2ARYA

Catalytic domain of human calpain-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
322
structure length
322
Chain Sequence
NAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Human Calpains 1 and 9 Imply Diverse Mechanisms of Action and Auto-inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Calpain-1 catalytic subunit
total genus 89
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 3.4.22.52: Calpain-1.
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00648 Peptidase_C2 Calpain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aryA02
1KFXL 3P5XA 1GMYA 1JQPA 2YJCA 3LXSA 1NL6A 4X6HA 4N79A 3OF9A 4WA6A 5CVOB 5K16A 2AUZA 6PADA 3I3TA 2HHNA 4PP2E 4MZSA 3LFYA 1QDQA 2AVWA 2YJ2A 3HHIA 1KXRA 1F2BA 1AYUA 2PNSA 2NQIA 1U9XA 2DC9A 3WXEA 2AYOA 4BQVA 4PI3A 4X6IA 3GCBA 4FK5A 3B79A 2AIMA 2H7JA 2B1NA 1GLOA 1PPNA 4CDEB 1VJVA 1Y08A 3O0UA 1EF7A 1HUCB 2O6XA 4G54A 1ME3A 4I04A 4PADA 2DC7A 2NQGA 4PP1A 2XU1A 1TLOA 3K8UA 4MZOA 2E03A 4N8WA 2R9MA 5FPWA 4CDDB 2HXZA 1F2CA 2E02A 1YALA 1AYWA 3K9MA 3WXGA 2HH5A 1ICFA 1STFE 1CQDA 4YYRA 3S3QA 1BP4A 3RVWA 3IMAA 3IV2A 1U9QX 4W5CA 1SNKA 1TL9A 3C9EA 1PCIA 3BCNA 1MEGA 1YT7A 3PDFA 1CB5A 9PAPA 3F5VA 3OVXA 1NQCA 3MHHA 1PPDA 4MSXA 2ACTA 1NB5A 1PADA 2IPPB 1CTEA 3USVA 5JA7A 3PBHA 1F2AA 3RVXA 3KW9A 8PCHA 2AS8A 5F02A 3IUTA 2R9NA 1EWLA 2AYNA 1O0EA 4BS6A 5EF4A 1QXPA 1M6DA 1MDWA 1Q6KA 2FO5A 3NHEA 1SP4B 5J94A 2FT2A 2P86A 1QOLA 3M99A 1VSNA 1AU3A 4YYSA 3V6CA 2DCDA 1EWOA 1CS8A 3N3GA 2XU3A 1ME4A 2NQAA 2DCCA 1YVBA 2IBIA 2DZZA 2PBHA 1EWPA 4BS5A 3H7DA 3OF8A 2VHFA 4YYUA 1PBHA 1PPOA 1BY8A 3D6SA 4YYVA 1KFUL 1MS6A 3KSEA 3O1GA 3H8BA 2JQFR 1DF0A 2R9OA 4BSQA 1ZIVA 2CB5A 4FJCA 5A24A 3RVVA 1TU6A 4RY2A 1MHWA 5CHTA 5JH3A 4Q8GA 3S3RA 2G6DA 2DCAA 2FQ9A 3H6SA 2FTDA 4W5BA 1AU4A 4K7CA 2G8EA 1BQIA 4X6JA 4OEMA 2AU1A 4I07A 3P5VA 3IHPA 4N4ZA 1PIPA 2Y6EA 2OZ2A 3BWKA 2DJGB 2NQDB 1EWMA 2DCBA 4YVAA 2P7UA 4QBBA 1KHPA 3H8CA 3AI8A 1A6RA 2GHUA 4YYWA 4Q8HA 3KWBX 3P5UA 2YJBA 2OP3A 4XUIA 1AU0A 1S4VA 2BDZA 3KWZA 1NB3A 3CBKA 1XKGA 3OISA 4YV8A 3BPMA 3IEJA 1ATKA 3HD3A 3BPFA 2YJ9A 1KHQA 1F29A 4QH6A 2FRAA 3ZUAA 3QSDA 4XR7A 3CH2X 4P6EA 1ZCMA 3U8EA 7PCKA 1CPJA 2G7YA 1U9VA 2XU5A 1IWDA 2FUDA 2FYEA 3P5WA 4KLBA 4DMXA 2B1MA 3QJ3A 2HD5A 3KFQA 2F7DA 3N3KA 4I05A 4QRGA 1CJLA 3PW3A 5PADA 4QRXA 3ERVA 2DJFB 1BGOA 3N4CA 4P6GA 1CSBB 1YK7A 2BDLA 1CVZA 3HWNA 3PNRA 2R9FA 1K3BB 4QRVA 3E1ZB 2JQGR 1ITOA 4CDFB 4YYQA 2G8JA 2E00A 1U9WA 3KKUA 2YJ8A 2R9CA 3H89A 1MIRA 2R6NA 3OVZA 3TNXA 4CDCB 4HWYA 2AUXA 