2DJFB

Crystal structure of human dipeptidyl peptidase i (cathepsin c) in complex with the inhibitor gly-phe-chn2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
161
structure length
161
Chain Sequence
LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Dipeptidyl-peptidase 1
publication title The crystal structure of human dipeptidyl peptidase I (cathepsin C) in complex with the inhibitor Gly-Phe-CHN2
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 161
sequence length 161
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2006-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2djfB01
1MEGA 1YVBA 4CDEB 2R9MA 2F1GA 2JQGR 2PREA 1HUCB 5CHTA 5EGWA 1GMYA 1M6DA 2NQIA 1DF0A 4PADA 2PNSA 4BQVA 2H7JA 2AUZA 1AU0A 1ZIVA 4PP1A 2PADA 4QH6A 1VSNA 3P5WA 1SNKA 2XU1A 1AYUA 1NB5A 1MDWA 1NB3A 4Q8GA 3H6SA 3P5VA 1U9QX 2YJCA 1PPDA 4BS5A 2JQFR 1AU2A 3OVXA 1GECE 2DJGB 2R9OA 1GCBA 4CDFB 4YYUA 1PE6A 1STFE 3KWBX 4W5CA 3TNXA 2YJ9A 1QOLA 4OEMA 2HXZA 4K7CA 2R6NA 3U8EA 4RY2A 3O0UA 3RVVA 1Y08A 4YYSA 3HHIA 4AXMA 2AVWA 2DZZA 1AIMA 2XU5A 2DJFB 4WA6A 3N3KA 3P5UA 1CPJA 3BPMA 1TLOA 3OVZA 3KKUA 2P0RA 1U9WA 1SP4B 1CSBB 4QBBA 2OZ2A 1A6RA 3PBHA 3HHAA 1PCIA 2HHNA 4P6EA 3BWKA 1EWOA 2FQ9A 1ME4A 2O6XA 3LXSA 3BC3A 5J94A 1KFUL 1Q6KA 2OP3A 4X6JA 3KWZA 2FYEA 1AYVA 4G54A 2R9NA 2ATOA 2E01A 1FH0A 2B1MA 2VHFA 3MORA 5CHVA 1EWLA 1PIPA 3N3GA 4CDCB 4MZSA 3MHSA 8PCHA 2FTDA 3H8BA 1CV8A 1F2CA 1BY8A 1S4VA 4BPVA 3F5VA 2DC7A 1ITOA 1GLOA 2CIOA 4YYRA 3PW3A 2P7UA 4PP2E 2FRAA 7PCKA 5JA7A 3B79A 1EWPA 2DZYA 4HWYA 1ME3A 2XU3A 1YK8A 2AU1A 1BQIA 4W4UA 2ARYA 2YJBA 3CH2X 3PNRA 1YK7A 1CVZA 1MS6A 2FRQA 3OF8A 3H8CA 4AXLA 1NLJA 1NPZA 4W5BA 1VJVA 3HWNA 2IPPB 5PADA 5JH3A 2GHUA 1MIRA 2IBIA 2NQDB 4BSQA 2ACTA 3WXFA 3M99A 1O0EA 3K24A 4Q8HA 4I04A 2AIMA 1AECA 1JQPA 1ZCMA 3BPFA 4YYVA 3OISA 2DC9A 3IEJA 3N4CA 1QMYA 1CB5A 4YYQA 2AS8A 1TL9A 3IV2A 3DF0A 3PDFA 4N4ZA 3K9MA 3CBJA 1PPNA 1CQDA 1BP4A 2DCAA 4BS6A 1F29A 1AYWA 3IOQA 3IUTA 3K8UA 4KLBA 3E1ZB 4PI3A 3V6CA 3CBKA 3F75A 2FO5A 4YVAA 9PAPA 3V6EA 1MHWA 3KW9A 4MZOA 3KSEA 3I3TA 1CS8A 1YALA 1KHPA 4X6IA 1IWDA 4QRGA 2GFOA 2CB5A 3BCNA 1Y4HA 2E00A 2BDZA 1MEMA 2DCCA 1EWMA 2HH5A 2DC6A 4I07A 1ICFA 3QT4A 3O1GA 4FK5A 4X6HA 2DCBA 1BGOA 3BOWA 1PADA 4OELA 3WXGA 2NQGA 3H89A 2FUDA 1U5IA 2P86A 1PXVA 3H7DA 1ATKA 4CZWA 2B1NA 5A24A 3QJ3A 3CH3X 3KX1A 1THEA 4CDDB 1TU6A 2XU4A 3P5XA 4YV8A 5F02A 5EF4A 3GCBA 1YT7A 4DMYA 1KHQA 4XUIA 1PBHA 3WXEA 2R9FA 1U9XA 2G8JA 4QRVA 1EF7A 3USVA 3IMAA 1F2BA 3NHEA 2YJ8A 1U9VA 1QXPA 