZ A;  2E03 A;  2AIM A;  4XUI A;  4P6G A;  1EWO A;  3E1Z B;  2R9M A;  2AUX A;  3ERV A;  3S3R A;  1W5R A;  3P5X A;  1U9Q X;  2BDL A;  3N4C A;  1PIP A;  1PE6 A;  3QT4 A;  2DCB A;  1CQD A;  2VHS A;  5FPW A;  4YYR A;  3I3T A;  1ZCM A;  2E02 A;  2FT2 A;  8PCH A;  3WXG A;  3H7D A;  1ME4 A;  5CVN B;  2GFO A;  2FQ9 A;  2DCA A;  1KXR A;  5F02 A;  3BC3 A;  2IPP B;  2AU1 A;  4YYQ A;  4QH6 A;  1YK8 A;  2AYO A;  3PNR A;  2XU1 A;  2DC8 A;  2FTD A;  2Y5B A;  5JA7 A;  4CDC B;  1VJV A;  1EWL A;  1PCI A;  1MEG A;  1NL6 A;  1X9Y A;  1IWD A;  4AXM A;  5JH3 A;  2YJB A;  3D9W A;  2G8E A;  4K7C A;  2B1M A;  3F75 A;  2VHF A;  4NV7 A;  1ICF A;  3HHI A;  1F2B A;  3IUT A;  1E2T A;  4HWY A;  2FUD A;  3WXF A;  2NQA A;  3K9M A;  3RVX A;  2VFC A;  5EF4 A;  1EF7 A;  2O6X A;  2FRA A;  1NB5 A;  4QRG A;  4CZW A;  4X6J A;  1CS8 A;  3N3G A;  1JQP A;  1MIR A;  3AI8 A;  1KHQ A;  2YJC A;  2AVW A;  1U9X A;  1AYV A;  2CB5 A;  3C9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...