1FH0A 1X9YA 2OULA 2P0RA 2GFOA 1AECA 2PREA 1PE6A 1PXVA 3DF0A 3HHAA 1GCBA 3BOWA 3MHSA 2FRQA 1NLJA 5CVNB 2XU4A 4DMYA 3V6EA 1MEMA 3CBJA 2C0YA 3K24A 3IOQA 3I06A 5CHVA 1GECE 1DEUA 4BPVA 3CH3X 1YK8A 1AU2A 1THEA 4ZUXU 1NPZA 3BC3A 2DZYA 4AXMA 3QT4A 2Y5BA 2WBFX 2ARYA 3WXFA 4CZWA 1CV8A 2E01A 2VHSA 4FIPA 1AIMA 2ATOA 2PADA 3MTNA 1PPPA 1POPA 1U5IA 4AXLA 4W4UA 3F75A 3KX1A 1Y4HA 4OELA 2DC6A 5EGWA 2CIOA 2F1GA 3MORA 1QMYA 1AYVA 2DC8A 5CVMA
chains in the Genus database with same CATH superfamily
1KFXL 3P5XA 1GMYA 1JQPA 2YJCA 3LXSA 1NL6A 4X6HA 4RKXA 4N79A 1UKFA 3OF9A 4WA6A 3PRPA 4RF0A 5CVOB 3MP2A 2J7QA 5K16A 2BTWA 2AUZA 4MM3B 6PADA 3IFUA 3I3TA 2HHNA 4RNAA 4PP2E 4MZSA 3LFYA 1QDQA 2AVWA 2YJ2A 4RF1A 3HHIA 1KXRA 1F2BA 1AYUA 3BB7A 2PNSA 2NQIA 1U9XA 2DC9A 3WXEA 2AYOA 4BQVA 4PI3A 4X6IA 4FK5A 2DOSA 3GCBA 3B79A 2AIMA 2H7JA 3TRKA 2B1NA 1GLOA 4BOSA 1PPNA 3PHXA 4CDEB 1VJVA 1Y08A 4IUMA 3O0UA 3MJ5A 1EF7A 1HUCB 4ZTBA 2O6XA 4G54A 1ME3A 4I04A 4PADA 2DC7A 2NQGA 4PP1A 2XU1A 1TLOA 3K8UA 4MZOA 4REZA 2E03A 4N8WA 2R9MA 2J7QC 5FPWA 4CDDB 2HXZA 1F2CA 2E02A 1YALA 2AGAA 1AYWA 3K9MA 3WXGA 2HH5A 1ICFA 1STFE 1CQDA 4YYRA 3S3QA 4BOPA 1BP4A 3RVWA 3IMAA 3IV2A 1U9QX 4W5CA 1SNKA 1TL9A 2FE8A 3C9EA 1PCIA 3BCNA 1MEGA 1YT7A 3PDFA 1CB5A 9PAPA 3F5VA 3OVXA 1NQCA 3MHHA 1PPDA 4MSXA 2ACTA 1NB5A 1PADA 2IPPB 1CTEA 3BBAA 3USVA 5JA7A 3PBHA 5EZQA 1F2AA 3RVXA 3KW9A 3PSEA 4HXDB 8PCHA 2AS8A 5F02A 3IUTA 2R9NA 4WURA 1EWLA 2AYNA 4IP3A 1O0EA 4BS6A 5EF4A 1QXPA 1M6DA 1MDWA 1Q6KA 2FO5A 3NHEA 4XZXA 1SP4B 5J94A 2FT2A 2P86A 1QOLA 3M99A 1VSNA 1AU3A 3E9SA 4YYSA 3V6CA 2DCDA 1EWOA 1CS8A 3N3GA 2XU3A 3PRMA 1ME4A 2NQAA 2DCCA 3TMPA 1YVBA 2IBIA 2DZZA 2PBHA 1EWPA 4BS5A 3H7DA 3OF8A 2VHFA 4YYUA 1PBHA 1PPOA 1BY8A 3B21A 3D6SA 4YYVA 3PHUA 1KFUL 1MS6A 3KSEA 4PT5A 3O1GA 2JTCA 3H8BA 2JQFR 1DF0A 2R9OA 4OVZB 4BSQA 1ZIVA 2CB5A 4FJCA 5A24A 3RVVA 1TU6A 1YZBA 4RY2A 1MHWA 5CHTA 4OVZA 5JH3A 4Q8GA 3S3RA 2G6DA 3ZNHA 2DCAA 2FQ9A 3H6SA 2FTDA 4W5BA 1AU4A 4K7CA 2G8EA 1BQIA 4X6JA 2BTWB 4OEMA 2AU1A 4I07A 3P5VA 3IHPA 4N4ZA 3C0RA 1PIPA 2Y6EA 2OZ2A 3BWKA 2DJGB 2NQDB 1EWMA 2DCBA 4YVAA 2P7UA 4QBBA 1KHPA 3H8CA 3AI8A 5E6JA 2Z84A 1A6RA 5JZEA 2GHUA 4YYWA 4Q8HA 3KWBX 3P5UA 3PHWA 2YJBA 2OP3A 4XUIA 1AU0A 1S4VA 2BDZA 3KWZA 3W31A 1NB3A 3CBKA 1XKGA 3BY4A 3OISA 4YV8A 3BPMA 5KO3A 3IEJA 1ATKA 3HD3A 3BPFA 2YJ9A 3OQCA 1KHQA 1F29A 4QH6A 2FRAA 3ZUAA 3QSDA 4XR7A 3CH2X 1PVJA 4BOQA 4P6EA 1ZCMA 3U8EA 7PCKA 1CPJA 2G7YA 1U9VA 2XU5A 1IWDA 2FUDA 2FYEA 3P5WA 4KLBA 4DMXA 4MI7A 2B1MA 3QJ3A 2HD5A 2HWKA 3KFQA 