2HWKA

Crystal structure of venezuelan equine encephalitis alphavirus nsp2 protease domain
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords helicase nsP2
publication title The Crystal Structure of the Venezuelan Equine Encephalitis Alphavirus nsP2 Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain tc-83)
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2hwkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2hwkA01
3DULA 5FQOA 5KYGA 4RTMA 2FHPA 3A25A 4YMGA 5P8WA 1G6Q1 1BKYA 1P91A 4PYMA 4POOA 1RI1A 2PY6A 2BR5A 2ZZKA 2BM8A 3SMQA 1KYZA 4PIMA 4Z2YA 4HTFB 2CKDA 2XYRA 4R6XA 5KQSA 2XYQA 4DF3A 3LKDA 1G55A 3CGGA 4BP3A 2GLUA 5HIIA 4E70A 3SSNA 2VDVE 3PT9A 3SX0A 4RYLA 3PX2A 2CWWA 5T64A 1VL5A 3RIEA 5DX8A 1R6AA 3I5UA 1Q0TA 5BW5A 3NW9A 1ZHFA 5E2AA 1MJFA 1D2HA 3LECA 3UFBA 1Y8CA 3V97A 4DM3A 4ER6A 1PRYA 2PV0A 5FUBA 1RI4A 5T67A 2H11A 2R3SA 2ZSUA 4C04A 4FSDA 1WS6A 4M38A 1G8SA 5F2KA 3SVZA 1SQFA 3CKKA 3DLCA 3G89A 3IV6A 3L8DA 4GOLD 4OBXA 5DRTA 4DZRA 3M70A 3NVKI 1N2XA 4YUZA 2F8LA 4RWZA 2GAFA 2AZTA 3B3FA 5E1BA 5EIWA 4RTKA 4QPPA 1KHHA 1WY7A 3TM4A 1VQ1A 5K0GA 4CKCA 2AVNA 4AZTA 4YV1A 2G1PA 3T7RA 2DULA 1SUIA 2Y1WA 1ORIA 3CJQA 2P3QA 5FCDA 3MTEA 4RTRA 2CL5A 2ZULA 1QAQA 4CWAA 3THRA 5FA8A 1X1BA 4KIFA 3JWJA 3HCAA 2OO3A 4X1OA 4E32A 2UZ4A 3FUXA 3EVEA 3SSMA 2AOUA 2P40A 4QPNA 5K0NA 3T0IA 4E30A 2CMHA 3P97A 4BLVA 2XVAA 3EMDA 4GOMD 2HR1A 1G38A 1R00A 2IFTA 5FWAA 5EZQA 2PLWA 2ZBPA 1IM8A 4ER5A 1QYRA 2YVLA 5ICCA 5DM4A 5HEKA 1AQJA 2C7PA 1AV6A 3EVZA 4GUAA 3A27A 5IKMA 2QRVB 4RTOA 2G72A 4RTNA 4QDKA 1XTPA 2NXCA 1KP9A 1SVUA 2BR3A 1YZ3A 3NWBA 4IWNA 4V0QA 3U81A 5GIOE 1ZQ9A 4V0RA 1ZGAA 2HWKA 3ME5A 2BM9A 1L1EA 3ORHA 2HNKA 3HVKA 4RTJA 3G2QA 5K03A 4LG1A 2ESRA 3FTEA 1VIDA 3E05A 3KQQA 3M6VA 1KPGA 3KPWA 3R9XB 2LD4A 3UJ9A 1Q0SA 3BGVA 5DPMA 3MB5A 3BUSA 2AOTB 3KR1A 4AZWA 4E2ZA 5HZMA 5BXYA 1TW2A 1N7IA 2C7RA 3UJAA 1PJZA 2FK7A 4MWZA 4X61A 5F2NA 