2DJFB

Crystal structure of human dipeptidyl peptidase i (cathepsin c) in complex with the inhibitor gly-phe-chn2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 161
sequence length 161
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2djfB01
2FYEA 5CHTA 5CHVA 4KLBA 3U8EA 4BPVA 4X6JA 1AYVA 1BGOA 4MZOA 1AU3A 2R9CA 5A24A 3H6SA 3I3TA 1NB3A 4PP2E 1MIRA 1AU0A 4YYSA 2CIOA 3RVXA 4FJCA 1MS6A 1CVZA 3MHHA 3AI8A 4FK5A 3KW9A 3MHSA 3IOQA 1ITOA 4P6EA 1XKGA 2CB5A 2E00A 2R9OA 2AYOA 4HWYA 3KWZA 3P5UA 4W5CA 3K8UA 4OELA 5EGWA 3F75A 1Y08A 3BOWA 1GMYA 2FTDA 2HD5A 3HHIA 4AXMA 1MEGA 3QSDA 3WXGA 2YJ9A 3C9EA 3H8BA 4Q8GA 3O1GA 1CS8A 6PADA 2F1GA 3BPFA 3P5WA 3S3QA 2G7YA 2DCCA 2R6NA 9PAPA 1CV8A 3DF0A 1PPOA 3ZUAA 1Q6KA 1AIMA 2XU4A 2HXZA 1EWOA 4YYRA 5JA7A 4CZWA 2VHFA 2DCAA 4YYWA 1KXRA 3V6EA 3BCNA 3OVZA 3N4CA 4QRGA 4PP1A 3NHEA 3IHPA 2NQGA 2AS8A 1AECA 1THEA 4CDFB 4ZUXU 1SNKA 2YJCA 8PCHA 2F7DA 1ME3A 2G6DA 4PADA 5PADA 4K7CA 2PNSA 1PIPA 2OZ2A 3WXEA 4QRVA 1ZIVA 2GFOA 1YALA 1Y4HA 2DZZA 2AVWA 4Q8HA 4CDCB 4QH6A 2FT2A 2R9MA 4XUIA 4BSQA 1TL9A 2PADA 2DC6A 2PREA 1F2BA 3TNXA 5CVNB 3OVXA 1CB5A 3H8CA 2AU1A 1EWPA 3LFYA 4YYQA 1QOLA 1NL6A 2DC9A 1PPNA 1CSBB 1X9YA 4BS6A 3HHAA 2FQ9A 2FRQA 2YJ2A 1PPDA 3KKUA 3KWBX 3PNRA 3P5XA 4I05A 2YJ8A 4YV8A 2BDLA 1VSNA 2NQIA 2AIMA 3N3KA 1MHWA 3KSEA 2AUZA 3BPMA 2P86A 1FH0A 1U9XA 2ACTA 4WA6A 1DEUA 2XU1A 1AYWA 2FO5A 2O6XA 5CVOB 4AXLA 2Y6EA 2FRAA 2DCDA 4YVAA 3B79A 1IWDA 2AUXA 3RVVA 2GHUA 4X6IA 1F2AA 1ZCMA 4CDEB 2VHSA 2Y5BA 3P5VA 4YYVA 1STFE 2P7UA 3N3GA 1MEMA 2PBHA 3I06A 2R9FA 2G8EA 2E03A 1ATKA 4DMYA 4FIPA 1BQIA 4MSXA 3K24A 3D6SA 3LXSA 1F2CA 1PXVA 2JQGR 3USVA 1NB5A 1EWLA 3IEJA 3OF9A 2B1MA 5J94A 2C0YA 3CH3X 2DCBA 2XU3A 3O0UA 3GCBA 1CPJA 2AYNA 1KFXL 1QXPA 2R9NA 4MZSA 1GCBA 2WBFX 1GECE 2IPPB 3PBHA 4PI3A 1DF0A 2BDZA 4BS5A 4BQVA 1GLOA 1YK8A 1A6RA 5FPWA 2B1NA 2E02A 2OP3A 4W5BA 1BP4A 4XR7A 7PCKA 1CJLA 2DC8A 1KHQA 3H7DA 1AU2A 3E1ZB 4I04A 2DC7A 3WXFA 5JH3A 1PBHA 3M99A 4I07A 3H89A 2DJGB 3MTNA 4X6HA 1AU4A 1CQDA 2HHNA 4W4UA 3S3RA 1ME4A 2E01A 1M6DA 3V6CA 4DMXA 3ERVA 3QJ3A 1PE6A 1U9WA 1K3BB 3CBKA 1NPZA 4N8WA 1HUCB 3QT4A 4P6GA 1JQPA 3IMAA 5EF4A 2G8JA 3OF8A 1O0EA 3OISA 4CDDB 3KX1A 1QDQA 1TLOA 3CBJA 3F5VA 4QRXA 1EF7A 4QBBA 1EWMA 1ICFA 1NQCA 1MDWA 1PPPA 1YVBA 1KFUL 4N79A 1CTEA 2NQDB 1PADA 2OULA 1U5IA 1TU6A 2H7JA 1AYUA 2DZYA 5F02A 1SP4B 4OEMA 1BY8A 1U9VA 3PW3A 4RY2A 3K9MA 3IV2A 2JQFR 1QMYA 4G54A 1PCIA 2XU5A 3KFQA 3HD3A 3BWKA 3HWNA 1NLJA 2ATOA 2IBIA 3MORA 3CH2X 3PDFA 2ARYA 2NQAA 4YYUA 3IUTA 5CVMA 1KHPA 2HH5A 1POPA 4N4ZA 2P0RA 1VJVA 1YK7A 5K16A 3RVWA 1U9QX 1S4VA 2DJFB 2FUDA 1YT7A 3BC3A 1F29A 2YJBA