2F7DA 3N3KA 4I05A 4QRGA 4M0WA 4OW0A 1CJLA 3PW3A 5PADA 4QRXA 3ERVA 2DJFB 1BGOA 3N4CA 4P6GA 4R3DA 1CSBB 1YK7A 3PT2A 2BDLA 1CVZA 3HWNA 3PNRA 2R9FA 1K3BB 4QRVA 3E1ZB 2JQGR 4GUAA 1ITOA 4CDFB 4YYQA 2G8JA 2E00A 1U9WA 3KKUA 2YJ8A 2R9CA 3H89A 1MIRA 2R6NA 3OVZA 3TNXA 4CDCB 3W30A 4HWYA 2AUXA 1FH0A 1X9YA 2OULA 2P0RA 2GFOA 1AECA 2PREA 4D8IA 1PE6A 1PXVA 3DF0A 3HHAA 1GCBA 3BOWA 3MHSA 2FRQA 2BU3A 2JRIA 1NLJA 5CVNB 1DKIA 4P16A 2XU4A 4DMYA 3V6EA 1MEMA 4A5UA 3CBJA 2C0YA 3K24A 3IOQA 3I06A 3RNVA 5CHVA 3MTVA 1GECE 1DEUA 4BPVA 3CH3X 1YK8A 1AU2A 1THEA 4ZUXU 1NPZA 3BC3A 2DZYA 4BOUA 4AXMA 2UZJA 3QT4A 2Y5BA 2WBFX 2ARYA 3WXFA 4CZWA 1CV8A 2E01A 4D8BA 2VHSA 4FIPA 1AIMA 2ATOA 2PADA 3MTNA 1PPPA 4BOZA 1POPA 1U5IA 4AXLA 4W4UA 3F75A 3KX1A 1Y4HA 4OELA 2DC6A 5EGWA 5EZSA 2CIOA 2F1GA 3MORA 4D8EA 1QMYA 1AYVA 2DC8A 5CVMA 3O65A
chains in the Genus database with same CATH topology
1KFXL 3P5XA 1GMYA 1JQPA 2YJCA 3LXSA 1NL6A 4X6HA 4N79A 3OF9A 4WA6A 5CVOB 5K16A 2AUZA 4BGFA 6PADA 3I3TA 2HHNA 4PP2E 4MZSA 3LFYA 1QDQA 2AVWA 2YJ2A 3HHIA 1KXRA 3D9WA 1F2BA 1AYUA 2PNSA 2NQIA 1U9XA 2DC9A 3WXEA 2AYOA 4BQVA 4PI3A 4X6IA 3GCBA 4FK5A 3B79A 2AIMA 2H7JA 1GX3A 2B1NA 1GLOA 1PPNA 4CDEB 1VJVA 1Y08A 3O0UA 1EF7A 1HUCB 2O6XA 4G54A 1ME3A 4I04A 4PADA 2DC7A 2NQGA 4PP1A 2XU1A 1W4TA 1TLOA 3K8UA 4MZOA 2E03A 4N8WA 2R9MA 5FPWA 4GUZA 4CDDB 2HXZA 1F2CA 2E02A 1YALA 1AYWA 3K9MA 3WXGA 2HH5A 1ICFA 1STFE 1CQDA 4YYRA 3S3QA 1BP4A 3RVWA 3IMAA 3IV2A 4C5PA 1U9QX 4W5CA 1SNKA 1TL9A 3C9EA 1PCIA 3BCNA 1MEGA 1YT7A 3PDFA 1CB5A 9PAPA 3F5VA 3OVXA 1NQCA 3MHHA 1PPDA 4MSXA 2ACTA 1NB5A 1PADA 2IPPB 1CTEA 3USVA 5JA7A 3PBHA 1F2AA 3RVXA 3KW9A 8PCHA 2AS8A 5F02A 3IUTA 2R9NA 1EWLA 2AYNA 1O0EA 4BS6A 5EF4A 1QXPA 1M6DA 1MDWA 1Q6KA 2FO5A 3NHEA 1SP4B 5J94A 2FT2A 2P86A 1QOLA 3M99A 1VSNA 1AU3A 4YYSA 3V6CA 2DCDA 1EWOA 1CS8A 3N3GA 2XU3A 1ME4A 2NQAA 2DCCA 1YVBA 2IBIA 2DZZA 2PBHA 1EWPA 4BS5A 3H7DA 3OF8A 2VHFA 4YYUA 1PBHA 1PPOA 1BY8A 3D6SA 4YYVA 2VFBA 1KFUL 1MS6A 3KSEA 3O1GA 3H8BA 2JQFR 1DF0A 2R9OA 4BSQA 1ZIVA 2CB5A 4FJCA 5A24A 3RVVA 1TU6A 4RY2A 1MHWA 5CHTA 5JH3A 4Q8GA 3S3RA 2G6DA 2DCAA 2FQ9A 3H6SA 2VFCA 2FTDA 4W5BA 1AU4A 3LTWA 4K7CA 2G8EA 1BQIA 4X6JA 4OEMA 2AU1A 4I07A 3P5VA 3IHPA 4N4ZA 1PIPA 2Y6EA 2OZ2A 3BWKA 2DJGB 1W5RA 2NQDB 1EWMA 2DCBA 4YVAA 2P7UA 4QBBA 1KHPA 3H8CA 3AI8A 1A6RA 2GHUA 4YYWA 4Q8HA 3KWBX 3P5UA 2YJBA 2OP3A 4XUIA 1AU0A 1S4VA 2BDZA 3KWZA 1NB3A 3CBKA 1XKGA 3OISA 4YV8A 3BPMA 3IEJA 1ATKA 3HD3A 3BPFA 4NV7A 2YJ9A 1KHQA 1F29A 4QH6A 2FRAA 3ZUAA 3QSDA 4XR7A 3CH2X 4P6EA 