3KFQA 2NQAA 2G8EA 1AU3A 4N8WA 2Y6EA 5CVMA 3S3QA 5FPWA 4P6GA 1PPPA 4DMXA 2F7DA 4I05A 2HD5A 3S3RA 5CVNB 3I06A 2DCDA 2G6DA 3RVXA 2FT2A 3MTNA 1K3BB 4XR7A 4YYWA 2R9CA 1XKGA 1KXRA 1NQCA 2E03A 2WBFX 3OF9A 3ERVA 1AU4A 2AUXA 2AYOA 2G7YA 1DEUA 1F2AA 3RVWA 4MSXA 3D6SA 4FJCA 1NL6A 1CTEA 3AI8A 1QDQA 4QRXA 6PADA 2DC8A 1POPA 5CVOB 1CJLA 2Y5BA 3HD3A 4N79A 2AYNA 2PBHA 3IHPA 5K16A 2YJ2A 2BDLA 3MHHA 2C0YA 1KFXL 3QSDA 2OULA 3ZUAA 4FIPA 1X9YA 1PPOA 2VHSA 4ZUXU 3C9EA 2E02A 3LFYA
chains in the Genus database with same CATH superfamily
1MEGA 1YVBA 4CDEB 2R9MA 2F1GA 2JQGR 2PREA 1HUCB 5CHTA 5EGWA 1GMYA 1M6DA 2NQIA 1DF0A 4PADA 2PNSA 4BQVA 2H7JA 2AUZA 4D8IA 1AU0A 1ZIVA 4R3DA 4PP1A 2PADA 5EZQA 4QH6A 1VSNA 3P5WA 1SNKA 2XU1A 1AYUA 1NB5A 1MDWA 1NB3A 4Q8GA 3H6SA 3P5VA 1U9QX 3O65A 2YJCA 5KO3A 1PPDA 3C0RA 4BS5A 3PRMA 5EZSA 2JQFR 1AU2A 3OVXA 1GECE 2DJGB 2R9OA 1GCBA 4CDFB 4YYUA 1PE6A 1STFE 3KWBX 4W5CA 3TNXA 2YJ9A 1QOLA 4OEMA 2HXZA 4K7CA 2R6NA 3U8EA 4RY2A 3O0UA 3RVVA 1Y08A 4YYSA 3HHIA 4AXMA 2AVWA 2DZZA 1AIMA 2XU5A 2DJFB 4WA6A 3N3KA 4P16A 3P5UA 1CPJA 3BPMA 1TLOA 3OVZA 3KKUA 2P0RA 1U9WA 1SP4B 1CSBB 4QBBA 2OZ2A 1A6RA 3PBHA 3HHAA 1PCIA 2HHNA 4P6EA 3BWKA 1EWOA 2FQ9A 1ME4A 2O6XA 3LXSA 3BC3A 5J94A 4RF0A 1KFUL 1Q6KA 3IFUA 2OP3A 4X6JA 3KWZA 2FYEA 1AYVA 4G54A 2R9NA 4HXDB 2BU3A 2ATOA 2E01A 1FH0A 2B1MA 2VHFA 3MORA 5CHVA 1EWLA 1PIPA 3N3GA 4CDCB 4MZSA 3MHSA 8PCHA 2FTDA 3H8BA 1CV8A 1F2CA 1BY8A 4IUMA 1YZBA 4WURA 1S4VA 4BPVA 3F5VA 2DC7A 1ITOA 1GLOA 2CIOA 4RNAA 4YYRA 3PW3A 2P7UA 4PP2E 2FRAA 4BOSA 7PCKA 5JA7A 3B79A 4A5UA 1EWPA 2DZYA 4HWYA 3BBAA 1ME3A 2XU3A 1YK8A 2AU1A 1BQIA 4W4UA 4OW0A 2ARYA 2YJBA 3CH2X 3PNRA 3TRKA 1YK7A 1CVZA 1MS6A 2FRQA 3OF8A 3H8CA 4AXLA 4BOUA 1NLJA 2BTWA 1NPZA 4W5BA 1VJVA 3HWNA 2J7QC 2IPPB 3W30A 5PADA 5JH3A 3ZNHA 2GHUA 1MIRA 1DKIA 2IBIA 4RF1A 2NQDB 3E9SA 4IP3A 4OVZB 4BSQA 2HWKA 2ACTA 3WXFA 3M99A 1O0EA 3K24A 4D8EA 4Q8HA 4I04A 2AIMA 1AECA 1JQPA 1ZCMA 3BPFA 4YYVA 3OISA 2DC9A 3IEJA 3N4CA 1QMYA 4REZA 1CB5A 4YYQA 2AS8A 1TL9A 2FE8A 3IV2A 3DF0A 3PDFA 4D8BA 4N4ZA 3K9MA 3CBJA 1PPNA 1CQDA 1BP4A 2DCAA 4BS6A 1F29A 1AYWA 4PT5A 3IOQA 3IUTA 3K8UA 3OQCA 4KLBA 4XZXA 3E1ZB 4PI3A 3V6CA 3CBKA 3F75A 2FO5A 4YVAA 9PAPA 3V6EA 1MHWA 3KW9A 4MZOA 3KSEA 3I3TA 1CS8A 1YALA 3MP2A 1KHPA 4X6IA 1IWDA 4QRGA 2GFOA 2CB5A 3BCNA 1Y4HA 3PHXA 2E00A 2BDZA 4RKXA 4BOZA 3PT2A 1MEMA 2DCCA 1EWMA 3PSEA 2HH5A 2DC6A 3TMPA 4I07A 1ICFA 3QT4A 3O1GA 4FK5A 3B21A 4X6HA 2DCBA 1BGOA 3BOWA 1PADA 4OELA 3WXGA 2NQGA 3H89A 2FUDA 1U5IA 2P86A 1PXVA 3PRPA 3H7DA 3PHWA 