2C7QA 2GH1A 2QM3A 1DL5A 4HGYA 4L7VA 4ER3A 5K05A 1T43A 5EHIA 3QOWA 2ZW9A 3OE5A 3UJBA 1ZKDA 2AN4A 4P7GA 3CCFA 4GQBA 3VSEA 5HIMA 3P71T 2GPYA 1UFKA 4QDJA 4XUCA 5C1IA 5CVDA 2B25A 2B78A 3ELYA 5DTMA 2OXTA 1V39A 2GS9A 3AXSA 2ONYA 2XBMA 4XUEA 2YXDA 2JHPA 3ID6C 3TFWA 7MHTA 3BKXA 3FZGA 3OFKA 4ER0A 3A4TA 3M6XA 4F86A 1VP9A 1JG1A 1F3LA 3CVOA 4PYKA 5EG5A 10MHA 5HIJA 3KQYA 2FCAA 3BXOA 1B42A 3EVBA 3G5TA 5LQKA 1HNNA 3G2PA 3MERA 5E9WA 5K0LA 5DTQA 5FHQA 3PTAA 3I53A 4PYOA 2PKWA 3PLAE 3FUWA 5CCBA 2PX4A 3KQTA 3M33A 4LECA 4DA4A 5EMJA 1JG4A 2IP2A 3M6UA 2R6ZA 3A7DA 4C05A 1NW6A 1VE3A 4EKGA 2BZGA 2IIPA 3DUWA 2OYRA 2CMGA 3KHKA 3HNRA 1L3IA 1TW3A 1XCLA 3LBYA 2KW5A 2YX1A 3MAGA 3AY0A 4OQEA 5K01A 5DT2A 3A7EA 5E8JA 3UA4A 3GJYA 3GRUA 3UWPA 2HTEA 1EJ0A 5CVEA 2OPBA 1X19A 3PX3A 2ADMA 4KWCA 4GOOD 5ICFA 3FPGA 1D2GA 2ZFUA 3ELDA 3GWZA 2ZLBA 5E2BA 1KPIA 5EPEA 1EAMA 1EJ6A 2PX5A 2IH5A 5D1HA 1G8AA 2I6GA 2AVDA 5ICGA 3BWBA 2PXCA 4H0NA 4RVHA 3OU6A 1NW8A 5EKXA 3R3HA 3AXTA 4ATNA 2ERCA 2PX2A 3I64A 2PGXA 3IEIA 3P9KA 3ANXA 5CCXA 5IH3A 4PNEA 1JTEA 4IV0A 3UJDA 4OA8A 1FPQA 5DRYA 3PFHA 1WZNA 2I7CA 4GBED 3P9CA 4XCXA 2ONZA 5GOZA 4HGZA 1YF3A 1QAOA 2ZIEA 5EEHA 3R24A 2UYCA 3Q7EA 1FP2A 4FT4A 2IH2A 1TPYA 5BP7A 4M36A 3ER8A 2O06A 4E2XA 5T6BA 3KPJA 5GP1A 3IYLW 2PX8A 2P7IA 4PINA 1FBNA 2ZTHA 4PWYA 5FQNA 1X1DA 1NE2A 5CVJA 3GDHA 3G88A 2PVCA 1INLA 2V7EA 4CKBA 5KVAA 3GRYA 1IY9A 4RV9A 2Z6QA 2EFJA 2GA9A 3PB3A 3ELUA 4KDRA 5DWQA 4KW7A 3KQWA 4M37A 1KYWA 4CTKA 4DCGA 4E2YA 2ZCJA 5KQRA 4QTUB 2FRXA 3EGEA 3GNLA 3K0BA 3TKAA 5LQNA 2FPOA 3GCZA 4F85A 5CIYA 4OQDA 3UZUA 4PYIA 5H02A 2N47A 3OZRA 4AZVA 2YUIA 3O31A 1VBFA 3TRKA 5U4XA 3GRRA 3B3JA 3KR9A 5E1DA 4IV8A 3UJ7A 1M6EX 1QANA 5GWXA 3OCJA 5LQRA 5GIPE 1X1CA 3OU2A 3DMGA 4RVDA 2NXNA 5GINE 2NP7A 1JG3A 3HVIA 2PT9A 2BR4A 3EVGA 5DM0A 3WSTA 3LDFA 5K0JA 2UYOA 4RTSA 3D2LA 4YUYA 2V74B 4XUDA 2XYVA 3KPYA 3P2IA 3TOSA 3R6TA 4EKIA 5DXJA 2YXLA 1RJDA 3OE4A 3ERCA 