chains in the Genus database with same CATH superfamily
2FYEA 5CHTA 5CHVA 3OQCA 4KLBA 3U8EA 4BPVA 4X6JA 1AYVA 1BGOA 4MZOA 1AU3A 2R9CA 5A24A 3H6SA 3I3TA 2JRIA 1NB3A 2AGAA 4PP2E 1MIRA 1AU0A 4YYSA 2CIOA 5E6JA 3RVXA 4FJCA 1MS6A 1CVZA 3MHHA 3AI8A 4FK5A 3KW9A 3MHSA 3IOQA 1ITOA 4P6EA 4PT5A 1XKGA 2CB5A 2E00A 2R9OA 2AYOA 4HWYA 3KWZA 3P5UA 4MI7A 3ZNHA 4W5CA 3K8UA 3TMPA 4OELA 5EGWA 3F75A 1Y08A 3BOWA 1GMYA 4A5UA 2FTDA 2HD5A 3HHIA 4AXMA 1MEGA 3QSDA 3WXGA 2YJ9A 3C9EA 3H8BA 4Q8GA 3O1GA 1CS8A 6PADA 2F1GA 3BPFA 3P5WA 4RNAA 3S3QA 2G7YA 2DCCA 2R6NA 9PAPA 1CV8A 3DF0A 1PPOA 3ZUAA 1Q6KA 1AIMA 2XU4A 2HXZA 1EWOA 3BB7A 4YYRA 5JA7A 4CZWA 2VHFA 2DCAA 4YYWA 1KXRA 3V6EA 3BCNA 3OVZA 3N4CA 4QRGA 4PP1A 3NHEA 3IHPA 2NQGA 2AS8A 1AECA 1THEA 4CDFB 4ZUXU 1SNKA 2YJCA 8PCHA 2F7DA 1ME3A 2G6DA 4PADA 5PADA 4K7CA 2PNSA 1PIPA 2OZ2A 3WXEA 4HXDB 4QRVA 1ZIVA 2GFOA 3RNVA 1YALA 1Y4HA 2DZZA 2AVWA 4Q8HA 4CDCB 4QH6A 2FT2A 2R9MA 4RF0A 4XUIA 4BSQA 1TL9A 2PADA 4BOPA 2DC6A 2PREA 4IUMA 1F2BA 3TNXA 5CVNB 3OVXA 1CB5A 3H8CA 4RKXA 2AU1A 1EWPA 3LFYA 4YYQA 1QOLA 1NL6A 3MTVA 2DC9A 1PPNA 1CSBB 1X9YA 4BS6A 3HHAA 4GUAA 2FQ9A 2FRQA 2YJ2A 1PPDA 3KKUA 3KWBX 3PNRA 2J7QC 3P5XA 4I05A 2YJ8A 4YV8A 2BDLA 2BTWA 1VSNA 2NQIA 2AIMA 5EZQA 3E9SA 3MP2A 4M0WA 3PRMA 3N3KA 1MHWA 3KSEA 2AUZA 4RF1A 3BPMA 1PVJA 2P86A 1FH0A 1U9XA 2ACTA 5EZSA 4WA6A 1DEUA 3PHWA 2XU1A 1AYWA 2FO5A 2O6XA 5CVOB 4AXLA 2Y6EA 2FRAA 2DCDA 4YVAA 3B79A 1IWDA 2AUXA 3RVVA 2GHUA 4X6IA 1F2AA 1ZCMA 4OW0A 4CDEB 2VHSA 2Y5BA 3P5VA 4YYVA 1STFE 2P7UA 2FE8A 3N3GA 1MEMA 2PBHA 3I06A 2R9FA 2G8EA 2E03A 1ATKA 4DMYA 4FIPA 4WURA 1BQIA 4MSXA 3K24A 4ZTBA 3D6SA 3LXSA 1F2CA 2BU3A 1PXVA 2JQGR 3USVA 4XZXA 4BOUA 1NB5A 1UKFA 1EWLA 3IEJA 3OF9A 4BOQA 4D8EA 2B1MA 5J94A 2C0YA 2J7QA 3B21A 2JTCA 4P16A 3CH3X 2DCBA 2XU3A 3O0UA 3GCBA 1CPJA 2AYNA 1KFXL 1QXPA 2R9NA 4MZSA 1GCBA 2WBFX 1GECE 3W30A 1DKIA 2IPPB 3PBHA 4OVZA 4PI3A 1DF0A 2BDZA 5KO3A 4BS5A 4BQVA 1GLOA 1YK8A 1A6RA 3MJ5A 5FPWA 2B1NA 2E02A 2OP3A 2UZJA 4W5BA 1BP4A 4XR7A 3C0RA 7PCKA 1CJLA 2DC8A 1KHQA 3PSEA 3H7DA 1AU2A 3E1ZB 4I04A 2DC7A 1YZBA 3WXFA 5JH3A 1PBHA 3M99A 4I07A 3H89A 2DJGB 3MTNA 4X6HA 1AU4A 1CQDA 2HHNA 4W4UA 4REZA 3S3RA 1ME4A 2E01A 1M6DA 5JZEA 3V6CA 4DMXA 3ERVA 3QJ3A 1PE6A 1U9WA 1K3BB 3IFUA 3CBKA 1NPZA 4N8WA 1HUCB 3QT4A 4P6GA 1JQPA 3IMAA 5EF4A 2G8JA 2Z84A 3OF8A 