1ATKA 4CZWA 2B1NA 5A24A 3QJ3A 3CH3X 5E6JA 2BTWB 3KX1A 1THEA 4CDDB 1TU6A 2XU4A 3P5XA 4YV8A 5F02A 5EF4A 2J7QA 5JZEA 3GCBA 1YT7A 3MTVA 4DMYA 1KHQA 4XUIA 1PBHA 3WXEA 2R9FA 1U9XA 2G8JA 4QRVA 1EF7A 3USVA 3IMAA 1F2BA 3NHEA 2YJ8A 1U9VA 1QXPA 3KFQA 2NQAA 2G8EA 1AU3A 4N8WA 2Y6EA 5CVMA 3S3QA 5FPWA 1UKFA 4P6GA 1PPPA 4DMXA 2F7DA 4I05A 2HD5A 2JRIA 3S3RA 5CVNB 3I06A 4OVZA 2DCDA 2G6DA 3RVXA 2DOSA 3MJ5A 2FT2A 3MTNA 1K3BB 4XR7A 4YYWA 2R9CA 1XKGA 1KXRA 1NQCA 2E03A 2WBFX 3OF9A 2AGAA 3W31A 3ERVA 1AU4A 3RNVA 3BB7A 2AUXA 2JTCA 2AYOA 4MM3B 2G7YA 1DEUA 1F2AA 3RVWA 4BOPA 4MI7A 4MSXA 3D6SA 4FJCA 1NL6A 2Z84A 4GUAA 4M0WA 1CTEA 3AI8A 1PVJA 1QDQA 4QRXA 6PADA 2DC8A 1POPA 5CVOB 1CJLA 2Y5BA 3BY4A 3HD3A 4N79A 2AYNA 2UZJA 2PBHA 3IHPA 5K16A 2YJ2A 2BDLA 4BOQA 3MHHA 2C0YA 1KFXL 3QSDA 2OULA 3ZUAA 4FIPA 1X9YA 1PPOA 2VHSA 4ZUXU 3C9EA 2E02A 3LFYA 4ZTBA 3PHUA
chains in the Genus database with same CATH topology
1MEGA 1YVBA 4CDEB 2R9MA 2F1GA 2JQGR 2PREA 1HUCB 5CHTA 5EGWA 1GMYA 1M6DA 2NQIA 1DF0A 4PADA 2PNSA 4BQVA 2H7JA 2AUZA 1AU0A 1ZIVA 4PP1A 2PADA 4QH6A 1VSNA 3P5WA 1SNKA 2XU1A 1AYUA 1NB5A 1MDWA 1NB3A 4Q8GA 3H6SA 3P5VA 1U9QX 2YJCA 1PPDA 4BS5A 2JQFR 1AU2A 3OVXA 1GECE 2DJGB 2R9OA 1GCBA 4CDFB 4YYUA 1PE6A 1STFE 3KWBX 4W5CA 3TNXA 2YJ9A 1QOLA 4OEMA 2HXZA 2VFBA 4K7CA 2R6NA 3U8EA 4RY2A 3O0UA 3RVVA 1Y08A 4YYSA 3HHIA 4AXMA 2AVWA 2DZZA 1AIMA 2XU5A 2DJFB 4WA6A 2VFCA 3N3KA 3P5UA 1CPJA 3BPMA 1TLOA 3OVZA 3KKUA 2P0RA 1U9WA 1SP4B 1CSBB 4QBBA 2OZ2A 1A6RA 3PBHA 3HHAA 1PCIA 2HHNA 4P6EA 3BWKA 1EWOA 2FQ9A 1ME4A 2O6XA 3LXSA 3BC3A 5J94A 1KFUL 1Q6KA 2OP3A 4X6JA 3KWZA 2FYEA 1AYVA 4G54A 2R9NA 2ATOA 2E01A 1FH0A 2B1MA 2VHFA 3MORA 5CHVA 1EWLA 1PIPA 3N3GA 4CDCB 1E2TA 4MZSA 3MHSA 8PCHA 2FTDA 3H8BA 1CV8A 1F2CA 1BY8A 1S4VA 4BPVA 3F5VA 2DC7A 1ITOA 1GLOA 2CIOA 4YYRA 3PW3A 2P7UA 4PP2E 2FRAA 7PCKA 5JA7A 3B79A 1EWPA 2DZYA 4HWYA 1ME3A 2XU3A 1YK8A 2AU1A 1BQIA 4W4UA 2ARYA 2YJBA 3CH2X 3PNRA 1YK7A 1CVZA 4C5PA 1MS6A 2FRQA 3OF8A 3H8CA 4AXLA 1NLJA 1NPZA 4W5BA 1VJVA 3HWNA 2IPPB 5PADA 5JH3A 4NV7A 2GHUA 1MIRA 2IBIA 2NQDB 1GX3A 4BSQA 2ACTA 3WXFA 3M99A 1O0EA 3K24A 4Q8HA 4I04A 2AIMA 1AECA 1JQPA 1ZCMA 2BSZA 3BPFA 4YYVA 3OISA 2DC9A 3IEJA 3N4CA 1QMYA 1CB5A 4YYQA 2AS8A 1TL9A 3IV2A 3DF0A 3PDFA 4N4ZA 3K9MA 3CBJA 1PPNA 1CQDA 1W6FA 1BP4A 2DCAA 4BS6A 1F29A 1AYWA 4B55A 3IOQA 3IUTA 3K8UA 4KLBA 3E1ZB 4PI3A 3V6CA 3CBKA 3F75A 2FO5A 4YVAA 9PAPA 3V6EA 1MHWA 3KW9A 4MZOA 3KSEA 3I3TA 1CS8A 1YALA 1KHPA 4X6IA 1IWDA 4QRGA 2GFOA 2CB5A 3BCNA 1Y4HA 2E00A 2BDZA 1MEMA 2DCCA 1EWMA 2HH5A 