1ZCMA 3U8EA 7PCKA 1CPJA 2G7YA 1U9VA 2XU5A 1IWDA 2FUDA 2FYEA 3P5WA 4KLBA 4DMXA 2B1MA 3QJ3A 2HD5A 3KFQA 2F7DA 3N3KA 4I05A 4QRGA 1W6FA 1CJLA 3PW3A 5PADA 4QRXA 3ERVA 2DJFB 1BGOA 3N4CA 4P6GA 1CSBB 1YK7A 2BSZA 2BDLA 1CVZA 3HWNA 3PNRA 2R9FA 1K3BB 4QRVA 3E1ZB 2JQGR 1ITOA 4CDFB 4YYQA 2G8JA 2E00A 1U9WA 3KKUA 2YJ8A 2R9CA 3H89A 1MIRA 2R6NA 3OVZA 3TNXA 4CDCB 4HWYA 2AUXA 1FH0A 1X9YA 2OULA 2P0RA 2GFOA 1AECA 2PREA 1PE6A 1PXVA 3DF0A 3HHAA 1GCBA 3BOWA 3MHSA 2FRQA 1NLJA 5CVNB 2XU4A 4DMYA 3V6EA 1MEMA 3CBJA 2C0YA 3K24A 3IOQA 4B55A 3I06A 5CHVA 1GECE 1DEUA 4BPVA 3CH3X 1YK8A 1AU2A 1THEA 4ZUXU 1NPZA 3BC3A 2DZYA 4AXMA 3QT4A 2Y5BA 2WBFX 2ARYA 3WXFA 4CZWA 1CV8A 2E01A 2VHSA 4FIPA 4NV8A 1AIMA 2ATOA 2PADA 3MTNA 1PPPA 1POPA 1U5IA 1E2TA 4AXLA 4W4UA 3F75A 3KX1A 1Y4HA 4OELA 2DC6A 5EGWA 2CIOA 2F1GA 3MORA 1QMYA 1AYVA 2DC8A 5CVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFX L;  3P5X A;  1GMY A;  1JQP A;  2YJC A;  3LXS A;  1NL6 A;  4X6H A;  4N79 A;  3OF9 A;  4WA6 A;  5CVO B;  5K16 A;  2AUZ A;  6PAD A;  3I3T A;  2HHN A;  4PP2 E;  4MZS A;  3LFY A;  1QDQ A;  2AVW A;  2YJ2 A;  3HHI A;  1KXR A;  1F2B A;  1AYU A;  2PNS A;  2NQI A;  1U9X A;  2DC9 A;  3WXE A;  2AYO A;  4BQV A;  4PI3 A;  4X6I A;  3GCB A;  4FK5 A;  3B79 A;  2AIM A;  2H7J A;  2B1N A;  1GLO A;  1PPN A;  4CDE B;  1VJV A;  1Y08 A;  3O0U A;  1EF7 A;  1HUC B;  2O6X A;  4G54 A;  1ME3 A;  4I04 A;  4PAD A;  2DC7 A;  2NQG A;  4PP1 A;  2XU1 A;  1TLO A;  3K8U A;  4MZO A;  2E03 A;  4N8W A;  2R9M A;  5FPW A;  4CDD B;  2HXZ A;  1F2C A;  2E02 A;  1YAL A;  1AYW A;  3K9M A;  3WXG A;  2HH5 A;  1ICF A;  1STF E;  1CQD A;  4YYR A;  3S3Q A;  1BP4 A;  3RVW A;  3IMA A;  3IV2 A;  1U9Q X;  4W5C A;  1SNK A;  1TL9 A;  3C9E A;  1PCI A;  3BCN A;  1MEG A;  1YT7 A;  3PDF A;  1CB5 A;  9PAP A;  3F5V A;  3OVX A;  1NQC A;  3MHH A;  1PPD A;  4MSX A;  2ACT A;  1NB5 A;  1PAD A;  2IPP B;  1CTE A;  3USV A;  5JA7 A;  3PBH A;  1F2A A;  3RVX A;  3KW9 A;  8PCH A;  2AS8 A;  5F02 A;  3IUT A;  2R9N A;  1EWL A;  2AYN A;  1O0E A;  4BS6 A;  5EF4 A;  1QXP A;  1M6D A;  1MDW A;  1Q6K A;  2FO5 A;  3NHE A;  1SP4 B;  5J94 A;  2FT2 A;  2P86 A;  1QOL A;  3M99 A;  1VSN A;  1AU3 A;  4YYS A;  3V6C A;  2DCD A;  1EWO A;  1CS8 A;  3N3G A;  2XU3 A;  1ME4 A;  2NQA A;  2DCC A;  1YVB A;  2IBI A;  2DZZ A;  2PBH A;  1EWP A;  4BS5 A;  3H7D A;  3OF8 A;  2VHF A;  4YYU A;  1PBH A;  1PPO A;  1BY8 A;  3D6S A;  4YYV A;  1KFU L;  1MS6 A;  3KSE A;  3O1G A;  3H8B A;  2JQF R;  1DF0 A;  2R9O A;  4BSQ A;  1ZIV A;  