1O0EA 3OISA 3O65A 3PRPA 3KX1A 3PHUA 4CDDB 1QDQA 4D8BA 3BBAA 1TLOA 3CBJA 2DOSA 3PT2A 3F5VA 4QRXA 1EF7A 4MM3B 4QBBA 3PHXA 1EWMA 1ICFA 1NQCA 1MDWA 1PPPA 1YVBA 1KFUL 4N79A 1CTEA 2NQDB 1PADA 2OULA 1U5IA 3TRKA 1TU6A 2H7JA 1AYUA 4OVZB 2DZYA 5F02A 1SP4B 4OEMA 1BY8A 1U9VA 2HWKA 3PW3A 4R3DA 3W31A 4D8IA 4IP3A 4RY2A 3K9MA 3IV2A 2JQFR 1QMYA 4G54A 1PCIA 2XU5A 3KFQA 3HD3A 4BOSA 3BWKA 3HWNA 1NLJA 2ATOA 2IBIA 3MORA 3CH2X 3PDFA 2ARYA 2NQAA 4YYUA 2BTWB 3IUTA 5CVMA 1KHPA 3BY4A 2HH5A 1POPA 4N4ZA 2P0RA 1VJVA 1YK7A 5K16A 3RVWA 1U9QX 1S4VA 2DJFB 4BOZA 2FUDA 1YT7A 3BC3A 1F29A 2YJBA
chains in the Genus database with same CATH topology
2FYEA 5CHTA 5CHVA 4KLBA 3U8EA 4BPVA 4X6JA 1AYVA 1BGOA 4MZOA 1AU3A 2R9CA 5A24A 3H6SA 3I3TA 1NB3A 4PP2E 1MIRA 1AU0A 4YYSA 2CIOA 3RVXA 4FJCA 1MS6A 1CVZA 3MHHA 3AI8A 4FK5A 3KW9A 3MHSA 3IOQA 1ITOA 4P6EA 1XKGA 2CB5A 2E00A 2R9OA 2AYOA 4HWYA 3KWZA 3P5UA 4W5CA 3K8UA 4OELA 5EGWA 3F75A 1Y08A 3BOWA 1E2TA 1GMYA 2FTDA 2HD5A 3HHIA 4AXMA 1MEGA 1GX3A 3QSDA 3WXGA 4GUZA 2YJ9A 3C9EA 3H8BA 4Q8GA 3O1GA 1CS8A 6PADA 2F1GA 3BPFA 3P5WA 1W5RA 3S3QA 2G7YA 2DCCA 2R6NA 9PAPA 1CV8A 3DF0A 1PPOA 3ZUAA 1Q6KA 1AIMA 2VFCA 2XU4A 2HXZA 1EWOA 4YYRA 5JA7A 4CZWA 2VHFA 2DCAA 4YYWA 1KXRA 3V6EA 3BCNA 3OVZA 3N4CA 4QRGA 4PP1A 3NHEA 3IHPA 2NQGA 2AS8A 1AECA 1THEA 4CDFB 4ZUXU 1SNKA 2YJCA 8PCHA 2F7DA 1ME3A 2G6DA 4PADA 5PADA 4K7CA 2PNSA 1PIPA 2OZ2A 3WXEA 4QRVA 1ZIVA 2GFOA 1YALA 1Y4HA 2DZZA 4NV7A 2AVWA 4Q8HA 4CDCB 1W6FA 4QH6A 2FT2A 4BGFA 2R9MA 3D9WA 4XUIA 4BSQA 1TL9A 2PADA 2DC6A 2PREA 1F2BA 3TNXA 5CVNB 3OVXA 1CB5A 3H8CA 2AU1A 1EWPA 3LFYA 4YYQA 1QOLA 1NL6A 2DC9A 2VFBA 1PPNA 1CSBB 1X9YA 4BS6A 3HHAA 2FQ9A 2FRQA 2YJ2A 1PPDA 3KKUA 3KWBX 3PNRA 3P5XA 4I05A 2YJ8A 4YV8A 2BDLA 1VSNA 2NQIA 2AIMA 2BSZA 3N3KA 1MHWA 3KSEA 2AUZA 3BPMA 2P86A 1FH0A 1U9XA 2ACTA 4WA6A 1DEUA 2XU1A 4NV8A 1AYWA 2FO5A 2O6XA 5CVOB 4AXLA 2Y6EA 2FRAA 2DCDA 4YVAA 3B79A 1IWDA 2AUXA 3RVVA 2GHUA 4X6IA 1F2AA 1ZCMA 4CDEB 2VHSA 2Y5BA 3P5VA 4YYVA 1STFE 2P7UA 3N3GA 1MEMA 2PBHA 3I06A 2R9FA 2G8EA 2E03A 1ATKA 4DMYA 4FIPA 1BQIA 4MSXA 3K24A 3D6SA 3LXSA 1F2CA 1PXVA 2JQGR 3USVA 1NB5A 1EWLA 3IEJA 3OF9A 2B1MA 5J94A 2C0YA 3CH3X 2DCBA 2XU3A 3O0UA 3GCBA 1CPJA 2AYNA 1KFXL 1QXPA 2R9NA 4MZSA 1GCBA 2WBFX 1GECE 2IPPB 3PBHA 4PI3A 1DF0A 2BDZA 4BS5A 4BQVA 1GLOA 1YK8A 1A6RA 5FPWA 2B1NA 2E02A 2OP3A 4W5BA 1BP4A 4XR7A 7PCKA 1CJLA 2DC8A 1KHQA 3H7DA 1AU2A 3E1ZB 4I04A 2DC7A 3WXFA 5JH3A 1PBHA 3M99A 4I07A 3H89A 2DJGB 3MTNA 4X6HA 1AU4A 1CQDA 2HHNA 