2DC6A 4I07A 1ICFA 3QT4A 3O1GA 4FK5A 4X6HA 2DCBA 1BGOA 3BOWA 1PADA 4OELA 3WXGA 2NQGA 3H89A 2FUDA 1U5IA 2P86A 1PXVA 1W4TA 3H7DA 1ATKA 4CZWA 2B1NA 5A24A 3QJ3A 3CH3X 3KX1A 1THEA 4CDDB 1TU6A 2XU4A 3P5XA 4YV8A 5F02A 5EF4A 3GCBA 1YT7A 4DMYA 1KHQA 4XUIA 1PBHA 3WXEA 2R9FA 1U9XA 2G8JA 4QRVA 1EF7A 3USVA 3IMAA 1F2BA 3NHEA 4BGFA 2YJ8A 1U9VA 1QXPA 3KFQA 2NQAA 3D9WA 2G8EA 1AU3A 4N8WA 2Y6EA 1W5RA 5CVMA 3S3QA 5FPWA 4P6GA 1PPPA 4DMXA 2F7DA 4I05A 2HD5A 3S3RA 5CVNB 3I06A 2DCDA 2G6DA 3RVXA 2FT2A 4NV8A 3MTNA 1K3BB 4XR7A 4YYWA 2R9CA 1XKGA 1KXRA 1NQCA 2E03A 2WBFX 3OF9A 3ERVA 1AU4A 4GUZA 2AUXA 2AYOA 2G7YA 1DEUA 1F2AA 3RVWA 3LTWA 4MSXA 3D6SA 4FJCA 1NL6A 1CTEA 3AI8A 1QDQA 4QRXA 6PADA 2DC8A 1POPA 5CVOB 1CJLA 2Y5BA 3HD3A 4N79A 2AYNA 2PBHA 3IHPA 5K16A 2YJ2A 2BDLA 3MHHA 2C0YA 1KFXL 3QSDA 2OULA 3ZUAA 4FIPA 1X9YA 1PPOA 2VHSA 4ZUXU 3C9EA 2E02A 3LFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEG A;  1YVB A;  4CDE B;  2R9M A;  2F1G A;  2JQG R;  2PRE A;  1HUC B;  5CHT A;  5EGW A;  1GMY A;  1M6D A;  2NQI A;  1DF0 A;  4PAD A;  2PNS A;  4BQV A;  2H7J A;  2AUZ A;  1AU0 A;  1ZIV A;  4PP1 A;  2PAD A;  4QH6 A;  1VSN A;  3P5W A;  1SNK A;  2XU1 A;  1AYU A;  1NB5 A;  1MDW A;  1NB3 A;  4Q8G A;  3H6S A;  3P5V A;  1U9Q X;  2YJC A;  1PPD A;  4BS5 A;  2JQF R;  1AU2 A;  3OVX A;  1GEC E;  2DJG B;  2R9O A;  1GCB A;  4CDF B;  4YYU A;  1PE6 A;  1STF E;  3KWB X;  4W5C A;  3TNX A;  2YJ9 A;  1QOL A;  4OEM A;  2HXZ A;  4K7C A;  2R6N A;  3U8E A;  4RY2 A;  3O0U A;  3RVV A;  1Y08 A;  4YYS A;  3HHI A;  4AXM A;  2AVW A;  2DZZ A;  1AIM A;  2XU5 A;  2DJF B;  4WA6 A;  3N3K A;  3P5U A;  1CPJ A;  3BPM A;  1TLO A;  3OVZ A;  3KKU A;  2P0R A;  1U9W A;  1SP4 B;  1CSB B;  4QBB A;  2OZ2 A;  1A6R A;  3PBH A;  3HHA A;  1PCI A;  2HHN A;  4P6E A;  3BWK A;  1EWO A;  2FQ9 A;  1ME4 A;  2O6X A;  3LXS A;  3BC3 A;  5J94 A;  1KFU L;  1Q6K A;  2OP3 A;  4X6J A;  3KWZ A;  2FYE A;  1AYV A;  4G54 A;  2R9N A;  2ATO A;  2E01 A;  1FH0 A;  2B1M A;  2VHF A;  3MOR A;  5CHV A;  1EWL A;  1PIP A;  3N3G A;  4CDC B;  4MZS A;  3MHS A;  8PCH A;  2FTD A;  3H8B A;  1CV8 A;  1F2C A;  1BY8 A;  1S4V A;  4BPV A;  3F5V A;  2DC7 A;  1ITO A;  1GLO A;  2CIO A;  4YYR A;  3PW3 A;  2P7U A;  4PP2 E;  2FRA A;  7PCK A;  5JA7 A;  3B79 A;  1EWP A;  2DZY A;  4HWY A;  1ME3 A;  2XU3 A;  1YK8 A;  2AU1 A;  1BQI A;  4W4U A;  2ARY A;  2YJB A;  3CH2 X;  3PNR A;  1YK7 A;  1CVZ A;  1MS6 A;  2FRQ A;  3OF8 A;  3H8C A;  4AXL A;  1NLJ A;  1NPZ A;  4W5B A;  1VJV A;  3HWN A;  2IPP B;  5PAD