2CB5 A;  4FJC A;  5A24 A;  3RVV A;  1TU6 A;  4RY2 A;  1MHW A;  5CHT A;  5JH3 A;  4Q8G A;  3S3R A;  2G6D A;  2DCA A;  2FQ9 A;  3H6S A;  2FTD A;  4W5B A;  1AU4 A;  4K7C A;  2G8E A;  1BQI A;  4X6J A;  4OEM A;  2AU1 A;  4I07 A;  3P5V A;  3IHP A;  4N4Z A;  1PIP A;  2Y6E A;  2OZ2 A;  3BWK A;  2DJG B;  2NQD B;  1EWM A;  2DCB A;  4YVA A;  2P7U A;  4QBB A;  1KHP A;  3H8C A;  3AI8 A;  1A6R A;  2GHU A;  4YYW A;  4Q8H A;  3KWB X;  3P5U A;  2YJB A;  2OP3 A;  4XUI A;  1AU0 A;  1S4V A;  2BDZ A;  3KWZ A;  1NB3 A;  3CBK A;  1XKG A;  3OIS A;  4YV8 A;  3BPM A;  3IEJ A;  1ATK A;  3HD3 A;  3BPF A;  2YJ9 A;  1KHQ A;  1F29 A;  4QH6 A;  2FRA A;  3ZUA A;  3QSD A;  4XR7 A;  3CH2 X;  4P6E A;  1ZCM A;  3U8E A;  7PCK A;  1CPJ A;  2G7Y A;  1U9V A;  2XU5 A;  1IWD A;  2FUD A;  2FYE A;  3P5W A;  4KLB A;  4DMX A;  2B1M A;  3QJ3 A;  2HD5 A;  3KFQ A;  2F7D A;  3N3K A;  4I05 A;  4QRG A;  1CJL A;  3PW3 A;  5PAD A;  4QRX A;  3ERV A;  2DJF B;  1BGO A;  3N4C A;  4P6G A;  1CSB B;  1YK7 A;  2BDL A;  1CVZ A;  3HWN A;  3PNR A;  2R9F A;  1K3B B;  4QRV A;  3E1Z B;  2JQG R;  1ITO A;  4CDF B;  4YYQ A;  2G8J A;  2E00 A;  1U9W A;  3KKU A;  2YJ8 A;  2R9C A;  3H89 A;  1MIR A;  2R6N A;  3OVZ A;  3TNX A;  4CDC B;  4HWY A;  2AUX A;  1FH0 A;  1X9Y A;  2OUL A;  2P0R A;  2GFO A;  1AEC A;  2PRE A;  1PE6 A;  1PXV A;  3DF0 A;  3HHA A;  1GCB A;  3BOW A;  3MHS A;  2FRQ A;  1NLJ A;  5CVN B;  2XU4 A;  4DMY A;  3V6E A;  1MEM A;  3CBJ A;  2C0Y A;  3K24 A;  3IOQ A;  3I06 A;  5CHV A;  1GEC E;  1DEU A;  4BPV A;  3CH3 X;  1YK8 A;  1AU2 A;  1THE A;  4ZUX U;  1NPZ A;  3BC3 A;  2DZY A;  4AXM A;  3QT4 A;  2Y5B A;  2WBF X;  2ARY A;  3WXF A;  4CZW A;  1CV8 A;  2E01 A;  2VHS A;  4FIP A;  1AIM A;  2ATO A;  2PAD A;  3MTN A;  1PPP A;  1POP A;  1U5I A;  4AXL A;  4W4U A;  3F75 A;  3KX1 A;  1Y4H A;  4OEL A;  2DC6 A;  5EGW A;  2CIO A;  2F1G A;  3MOR A;  1QMY A;  1AYV A;  2DC8 A;  5CVM A; 
#chains in the Genus database with same CATH topology
 1KFX L;  3P5X A;  1GMY A;  1JQP A;  2YJC A;  3LXS A;  1NL6 A;  4X6H A;  4RKX A;  4N79 A;  1UKF A;  3OF9 A;  4WA6 A;  3PRP A;  4RF0 A;  5CVO B;  3MP2 A;  2J7Q A;  5K16 A;  2BTW A;  2AUZ A;  4MM3 B;  6PAD A;  3IFU A;  3I3T A;  2HHN A;  4RNA A;  4PP2 E;  4MZS A;  3LFY A;  1QDQ A;  2AVW A;  2YJ2 A;  4RF1 A;  3HHI A;  1KXR A;  1F2B A;  1AYU A;  3BB7 A;  2PNS A;  2NQI A;  1U9X A;  2DC9 A;  3WXE A;  2AYO A;  4BQV A;  4PI3 A;  4X6I A;  4FK5 A;  2DOS A;  3GCB A;  3B79 A;  2AIM A;  2H7J A;  3TRK A;  2B1N A;  1GLO