4W4UA 3S3RA 1ME4A 3LTWA 2E01A 1M6DA 3V6CA 4DMXA 3ERVA 3QJ3A 1PE6A 1U9WA 1K3BB 3CBKA 1NPZA 4N8WA 1HUCB 3QT4A 4P6GA 1JQPA 3IMAA 5EF4A 2G8JA 4B55A 3OF8A 1O0EA 3OISA 4CDDB 3KX1A 1QDQA 1TLOA 3CBJA 3F5VA 4QRXA 1EF7A 4QBBA 1EWMA 1ICFA 1NQCA 1MDWA 1PPPA 1YVBA 1KFUL 4N79A 1CTEA 2NQDB 1PADA 2OULA 1U5IA 1TU6A 2H7JA 1AYUA 2DZYA 5F02A 1SP4B 4OEMA 1BY8A 4C5PA 1U9VA 3PW3A 4RY2A 3K9MA 3IV2A 2JQFR 1QMYA 4G54A 1PCIA 2XU5A 3KFQA 3HD3A 3BWKA 3HWNA 1NLJA 1W4TA 2ATOA 2IBIA 3MORA 3CH2X 3PDFA 2ARYA 2NQAA 4YYUA 3IUTA 5CVMA 1KHPA 2HH5A 1POPA 4N4ZA 2P0RA 1VJVA 1YK7A 5K16A 3RVWA 1U9QX 1S4VA 2DJFB 2FUDA 1YT7A 3BC3A 1F29A 2YJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYE A;  5CHT A;  5CHV A;  4KLB A;  3U8E A;  4BPV A;  4X6J A;  1AYV A;  1BGO A;  4MZO A;  1AU3 A;  2R9C A;  5A24 A;  3H6S A;  3I3T A;  1NB3 A;  4PP2 E;  1MIR A;  1AU0 A;  4YYS A;  2CIO A;  3RVX A;  4FJC A;  1MS6 A;  1CVZ A;  3MHH A;  3AI8 A;  4FK5 A;  3KW9 A;  3MHS A;  3IOQ A;  1ITO A;  4P6E A;  1XKG A;  2CB5 A;  2E00 A;  2R9O A;  2AYO A;  4HWY A;  3KWZ A;  3P5U A;  4W5C A;  3K8U A;  4OEL A;  5EGW A;  3F75 A;  1Y08 A;  3BOW A;  1GMY A;  2FTD A;  2HD5 A;  3HHI A;  4AXM A;  1MEG A;  3QSD A;  3WXG A;  2YJ9 A;  3C9E A;  3H8B A;  4Q8G A;  3O1G A;  1CS8 A;  6PAD A;  2F1G A;  3BPF A;  3P5W A;  3S3Q A;  2G7Y A;  2DCC A;  2R6N A;  9PAP A;  1CV8 A;  3DF0 A;  1PPO A;  3ZUA A;  1Q6K A;  1AIM A;  2XU4 A;  2HXZ A;  1EWO A;  4YYR A;  5JA7 A;  4CZW A;  2VHF A;  2DCA A;  4YYW A;  1KXR A;  3V6E A;  3BCN A;  3OVZ A;  3N4C A;  4QRG A;  4PP1 A;  3NHE A;  3IHP A;  2NQG A;  2AS8 A;  1AEC A;  1THE A;  4CDF B;  4ZUX U;  1SNK A;  2YJC A;  8PCH A;  2F7D A;  1ME3 A;  2G6D A;  4PAD A;  5PAD A;  4K7C A;  2PNS A;  1PIP A;  2OZ2 A;  3WXE A;  4QRV A;  1ZIV A;  2GFO A;  1YAL A;  1Y4H A;  2DZZ A;  2AVW A;  4Q8H A;  4CDC B;  4QH6 A;  2FT2 A;  2R9M A;  4XUI A;  4BSQ A;  1TL9 A;  2PAD A;  2DC6 A;  2PRE A;  1F2B A;  3TNX A;  5CVN B;  3OVX A;  1CB5 A;  3H8C A;  2AU1 A;  1EWP A;  3LFY A;  4YYQ A;  1QOL A;  1NL6 A;  2DC9 A;  1PPN A;  1CSB B;  1X9Y A;  4BS6 A;  3HHA A;  2FQ9 A;  2FRQ A;  2YJ2 A;  1PPD A;  3KKU A;  3KWB X;  3PNR A;  3P5X A;  4I05 A;  2YJ8 A;  4YV8 A;  2BDL A;  1VSN A;  2NQI A;  2AIM A;  3N3K A;  1MHW A;  3KSE A;  2AUZ A;  3BPM A;  2P86 A;  1FH0 A;  1U9X A;  2ACT A;  4WA6 A;  1DEU A;  2XU1 A;  1AYW A;  2FO5 A;  2O6X A;  5CVO B;  4AXL A;  2Y6E A;  2FRA A;  2DCD A;  4YVA A;  3B79 A;  1IWD A;  2AUX A;  3RVV