A;  5JH3 A;  2GHU A;  1MIR A;  2IBI A;  2NQD B;  4BSQ A;  2ACT A;  3WXF A;  3M99 A;  1O0E A;  3K24 A;  4Q8H A;  4I04 A;  2AIM A;  1AEC A;  1JQP A;  1ZCM A;  3BPF A;  4YYV A;  3OIS A;  2DC9 A;  3IEJ A;  3N4C A;  1QMY A;  1CB5 A;  4YYQ A;  2AS8 A;  1TL9 A;  3IV2 A;  3DF0 A;  3PDF A;  4N4Z A;  3K9M A;  3CBJ A;  1PPN A;  1CQD A;  1BP4 A;  2DCA A;  4BS6 A;  1F29 A;  1AYW A;  3IOQ A;  3IUT A;  3K8U A;  4KLB A;  3E1Z B;  4PI3 A;  3V6C A;  3CBK A;  3F75 A;  2FO5 A;  4YVA A;  9PAP A;  3V6E A;  1MHW A;  3KW9 A;  4MZO A;  3KSE A;  3I3T A;  1CS8 A;  1YAL A;  1KHP A;  4X6I A;  1IWD A;  4QRG A;  2GFO A;  2CB5 A;  3BCN A;  1Y4H A;  2E00 A;  2BDZ A;  1MEM A;  2DCC A;  1EWM A;  2HH5 A;  2DC6 A;  4I07 A;  1ICF A;  3QT4 A;  3O1G A;  4FK5 A;  4X6H A;  2DCB A;  1BGO A;  3BOW A;  1PAD A;  4OEL A;  3WXG A;  2NQG A;  3H89 A;  2FUD A;  1U5I A;  2P86 A;  1PXV A;  3H7D A;  1ATK A;  4CZW A;  2B1N A;  5A24 A;  3QJ3 A;  3CH3 X;  3KX1 A;  1THE A;  4CDD B;  1TU6 A;  2XU4 A;  3P5X A;  4YV8 A;  5F02 A;  5EF4 A;  3GCB A;  1YT7 A;  4DMY A;  1KHQ A;  4XUI A;  1PBH A;  3WXE A;  2R9F A;  1U9X A;  2G8J A;  4QRV A;  1EF7 A;  3USV A;  3IMA A;  1F2B A;  3NHE A;  2YJ8 A;  1U9V A;  1QXP A;  3KFQ A;  2NQA A;  2G8E A;  1AU3 A;  4N8W A;  2Y6E A;  5CVM A;  3S3Q A;  5FPW A;  4P6G A;  1PPP A;  4DMX A;  2F7D A;  4I05 A;  2HD5 A;  3S3R A;  5CVN B;  3I06 A;  2DCD A;  2G6D A;  3RVX A;  2FT2 A;  3MTN A;  1K3B B;  4XR7 A;  4YYW A;  2R9C A;  1XKG A;  1KXR A;  1NQC A;  2E03 A;  2WBF X;  3OF9 A;  3ERV A;  1AU4 A;  2AUX A;  2AYO A;  2G7Y A;  1DEU A;  1F2A A;  3RVW A;  4MSX A;  3D6S A;  4FJC A;  1NL6 A;  1CTE A;  3AI8 A;  1QDQ A;  4QRX A;  6PAD A;  2DC8 A;  1POP A;  5CVO B;  1CJL A;  2Y5B A;  3HD3 A;  4N79 A;  2AYN A;  2PBH A;  3IHP A;  5K16 A;  2YJ2 A;  2BDL A;  3MHH A;  2C0Y A;  1KFX L;  3QSD A;  2OUL A;  3ZUA A;  4FIP A;  1X9Y A;  1PPO A;  2VHS A;  4ZUX U;  3C9E A;  2E02 A;  3LFY A; 
#chains in the Genus database with same CATH topology
 1MEG A;  1YVB A;  4CDE B;  2R9M A;  2F1G A;  2JQG R;  2PRE A;  1HUC B;  5CHT A;  5EGW A;  1GMY A;  1M6D A;  2NQI A;  1DF0 A;  4PAD A;  2PNS A;  4BQV A;  2H7J A;  2AUZ A;  4D8I A;  1AU0 A;  1ZIV A;  4R3D A;  4PP1 A;  2PAD A;  5EZQ A;  4QH6 A;  1VSN A;  3P5W A;  1SNK A;  2XU1 A;  1AYU A;  1NB5 A;  1MDW A;  1NB3 A;  4Q8G A;  3H6S A;  3P5V A;  1U9Q X;  3O65 A;  2YJC A;  5KO3 A;  1PPD A;  3C0R A;  4BS5 A;  3PRM A;  5EZS A;  2JQF R;  1AU2 A;  3OVX A;  1GEC E;  2DJG B;  2R9O A;  1GCB A;  4CDF B;  