A;  4BOS A;  1PPN A;  3PHX A;  4CDE B;  1VJV A;  1Y08 A;  4IUM A;  3O0U A;  3MJ5 A;  1EF7 A;  1HUC B;  4ZTB A;  2O6X A;  4G54 A;  1ME3 A;  4I04 A;  4PAD A;  2DC7 A;  2NQG A;  4PP1 A;  2XU1 A;  1TLO A;  3K8U A;  4MZO A;  4REZ A;  2E03 A;  4N8W A;  2R9M A;  2J7Q C;  5FPW A;  4CDD B;  2HXZ A;  1F2C A;  2E02 A;  1YAL A;  2AGA A;  1AYW A;  3K9M A;  3WXG A;  2HH5 A;  1ICF A;  1STF E;  1CQD A;  4YYR A;  3S3Q A;  4BOP A;  1BP4 A;  3RVW A;  3IMA A;  3IV2 A;  1U9Q X;  4W5C A;  1SNK A;  1TL9 A;  2FE8 A;  3C9E A;  1PCI A;  3BCN A;  1MEG A;  1YT7 A;  3PDF A;  1CB5 A;  9PAP A;  3F5V A;  3OVX A;  1NQC A;  3MHH A;  1PPD A;  4MSX A;  2ACT A;  1NB5 A;  1PAD A;  2IPP B;  1CTE A;  3BBA A;  3USV A;  5JA7 A;  3PBH A;  5EZQ A;  1F2A A;  3RVX A;  3KW9 A;  3PSE A;  4HXD B;  8PCH A;  2AS8 A;  5F02 A;  3IUT A;  2R9N A;  4WUR A;  1EWL A;  2AYN A;  4IP3 A;  1O0E A;  4BS6 A;  5EF4 A;  1QXP A;  1M6D A;  1MDW A;  1Q6K A;  2FO5 A;  3NHE A;  4XZX A;  1SP4 B;  5J94 A;  2FT2 A;  2P86 A;  1QOL A;  3M99 A;  1VSN A;  1AU3 A;  3E9S A;  4YYS A;  3V6C A;  2DCD A;  1EWO A;  1CS8 A;  3N3G A;  2XU3 A;  3PRM A;  1ME4 A;  2NQA A;  2DCC A;  3TMP A;  1YVB A;  2IBI A;  2DZZ A;  2PBH A;  1EWP A;  4BS5 A;  3H7D A;  3OF8 A;  2VHF A;  4YYU A;  1PBH A;  1PPO A;  1BY8 A;  3B21 A;  3D6S A;  4YYV A;  3PHU A;  1KFU L;  1MS6 A;  3KSE A;  4PT5 A;  3O1G A;  2JTC A;  3H8B A;  2JQF R;  1DF0 A;  2R9O A;  4OVZ B;  4BSQ A;  1ZIV A;  2CB5 A;  4FJC A;  5A24 A;  3RVV A;  1TU6 A;  1YZB A;  4RY2 A;  1MHW A;  5CHT A;  4OVZ A;  5JH3 A;  4Q8G A;  3S3R A;  2G6D A;  3ZNH A;  2DCA A;  2FQ9 A;  3H6S A;  2FTD A;  4W5B A;  1AU4 A;  4K7C A;  2G8E A;  1BQI A;  4X6J A;  2BTW B;  4OEM A;  2AU1 A;  4I07 A;  3P5V A;  3IHP A;  4N4Z A;  3C0R A;  1PIP A;  2Y6E A;  2OZ2 A;  3BWK A;  2DJG B;  2NQD B;  1EWM A;  2DCB A;  4YVA A;  2P7U A;  4QBB A;  1KHP A;  3H8C A;  3AI8 A;  5E6J A;  2Z84 A;  1A6R A;  5JZE A;  2GHU A;  4YYW A;  4Q8H A;  3KWB X;  3P5U A;  3PHW A;  2YJB A;  2OP3 A;  4XUI A;  1AU0 A;  1S4V A;  2BDZ A;  3KWZ A;  3W31 A;  1NB3 A;  3CBK A;  1XKG A;  3BY4 A;  3OIS A;  4YV8 A;  3BPM A;  5KO3 A;  3IEJ A;  1ATK A;  3HD3 A;  3BPF A;  2YJ9 A;  3OQC A;  1KHQ A;  1F29 A;  4QH6 A;  2FRA A;  3ZUA A;  3QSD A;  4XR7 A;  3CH2 X;  1PVJ A;  4BOQ A;  4P6E A;  1ZCM A;  3U8E A;  7PCK A;  1CPJ A;  2G7Y A;  1U9V A;  2XU5 A;  1IWD A;  2FUD A;  2FYE A;  3P5W A;  4KLB A;  4DMX A;  4MI7 A;  2B1M A;  3QJ3 A;  2HD5 A;  2HWK A;  3KFQ A;  2F7D A;  3N3K A;  4I05 A;  