A;  2GHU A;  4X6I A;  1F2A A;  1ZCM A;  4CDE B;  2VHS A;  2Y5B A;  3P5V A;  4YYV A;  1STF E;  2P7U A;  3N3G A;  1MEM A;  2PBH A;  3I06 A;  2R9F A;  2G8E A;  2E03 A;  1ATK A;  4DMY A;  4FIP A;  1BQI A;  4MSX A;  3K24 A;  3D6S A;  3LXS A;  1F2C A;  1PXV A;  2JQG R;  3USV A;  1NB5 A;  1EWL A;  3IEJ A;  3OF9 A;  2B1M A;  5J94 A;  2C0Y A;  3CH3 X;  2DCB A;  2XU3 A;  3O0U A;  3GCB A;  1CPJ A;  2AYN A;  1KFX L;  1QXP A;  2R9N A;  4MZS A;  1GCB A;  2WBF X;  1GEC E;  2IPP B;  3PBH A;  4PI3 A;  1DF0 A;  2BDZ A;  4BS5 A;  4BQV A;  1GLO A;  1YK8 A;  1A6R A;  5FPW A;  2B1N A;  2E02 A;  2OP3 A;  4W5B A;  1BP4 A;  4XR7 A;  7PCK A;  1CJL A;  2DC8 A;  1KHQ A;  3H7D A;  1AU2 A;  3E1Z B;  4I04 A;  2DC7 A;  3WXF A;  5JH3 A;  1PBH A;  3M99 A;  4I07 A;  3H89 A;  2DJG B;  3MTN A;  4X6H A;  1AU4 A;  1CQD A;  2HHN A;  4W4U A;  3S3R A;  1ME4 A;  2E01 A;  1M6D A;  3V6C A;  4DMX A;  3ERV A;  3QJ3 A;  1PE6 A;  1U9W A;  1K3B B;  3CBK A;  1NPZ A;  4N8W A;  1HUC B;  3QT4 A;  4P6G A;  1JQP A;  3IMA A;  5EF4 A;  2G8J A;  3OF8 A;  1O0E A;  3OIS A;  4CDD B;  3KX1 A;  1QDQ A;  1TLO A;  3CBJ A;  3F5V A;  4QRX A;  1EF7 A;  4QBB A;  1EWM A;  1ICF A;  1NQC A;  1MDW A;  1PPP A;  1YVB A;  1KFU L;  4N79 A;  1CTE A;  2NQD B;  1PAD A;  2OUL A;  1U5I A;  1TU6 A;  2H7J A;  1AYU A;  2DZY A;  5F02 A;  1SP4 B;  4OEM A;  1BY8 A;  1U9V A;  3PW3 A;  4RY2 A;  3K9M A;  3IV2 A;  2JQF R;  1QMY A;  4G54 A;  1PCI A;  2XU5 A;  3KFQ A;  3HD3 A;  3BWK A;  3HWN A;  1NLJ A;  2ATO A;  2IBI A;  3MOR A;  3CH2 X;  3PDF A;  2ARY A;  2NQA A;  4YYU A;  3IUT A;  5CVM A;  1KHP A;  2HH5 A;  1POP A;  4N4Z A;  2P0R A;  1VJV A;  1YK7 A;  5K16 A;  3RVW A;  1U9Q X;  1S4V A;  2DJF B;  2FUD A;  1YT7 A;  3BC3 A;  1F29 A;  2YJB A; 
#chains in the Genus database with same CATH topology
 2FYE A;  5CHT A;  5CHV A;  3OQC A;  4KLB A;  3U8E A;  4BPV A;  4X6J A;  1AYV A;  1BGO A;  4MZO A;  1AU3 A;  2R9C A;  5A24 A;  3H6S A;  3I3T A;  2JRI A;  1NB3 A;  2AGA A;  4PP2 E;  1MIR A;  1AU0 A;  4YYS A;  2CIO A;  5E6J A;  3RVX A;  4FJC A;  1MS6 A;  1CVZ A;  3MHH A;  3AI8 A;  4FK5 A;  3KW9 A;  3MHS A;  3IOQ A;  1ITO A;  4P6E A;  4PT5 A;  1XKG A;  2CB5 A;  2E00 A;  2R9O A;  2AYO A;  4HWY A;  3KWZ A;  3P5U A;  4MI7 A;  3ZNH A;  4W5C A;  3K8U A;  3TMP A;  4OEL A;  5EGW A;  3F75 A;  1Y08 A;  3BOW A;  1GMY A;  4A5U A;  2FTD A;  2HD5 A;  3HHI A;  4AXM A;  1MEG A;  3QSD A;  3WXG A;  2YJ9 A;  3C9E A;  3H8B A;  4Q8G A;  3O1G A;  