4YYU A;  1PE6 A;  1STF E;  3KWB X;  4W5C A;  3TNX A;  2YJ9 A;  1QOL A;  4OEM A;  2HXZ A;  4K7C A;  2R6N A;  3U8E A;  4RY2 A;  3O0U A;  3RVV A;  1Y08 A;  4YYS A;  3HHI A;  4AXM A;  2AVW A;  2DZZ A;  1AIM A;  2XU5 A;  2DJF B;  4WA6 A;  3N3K A;  4P16 A;  3P5U A;  1CPJ A;  3BPM A;  1TLO A;  3OVZ A;  3KKU A;  2P0R A;  1U9W A;  1SP4 B;  1CSB B;  4QBB A;  2OZ2 A;  1A6R A;  3PBH A;  3HHA A;  1PCI A;  2HHN A;  4P6E A;  3BWK A;  1EWO A;  2FQ9 A;  1ME4 A;  2O6X A;  3LXS A;  3BC3 A;  5J94 A;  4RF0 A;  1KFU L;  1Q6K A;  3IFU A;  2OP3 A;  4X6J A;  3KWZ A;  2FYE A;  1AYV A;  4G54 A;  2R9N A;  4HXD B;  2BU3 A;  2ATO A;  2E01 A;  1FH0 A;  2B1M A;  2VHF A;  3MOR A;  5CHV A;  1EWL A;  1PIP A;  3N3G A;  4CDC B;  4MZS A;  3MHS A;  8PCH A;  2FTD A;  3H8B A;  1CV8 A;  1F2C A;  1BY8 A;  4IUM A;  1YZB A;  4WUR A;  1S4V A;  4BPV A;  3F5V A;  2DC7 A;  1ITO A;  1GLO A;  2CIO A;  4RNA A;  4YYR A;  3PW3 A;  2P7U A;  4PP2 E;  2FRA A;  4BOS A;  7PCK A;  5JA7 A;  3B79 A;  4A5U A;  1EWP A;  2DZY A;  4HWY A;  3BBA A;  1ME3 A;  2XU3 A;  1YK8 A;  2AU1 A;  1BQI A;  4W4U A;  4OW0 A;  2ARY A;  2YJB A;  3CH2 X;  3PNR A;  3TRK A;  1YK7 A;  1CVZ A;  1MS6 A;  2FRQ A;  3OF8 A;  3H8C A;  4AXL A;  4BOU A;  1NLJ A;  2BTW A;  1NPZ A;  4W5B A;  1VJV A;  3HWN A;  2J7Q C;  2IPP B;  3W30 A;  5PAD A;  5JH3 A;  3ZNH A;  2GHU A;  1MIR A;  1DKI A;  2IBI A;  4RF1 A;  2NQD B;  3E9S A;  4IP3 A;  4OVZ B;  4BSQ A;  2HWK A;  2ACT A;  3WXF A;  3M99 A;  1O0E A;  3K24 A;  4D8E A;  4Q8H A;  4I04 A;  2AIM A;  1AEC A;  1JQP A;  1ZCM A;  3BPF A;  4YYV A;  3OIS A;  2DC9 A;  3IEJ A;  3N4C A;  1QMY A;  4REZ A;  1CB5 A;  4YYQ A;  2AS8 A;  1TL9 A;  2FE8 A;  3IV2 A;  3DF0 A;  3PDF A;  4D8B A;  4N4Z A;  3K9M A;  3CBJ A;  1PPN A;  1CQD A;  1BP4 A;  2DCA A;  4BS6 A;  1F29 A;  1AYW A;  4PT5 A;  3IOQ A;  3IUT A;  3K8U A;  3OQC A;  4KLB A;  4XZX A;  3E1Z B;  4PI3 A;  3V6C A;  3CBK A;  3F75 A;  2FO5 A;  4YVA A;  9PAP A;  3V6E A;  1MHW A;  3KW9 A;  4MZO A;  3KSE A;  3I3T A;  1CS8 A;  1YAL A;  3MP2 A;  1KHP A;  4X6I A;  1IWD A;  4QRG A;  2GFO A;  2CB5 A;  3BCN A;  1Y4H A;  3PHX A;  2E00 A;  2BDZ A;  4RKX A;  4BOZ A;  3PT2 A;  1MEM A;  2DCC A;  1EWM A;  3PSE A;  2HH5 A;  2DC6 A;  3TMP A;  4I07 A;  1ICF A;  3QT4 A;  3O1G A;  4FK5 A;  3B21 A;  4X6H A;  2DCB A;  1BGO A;  3BOW A;  1PAD A;  4OEL A;  3WXG A;  2NQG A;  3H89 A;  2FUD A;  1U5I A;  2P86 A;  1PXV A;  3PRP A;  3H7D A;  3PHW A;  1ATK A;  4CZW A;  2B1N A;  5A24 A;  3QJ3 A;  3CH3 X;  5E6J A;  