4QRG A;  4M0W A;  4OW0 A;  1CJL A;  3PW3 A;  5PAD A;  4QRX A;  3ERV A;  2DJF B;  1BGO A;  3N4C A;  4P6G A;  4R3D A;  1CSB B;  1YK7 A;  3PT2 A;  2BDL A;  1CVZ A;  3HWN A;  3PNR A;  2R9F A;  1K3B B;  4QRV A;  3E1Z B;  2JQG R;  4GUA A;  1ITO A;  4CDF B;  4YYQ A;  2G8J A;  2E00 A;  1U9W A;  3KKU A;  2YJ8 A;  2R9C A;  3H89 A;  1MIR A;  2R6N A;  3OVZ A;  3TNX A;  4CDC B;  3W30 A;  4HWY A;  2AUX A;  1FH0 A;  1X9Y A;  2OUL A;  2P0R A;  2GFO A;  1AEC A;  2PRE A;  4D8I A;  1PE6 A;  1PXV A;  3DF0 A;  3HHA A;  1GCB A;  3BOW A;  3MHS A;  2FRQ A;  2BU3 A;  2JRI A;  1NLJ A;  5CVN B;  1DKI A;  4P16 A;  2XU4 A;  4DMY A;  3V6E A;  1MEM A;  4A5U A;  3CBJ A;  2C0Y A;  3K24 A;  3IOQ A;  3I06 A;  3RNV A;  5CHV A;  3MTV A;  1GEC E;  1DEU A;  4BPV A;  3CH3 X;  1YK8 A;  1AU2 A;  1THE A;  4ZUX U;  1NPZ A;  3BC3 A;  2DZY A;  4BOU A;  4AXM A;  2UZJ A;  3QT4 A;  2Y5B A;  2WBF X;  2ARY A;  3WXF A;  4CZW A;  1CV8 A;  2E01 A;  4D8B A;  2VHS A;  4FIP A;  1AIM A;  2ATO A;  2PAD A;  3MTN A;  1PPP A;  4BOZ A;  1POP A;  1U5I A;  4AXL A;  4W4U A;  3F75 A;  3KX1 A;  1Y4H A;  4OEL A;  2DC6 A;  5EGW A;  5EZS A;  2CIO A;  2F1G A;  3MOR A;  4D8E A;  1QMY A;  1AYV A;  2DC8 A;  5CVM A;  3O65 A; 
#chains in the Genus database with same CATH homology
 1KFX L;  3P5X A;  1GMY A;  1JQP A;  2YJC A;  3LXS A;  1NL6 A;  4X6H A;  4N79 A;  3OF9 A;  4WA6 A;  5CVO B;  5K16 A;  2AUZ A;  4BGF A;  6PAD A;  3I3T A;  2HHN A;  4PP2 E;  4MZS A;  3LFY A;  1QDQ A;  2AVW A;  2YJ2 A;  3HHI A;  1KXR A;  3D9W A;  1F2B A;  1AYU A;  2PNS A;  2NQI A;  1U9X A;  2DC9 A;  3WXE A;  2AYO A;  4BQV A;  4PI3 A;  4X6I A;  3GCB A;  4FK5 A;  3B79 A;  2AIM A;  2H7J A;  1GX3 A;  2B1N A;  1GLO A;  1PPN A;  4CDE B;  1VJV A;  1Y08 A;  3O0U A;  1EF7 A;  1HUC B;  2O6X A;  4G54 A;  1ME3 A;  4I04 A;  4PAD A;  2DC7 A;  2NQG A;  4PP1 A;  2XU1 A;  1W4T A;  1TLO A;  3K8U A;  4MZO A;  2E03 A;  4N8W A;  2R9M A;  5FPW A;  4GUZ A;  4CDD B;  2HXZ A;  1F2C A;  2E02 A;  1YAL A;  1AYW A;  3K9M A;  3WXG A;  2HH5 A;  1ICF A;  1STF E;  1CQD A;  4YYR A;  3S3Q A;  1BP4 A;  3RVW A;  3IMA A;  3IV2 A;  4C5P A;  1U9Q X;  4W5C A;  1SNK A;  1TL9 A;  3C9E A;  1PCI A;  3BCN A;  1MEG A;  1YT7 A;  3PDF A;  1CB5 A;  9PAP A;  3F5V A;  3OVX A;  1NQC A;  3MHH A;  1PPD A;  4MSX A;  2ACT A;  1NB5 A;  1PAD A;  2IPP B;  1CTE A;  3USV A;  5JA7 A;  3PBH A;  1F2A A;  3RVX A;  3KW9 A;  8PCH A;  2AS8 A;  5F02 A;  3IUT A;  2R9N A;  1EWL A;  2AYN A;  1O0E A;  4BS6 A;  5EF4 A;  1QXP A;  1M6D A;  