1CS8 A;  6PAD A;  2F1G A;  3BPF A;  3P5W A;  4RNA A;  3S3Q A;  2G7Y A;  2DCC A;  2R6N A;  9PAP A;  1CV8 A;  3DF0 A;  1PPO A;  3ZUA A;  1Q6K A;  1AIM A;  2XU4 A;  2HXZ A;  1EWO A;  3BB7 A;  4YYR A;  5JA7 A;  4CZW A;  2VHF A;  2DCA A;  4YYW A;  1KXR A;  3V6E A;  3BCN A;  3OVZ A;  3N4C A;  4QRG A;  4PP1 A;  3NHE A;  3IHP A;  2NQG A;  2AS8 A;  1AEC A;  1THE A;  4CDF B;  4ZUX U;  1SNK A;  2YJC A;  8PCH A;  2F7D A;  1ME3 A;  2G6D A;  4PAD A;  5PAD A;  4K7C A;  2PNS A;  1PIP A;  2OZ2 A;  3WXE A;  4HXD B;  4QRV A;  1ZIV A;  2GFO A;  3RNV A;  1YAL A;  1Y4H A;  2DZZ A;  2AVW A;  4Q8H A;  4CDC B;  4QH6 A;  2FT2 A;  2R9M A;  4RF0 A;  4XUI A;  4BSQ A;  1TL9 A;  2PAD A;  4BOP A;  2DC6 A;  2PRE A;  4IUM A;  1F2B A;  3TNX A;  5CVN B;  3OVX A;  1CB5 A;  3H8C A;  4RKX A;  2AU1 A;  1EWP A;  3LFY A;  4YYQ A;  1QOL A;  1NL6 A;  3MTV A;  2DC9 A;  1PPN A;  1CSB B;  1X9Y A;  4BS6 A;  3HHA A;  4GUA A;  2FQ9 A;  2FRQ A;  2YJ2 A;  1PPD A;  3KKU A;  3KWB X;  3PNR A;  2J7Q C;  3P5X A;  4I05 A;  2YJ8 A;  4YV8 A;  2BDL A;  2BTW A;  1VSN A;  2NQI A;  2AIM A;  5EZQ A;  3E9S A;  3MP2 A;  4M0W A;  3PRM A;  3N3K A;  1MHW A;  3KSE A;  2AUZ A;  4RF1 A;  3BPM A;  1PVJ A;  2P86 A;  1FH0 A;  1U9X A;  2ACT A;  5EZS A;  4WA6 A;  1DEU A;  3PHW A;  2XU1 A;  1AYW A;  2FO5 A;  2O6X A;  5CVO B;  4AXL A;  2Y6E A;  2FRA A;  2DCD A;  4YVA A;  3B79 A;  1IWD A;  2AUX A;  3RVV A;  2GHU A;  4X6I A;  1F2A A;  1ZCM A;  4OW0 A;  4CDE B;  2VHS A;  2Y5B A;  3P5V A;  4YYV A;  1STF E;  2P7U A;  2FE8 A;  3N3G A;  1MEM A;  2PBH A;  3I06 A;  2R9F A;  2G8E A;  2E03 A;  1ATK A;  4DMY A;  4FIP A;  4WUR A;  1BQI A;  4MSX A;  3K24 A;  4ZTB A;  3D6S A;  3LXS A;  1F2C A;  2BU3 A;  1PXV A;  2JQG R;  3USV A;  4XZX A;  4BOU A;  1NB5 A;  1UKF A;  1EWL A;  3IEJ A;  3OF9 A;  4BOQ A;  4D8E A;  2B1M A;  5J94 A;  2C0Y A;  2J7Q A;  3B21 A;  2JTC A;  4P16 A;  3CH3 X;  2DCB A;  2XU3 A;  3O0U A;  3GCB A;  1CPJ A;  2AYN A;  1KFX L;  1QXP A;  2R9N A;  4MZS A;  1GCB A;  2WBF X;  1GEC E;  3W30 A;  1DKI A;  2IPP B;  3PBH A;  4OVZ A;  4PI3 A;  1DF0 A;  2BDZ A;  5KO3 A;  4BS5 A;  4BQV A;  1GLO A;  1YK8 A;  1A6R A;  3MJ5 A;  5FPW A;  2B1N A;  2E02 A;  2OP3 A;  2UZJ A;  4W5B A;  1BP4 A;  4XR7 A;  3C0R A;  7PCK A;  1CJL A;  2DC8 A;  1KHQ A;  3PSE A;  3H7D A;  1AU2 A;  3E1Z B;  4I04 A;  2DC7 A;  1YZB A;  3WXF A;  5JH3 A;  1PBH A;  3M99 A;  4I07 A;  3H89 A;  2DJG B;  3MTN A;  4X6H A;  1AU4 A;  1CQD A;  2HHN A;  