2BTW B;  3KX1 A;  1THE A;  4CDD B;  1TU6 A;  2XU4 A;  3P5X A;  4YV8 A;  5F02 A;  5EF4 A;  2J7Q A;  5JZE A;  3GCB A;  1YT7 A;  3MTV A;  4DMY A;  1KHQ A;  4XUI A;  1PBH A;  3WXE A;  2R9F A;  1U9X A;  2G8J A;  4QRV A;  1EF7 A;  3USV A;  3IMA A;  1F2B A;  3NHE A;  2YJ8 A;  1U9V A;  1QXP A;  3KFQ A;  2NQA A;  2G8E A;  1AU3 A;  4N8W A;  2Y6E A;  5CVM A;  3S3Q A;  5FPW A;  1UKF A;  4P6G A;  1PPP A;  4DMX A;  2F7D A;  4I05 A;  2HD5 A;  2JRI A;  3S3R A;  5CVN B;  3I06 A;  4OVZ A;  2DCD A;  2G6D A;  3RVX A;  2DOS A;  3MJ5 A;  2FT2 A;  3MTN A;  1K3B B;  4XR7 A;  4YYW A;  2R9C A;  1XKG A;  1KXR A;  1NQC A;  2E03 A;  2WBF X;  3OF9 A;  2AGA A;  3W31 A;  3ERV A;  1AU4 A;  3RNV A;  3BB7 A;  2AUX A;  2JTC A;  2AYO A;  4MM3 B;  2G7Y A;  1DEU A;  1F2A A;  3RVW A;  4BOP A;  4MI7 A;  4MSX A;  3D6S A;  4FJC A;  1NL6 A;  2Z84 A;  4GUA A;  4M0W A;  1CTE A;  3AI8 A;  1PVJ A;  1QDQ A;  4QRX A;  6PAD A;  2DC8 A;  1POP A;  5CVO B;  1CJL A;  2Y5B A;  3BY4 A;  3HD3 A;  4N79 A;  2AYN A;  2UZJ A;  2PBH A;  3IHP A;  5K16 A;  2YJ2 A;  2BDL A;  4BOQ A;  3MHH A;  2C0Y A;  1KFX L;  3QSD A;  2OUL A;  3ZUA A;  4FIP A;  1X9Y A;  1PPO A;  2VHS A;  4ZUX U;  3C9E A;  2E02 A;  3LFY A;  4ZTB A;  3PHU A; 
#chains in the Genus database with same CATH homology
 1MEG A;  1YVB A;  4CDE B;  2R9M A;  2F1G A;  2JQG R;  2PRE A;  1HUC B;  5CHT A;  5EGW A;  1GMY A;  1M6D A;  2NQI A;  1DF0 A;  4PAD A;  2PNS A;  4BQV A;  2H7J A;  2AUZ A;  1AU0 A;  1ZIV A;  4PP1 A;  2PAD A;  4QH6 A;  1VSN A;  3P5W A;  1SNK A;  2XU1 A;  1AYU A;  1NB5 A;  1MDW A;  1NB3 A;  4Q8G A;  3H6S A;  3P5V A;  1U9Q X;  2YJC A;  1PPD A;  4BS5 A;  2JQF R;  1AU2 A;  3OVX A;  1GEC E;  2DJG B;  2R9O A;  1GCB A;  4CDF B;  4YYU A;  1PE6 A;  1STF E;  3KWB X;  4W5C A;  3TNX A;  2YJ9 A;  1QOL A;  4OEM A;  2HXZ A;  2VFB A;  4K7C A;  2R6N A;  3U8E A;  4RY2 A;  3O0U A;  3RVV A;  1Y08 A;  4YYS A;  3HHI A;  4AXM A;  2AVW A;  2DZZ A;  1AIM A;  2XU5 A;  2DJF B;  4WA6 A;  2VFC A;  3N3K A;  3P5U A;  1CPJ A;  3BPM A;  1TLO A;  3OVZ A;  3KKU A;  2P0R A;  1U9W A;  1SP4 B;  1CSB B;  4QBB A;  2OZ2 A;  1A6R A;  3PBH A;  3HHA A;  1PCI A;  2HHN A;  4P6E A;  3BWK A;  1EWO A;  2FQ9 A;  1ME4 A;  2O6X A;  3LXS A;  3BC3 A;  5J94 A;  1KFU L;  1Q6K A;  2OP3 A;  4X6J A;  3KWZ A;  2FYE A;  1AYV A;  4G54 A;  2R9N A;  2ATO A;  2E01 A;  1FH0 A;  2B1M A;  2VHF A;  3MOR A;  5CHV A;  1EWL A;  1PIP A;  3N3G A;  4CDC B;  1E2T A;  4MZS A;  3MHS A;  8PCH A;  2FTD A;  3H8B A;  1CV8 A;  1F2C A;  1BY8 