1MDW A;  1Q6K A;  2FO5 A;  3NHE A;  1SP4 B;  5J94 A;  2FT2 A;  2P86 A;  1QOL A;  3M99 A;  1VSN A;  1AU3 A;  4YYS A;  3V6C A;  2DCD A;  1EWO A;  1CS8 A;  3N3G A;  2XU3 A;  1ME4 A;  2NQA A;  2DCC A;  1YVB A;  2IBI A;  2DZZ A;  2PBH A;  1EWP A;  4BS5 A;  3H7D A;  3OF8 A;  2VHF A;  4YYU A;  1PBH A;  1PPO A;  1BY8 A;  3D6S A;  4YYV A;  2VFB A;  1KFU L;  1MS6 A;  3KSE A;  3O1G A;  3H8B A;  2JQF R;  1DF0 A;  2R9O A;  4BSQ A;  1ZIV A;  2CB5 A;  4FJC A;  5A24 A;  3RVV A;  1TU6 A;  4RY2 A;  1MHW A;  5CHT A;  5JH3 A;  4Q8G A;  3S3R A;  2G6D A;  2DCA A;  2FQ9 A;  3H6S A;  2VFC A;  2FTD A;  4W5B A;  1AU4 A;  3LTW A;  4K7C A;  2G8E A;  1BQI A;  4X6J A;  4OEM A;  2AU1 A;  4I07 A;  3P5V A;  3IHP A;  4N4Z A;  1PIP A;  2Y6E A;  2OZ2 A;  3BWK A;  2DJG B;  1W5R A;  2NQD B;  1EWM A;  2DCB A;  4YVA A;  2P7U A;  4QBB A;  1KHP A;  3H8C A;  3AI8 A;  1A6R A;  2GHU A;  4YYW A;  4Q8H A;  3KWB X;  3P5U A;  2YJB A;  2OP3 A;  4XUI A;  1AU0 A;  1S4V A;  2BDZ A;  3KWZ A;  1NB3 A;  3CBK A;  1XKG A;  3OIS A;  4YV8 A;  3BPM A;  3IEJ A;  1ATK A;  3HD3 A;  3BPF A;  4NV7 A;  2YJ9 A;  1KHQ A;  1F29 A;  4QH6 A;  2FRA A;  3ZUA A;  3QSD A;  4XR7 A;  3CH2 X;  4P6E A;  1ZCM A;  3U8E A;  7PCK A;  1CPJ A;  2G7Y A;  1U9V A;  2XU5 A;  1IWD A;  2FUD A;  2FYE A;  3P5W A;  4KLB A;  4DMX A;  2B1M A;  3QJ3 A;  2HD5 A;  3KFQ A;  2F7D A;  3N3K A;  4I05 A;  4QRG A;  1W6F A;  1CJL A;  3PW3 A;  5PAD A;  4QRX A;  3ERV A;  2DJF B;  1BGO A;  3N4C A;  4P6G A;  1CSB B;  1YK7 A;  2BSZ A;  2BDL A;  1CVZ A;  3HWN A;  3PNR A;  2R9F A;  1K3B B;  4QRV A;  3E1Z B;  2JQG R;  1ITO A;  4CDF B;  4YYQ A;  2G8J A;  2E00 A;  1U9W A;  3KKU A;  2YJ8 A;  2R9C A;  3H89 A;  1MIR A;  2R6N A;  3OVZ A;  3TNX A;  4CDC B;  4HWY A;  2AUX A;  1FH0 A;  1X9Y A;  2OUL A;  2P0R A;  2GFO A;  1AEC A;  2PRE A;  1PE6 A;  1PXV A;  3DF0 A;  3HHA A;  1GCB A;  3BOW A;  3MHS A;  2FRQ A;  1NLJ A;  5CVN B;  2XU4 A;  4DMY A;  3V6E A;  1MEM A;  3CBJ A;  2C0Y A;  3K24 A;  3IOQ A;  4B55 A;  3I06 A;  5CHV A;  1GEC E;  1DEU A;  4BPV A;  3CH3 X;  1YK8 A;  1AU2 A;  1THE A;  4ZUX U;  1NPZ A;  3BC3 A;  2DZY A;  4AXM A;  3QT4 A;  2Y5B A;  2WBF X;  2ARY A;  3WXF A;  4CZW A;  1CV8 A;  2E01 A;  2VHS A;  4FIP A;  4NV8 A;  1AIM A;  2ATO A;  2PAD A;  3MTN A;  1PPP A;  1POP A;  1U5I A;  1E2T A;  4AXL A;  4W4U A;  3F75 A;  3KX1 A;  1Y4H A;  4OEL A;  2DC6 A;  5EGW A;  2CIO A;  2F1G A;  3MOR A;  1QMY A;  1AYV A;  2DC8 A;  5CVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...