4W4U A;  4REZ A;  3S3R A;  1ME4 A;  2E01 A;  1M6D A;  5JZE A;  3V6C A;  4DMX A;  3ERV A;  3QJ3 A;  1PE6 A;  1U9W A;  1K3B B;  3IFU A;  3CBK A;  1NPZ A;  4N8W A;  1HUC B;  3QT4 A;  4P6G A;  1JQP A;  3IMA A;  5EF4 A;  2G8J A;  2Z84 A;  3OF8 A;  1O0E A;  3OIS A;  3O65 A;  3PRP A;  3KX1 A;  3PHU A;  4CDD B;  1QDQ A;  4D8B A;  3BBA A;  1TLO A;  3CBJ A;  2DOS A;  3PT2 A;  3F5V A;  4QRX A;  1EF7 A;  4MM3 B;  4QBB A;  3PHX A;  1EWM A;  1ICF A;  1NQC A;  1MDW A;  1PPP A;  1YVB A;  1KFU L;  4N79 A;  1CTE A;  2NQD B;  1PAD A;  2OUL A;  1U5I A;  3TRK A;  1TU6 A;  2H7J A;  1AYU A;  4OVZ B;  2DZY A;  5F02 A;  1SP4 B;  4OEM A;  1BY8 A;  1U9V A;  2HWK A;  3PW3 A;  4R3D A;  3W31 A;  4D8I A;  4IP3 A;  4RY2 A;  3K9M A;  3IV2 A;  2JQF R;  1QMY A;  4G54 A;  1PCI A;  2XU5 A;  3KFQ A;  3HD3 A;  4BOS A;  3BWK A;  3HWN A;  1NLJ A;  2ATO A;  2IBI A;  3MOR A;  3CH2 X;  3PDF A;  2ARY A;  2NQA A;  4YYU A;  2BTW B;  3IUT A;  5CVM A;  1KHP A;  3BY4 A;  2HH5 A;  1POP A;  4N4Z A;  2P0R A;  1VJV A;  1YK7 A;  5K16 A;  3RVW A;  1U9Q X;  1S4V A;  2DJF B;  4BOZ A;  2FUD A;  1YT7 A;  3BC3 A;  1F29 A;  2YJB A; 
#chains in the Genus database with same CATH homology
 2FYE A;  5CHT A;  5CHV A;  4KLB A;  3U8E A;  4BPV A;  4X6J A;  1AYV A;  1BGO A;  4MZO A;  1AU3 A;  2R9C A;  5A24 A;  3H6S A;  3I3T A;  1NB3 A;  4PP2 E;  1MIR A;  1AU0 A;  4YYS A;  2CIO A;  3RVX A;  4FJC A;  1MS6 A;  1CVZ A;  3MHH A;  3AI8 A;  4FK5 A;  3KW9 A;  3MHS A;  3IOQ A;  1ITO A;  4P6E A;  1XKG A;  2CB5 A;  2E00 A;  2R9O A;  2AYO A;  4HWY A;  3KWZ A;  3P5U A;  4W5C A;  3K8U A;  4OEL A;  5EGW A;  3F75 A;  1Y08 A;  3BOW A;  1E2T A;  1GMY A;  2FTD A;  2HD5 A;  3HHI A;  4AXM A;  1MEG A;  1GX3 A;  3QSD A;  3WXG A;  4GUZ A;  2YJ9 A;  3C9E A;  3H8B A;  4Q8G A;  3O1G A;  1CS8 A;  6PAD A;  2F1G A;  3BPF A;  3P5W A;  1W5R A;  3S3Q A;  2G7Y A;  2DCC A;  2R6N A;  9PAP A;  1CV8 A;  3DF0 A;  1PPO A;  3ZUA A;  1Q6K A;  1AIM A;  2VFC A;  2XU4 A;  2HXZ A;  1EWO A;  4YYR A;  5JA7 A;  4CZW A;  2VHF A;  2DCA A;  4YYW A;  1KXR A;  3V6E A;  3BCN A;  3OVZ A;  3N4C A;  4QRG A;  4PP1 A;  3NHE A;  3IHP A;  2NQG A;  2AS8 A;  1AEC A;  1THE A;  4CDF B;  4ZUX U;  1SNK A;  2YJC A;  8PCH A;  2F7D A;  1ME3 A;  2G6D A;  4PAD A;  5PAD A;  4K7C A;  2PNS A;  1PIP A;  2OZ2 A;  3WXE A;  4QRV A;  1ZIV A;  2GFO A;  1YAL A;  1Y4H A;  2DZZ A;  4NV7 A;  2AVW A;  4Q8H A;  4CDC B;  1W6F A;  4QH6 A;  2FT2 A;  4BGF A;  2R9M A;  3D9W A;  