A;  1S4V A;  4BPV A;  3F5V A;  2DC7 A;  1ITO A;  1GLO A;  2CIO A;  4YYR A;  3PW3 A;  2P7U A;  4PP2 E;  2FRA A;  7PCK A;  5JA7 A;  3B79 A;  1EWP A;  2DZY A;  4HWY A;  1ME3 A;  2XU3 A;  1YK8 A;  2AU1 A;  1BQI A;  4W4U A;  2ARY A;  2YJB A;  3CH2 X;  3PNR A;  1YK7 A;  1CVZ A;  4C5P A;  1MS6 A;  2FRQ A;  3OF8 A;  3H8C A;  4AXL A;  1NLJ A;  1NPZ A;  4W5B A;  1VJV A;  3HWN A;  2IPP B;  5PAD A;  5JH3 A;  4NV7 A;  2GHU A;  1MIR A;  2IBI A;  2NQD B;  1GX3 A;  4BSQ A;  2ACT A;  3WXF A;  3M99 A;  1O0E A;  3K24 A;  4Q8H A;  4I04 A;  2AIM A;  1AEC A;  1JQP A;  1ZCM A;  2BSZ A;  3BPF A;  4YYV A;  3OIS A;  2DC9 A;  3IEJ A;  3N4C A;  1QMY A;  1CB5 A;  4YYQ A;  2AS8 A;  1TL9 A;  3IV2 A;  3DF0 A;  3PDF A;  4N4Z A;  3K9M A;  3CBJ A;  1PPN A;  1CQD A;  1W6F A;  1BP4 A;  2DCA A;  4BS6 A;  1F29 A;  1AYW A;  4B55 A;  3IOQ A;  3IUT A;  3K8U A;  4KLB A;  3E1Z B;  4PI3 A;  3V6C A;  3CBK A;  3F75 A;  2FO5 A;  4YVA A;  9PAP A;  3V6E A;  1MHW A;  3KW9 A;  4MZO A;  3KSE A;  3I3T A;  1CS8 A;  1YAL A;  1KHP A;  4X6I A;  1IWD A;  4QRG A;  2GFO A;  2CB5 A;  3BCN A;  1Y4H A;  2E00 A;  2BDZ A;  1MEM A;  2DCC A;  1EWM A;  2HH5 A;  2DC6 A;  4I07 A;  1ICF A;  3QT4 A;  3O1G A;  4FK5 A;  4X6H A;  2DCB A;  1BGO A;  3BOW A;  1PAD A;  4OEL A;  3WXG A;  2NQG A;  3H89 A;  2FUD A;  1U5I A;  2P86 A;  1PXV A;  1W4T A;  3H7D A;  1ATK A;  4CZW A;  2B1N A;  5A24 A;  3QJ3 A;  3CH3 X;  3KX1 A;  1THE A;  4CDD B;  1TU6 A;  2XU4 A;  3P5X A;  4YV8 A;  5F02 A;  5EF4 A;  3GCB A;  1YT7 A;  4DMY A;  1KHQ A;  4XUI A;  1PBH A;  3WXE A;  2R9F A;  1U9X A;  2G8J A;  4QRV A;  1EF7 A;  3USV A;  3IMA A;  1F2B A;  3NHE A;  4BGF A;  2YJ8 A;  1U9V A;  1QXP A;  3KFQ A;  2NQA A;  3D9W A;  2G8E A;  1AU3 A;  4N8W A;  2Y6E A;  1W5R A;  5CVM A;  3S3Q A;  5FPW A;  4P6G A;  1PPP A;  4DMX A;  2F7D A;  4I05 A;  2HD5 A;  3S3R A;  5CVN B;  3I06 A;  2DCD A;  2G6D A;  3RVX A;  2FT2 A;  4NV8 A;  3MTN A;  1K3B B;  4XR7 A;  4YYW A;  2R9C A;  1XKG A;  1KXR A;  1NQC A;  2E03 A;  2WBF X;  3OF9 A;  3ERV A;  1AU4 A;  4GUZ A;  2AUX A;  2AYO A;  2G7Y A;  1DEU A;  1F2A A;  3RVW A;  3LTW A;  4MSX A;  3D6S A;  4FJC A;  1NL6 A;  1CTE A;  3AI8 A;  1QDQ A;  4QRX A;  6PAD A;  2DC8 A;  1POP A;  5CVO B;  1CJL A;  2Y5B A;  3HD3 A;  4N79 A;  2AYN A;  2PBH A;  3IHP A;  5K16 A;  2YJ2 A;  2BDL A;  3MHH A;  2C0Y A;  1KFX L;  3QSD A;  2OUL A;  3ZUA A;  4FIP A;  1X9Y A;  1PPO A;  2VHS A;  4ZUX U;  3C9E A;  2E02 A;  3LFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...