4XUI A;  4BSQ A;  1TL9 A;  2PAD A;  2DC6 A;  2PRE A;  1F2B A;  3TNX A;  5CVN B;  3OVX A;  1CB5 A;  3H8C A;  2AU1 A;  1EWP A;  3LFY A;  4YYQ A;  1QOL A;  1NL6 A;  2DC9 A;  2VFB A;  1PPN A;  1CSB B;  1X9Y A;  4BS6 A;  3HHA A;  2FQ9 A;  2FRQ A;  2YJ2 A;  1PPD A;  3KKU A;  3KWB X;  3PNR A;  3P5X A;  4I05 A;  2YJ8 A;  4YV8 A;  2BDL A;  1VSN A;  2NQI A;  2AIM A;  2BSZ A;  3N3K A;  1MHW A;  3KSE A;  2AUZ A;  3BPM A;  2P86 A;  1FH0 A;  1U9X A;  2ACT A;  4WA6 A;  1DEU A;  2XU1 A;  4NV8 A;  1AYW A;  2FO5 A;  2O6X A;  5CVO B;  4AXL A;  2Y6E A;  2FRA A;  2DCD A;  4YVA A;  3B79 A;  1IWD A;  2AUX A;  3RVV A;  2GHU A;  4X6I A;  1F2A A;  1ZCM A;  4CDE B;  2VHS A;  2Y5B A;  3P5V A;  4YYV A;  1STF E;  2P7U A;  3N3G A;  1MEM A;  2PBH A;  3I06 A;  2R9F A;  2G8E A;  2E03 A;  1ATK A;  4DMY A;  4FIP A;  1BQI A;  4MSX A;  3K24 A;  3D6S A;  3LXS A;  1F2C A;  1PXV A;  2JQG R;  3USV A;  1NB5 A;  1EWL A;  3IEJ A;  3OF9 A;  2B1M A;  5J94 A;  2C0Y A;  3CH3 X;  2DCB A;  2XU3 A;  3O0U A;  3GCB A;  1CPJ A;  2AYN A;  1KFX L;  1QXP A;  2R9N A;  4MZS A;  1GCB A;  2WBF X;  1GEC E;  2IPP B;  3PBH A;  4PI3 A;  1DF0 A;  2BDZ A;  4BS5 A;  4BQV A;  1GLO A;  1YK8 A;  1A6R A;  5FPW A;  2B1N A;  2E02 A;  2OP3 A;  4W5B A;  1BP4 A;  4XR7 A;  7PCK A;  1CJL A;  2DC8 A;  1KHQ A;  3H7D A;  1AU2 A;  3E1Z B;  4I04 A;  2DC7 A;  3WXF A;  5JH3 A;  1PBH A;  3M99 A;  4I07 A;  3H89 A;  2DJG B;  3MTN A;  4X6H A;  1AU4 A;  1CQD A;  2HHN A;  4W4U A;  3S3R A;  1ME4 A;  3LTW A;  2E01 A;  1M6D A;  3V6C A;  4DMX A;  3ERV A;  3QJ3 A;  1PE6 A;  1U9W A;  1K3B B;  3CBK A;  1NPZ A;  4N8W A;  1HUC B;  3QT4 A;  4P6G A;  1JQP A;  3IMA A;  5EF4 A;  2G8J A;  4B55 A;  3OF8 A;  1O0E A;  3OIS A;  4CDD B;  3KX1 A;  1QDQ A;  1TLO A;  3CBJ A;  3F5V A;  4QRX A;  1EF7 A;  4QBB A;  1EWM A;  1ICF A;  1NQC A;  1MDW A;  1PPP A;  1YVB A;  1KFU L;  4N79 A;  1CTE A;  2NQD B;  1PAD A;  2OUL A;  1U5I A;  1TU6 A;  2H7J A;  1AYU A;  2DZY A;  5F02 A;  1SP4 B;  4OEM A;  1BY8 A;  4C5P A;  1U9V A;  3PW3 A;  4RY2 A;  3K9M A;  3IV2 A;  2JQF R;  1QMY A;  4G54 A;  1PCI A;  2XU5 A;  3KFQ A;  3HD3 A;  3BWK A;  3HWN A;  1NLJ A;  1W4T A;  2ATO A;  2IBI A;  3MOR A;  3CH2 X;  3PDF A;  2ARY A;  2NQA A;  4YYU A;  3IUT A;  5CVM A;  1KHP A;  2HH5 A;  1POP A;  4N4Z A;  2P0R A;  1VJV A;  1YK7 A;  5K16 A;  3RVW A;  1U9Q X;  1S4V A;  2DJF B;  2FUD A;  1YT7 A;  3BC3 A;  1F29 A;  2YJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...