2FYTA 1G60A 2PWYA 3E8SA 3NDIA 2IH4A 5D1NA 2FK8A 1L9KA 5JUWA 1DCTA 2O57A 3B89A 3G8AA 3JWGA 5DTRA 5DM2A 1M6YA 4GC9A 1YUBA 3NJRA 4HSGA 4K6MA 3EVCA 3LCVB 2IBTA 5EVJA 2WA1A 3VC2A 3CBGA 4PGGA 2Q41A 2I62A 3HVHA 4QQNA 2AOUB 4BP1A 1P1BA 3KR0A 4PONA 4HH4A 1P1CA 1RI5A 4X41A 2K4MA 2AN3A 3UBTA 3NVMB 1RJGA 2NXJA 4YUXA 3LDUA 1VLMA 5E9JA 1IXKA 2Z6UA 3JWIA 3P2EA 1D2CA 1JR4A 2VP3A 5K0FA 3C0KA 3HA5A 3FUTA 3SSOA 3TKYA 4B17A 1H1DA 3OZSA 4DCMA 2DPMA 2NNWB 4EVIA 4YUWA 3MQ2A 3G2MA 4YV0A 2Z6AA 2JHAA 3KQPA 3LX6A 4E31A 4GF5A 4PYQA 5CUQA 5LQAA 4X60A 2H00A 2OB2A 5DLYA 4JXJA 4P58A 1NV8A 3DXZA 4YUVA 3FTFA 1XXLA 3UJ8A 2G8NA 3DXYA 1X1AA 1AF7A 3V8VA 3MCZA 3DMFA 1I4WA 3DMHA 4PCAA 3VC1A 1EIZA 3R0QA 1NKVA 2ZZNA 3DLIA 3HCBA 2XVMA 1FJXA 2VDWA 2QY6A 3NWEA 3EGIA 3TQSA 3G5LA 2G71A 3EVAA 3LKZA 3GRVA 4HRAA 4RVFA 4C08A 2JG3A 4A6EA 4DKJA 1QZZA 5E9QA 3MCTA 1R8YA 5CM2Z 4M7RA 1AQIA 1BC5A 4YMHA 4FP9A 4HC4A 4AX8A 3MGGA 3EVDA 2NP6A 3HCEA 4EMSA 5K0EA 2JJQA 5M5BA 2AS0A 3TMAA 3E23A 2AOVA 2PJDA 4MIKA 3HCDA 1R8XA 3C3PA 3HM2A 2H1RA 4QVGA 1ORHA 3A26A 3G2OA 3TPZA 3FUUA 3GRZA 4HTFA 5EKUA 5BW4A 3C6MA 2AOWA 3B3GA 5GM1A 3EPPA 1YFLA 5K8VA 2OBFA 1ZGJA 5EQJB 4C07A 2VS1A 3FRHA 2YTZA 1NW5A 5FHRA 3EEYA 2OZVA 4GEKA 4FS8A 2EX4A 3I9FA 5FADA 4CTJA 2IGTA 5LQCA 5K0CA 2ZBRA 1U2ZA 3GU3A 3GXOA 2PXXA 3Q87B 3EGVA 3BKWA 2ZZMA 2WA2A 4GC5A 3SR4A 2IDJA 4WXHA 3UJCA 4RTQA 3G7UA 4MHTA 2AR0A 4A6DA 5E1MA 5DM1A 3VYWA 4U7PB 3FPEA 5EZSA 3ER9A 3M4XA 3BWMA 4BLUA 2UYQA 2ZVJA 3ELWA 4FZVA 5EMMA 4X63A 4RSRA 1UIRA 5C9ZA 2E5WA 1JG2A 2GB4A 5DSTA 3RODA 1WG8A 2EJTA 4FT2A 1UWVA 3DP7A 4PCLA 4C06A 2EJUA 1JQDA 2G70A 2ZBQA 3GIWA 8MHTA 4OA5A 4GOND 1HMYA 3MHTA 3HA3A 1XVAA 4MQ4A 5JR3A 1KXZA 3BZBA 1JSXA 1YZHA 5KS2A 1ZG3A 5GM2A 2PBFA 3LHDA 4KDCA 3DXXA 2IBSA 2O05A 4Y30A 4YV2A 5LQJA 2YQZA 3FYCA 4F84A 4FSXA 4RVGA 5E8RA 2C7OA 3T7SA 4WVLA 1L3CA 3SM3A 5MHTA 3BWYA 4QQKA 5HILA 3LSTA 5EGSA 1F38A 1NW3A 2O07A 4EQZA 2NYUA 1WXWA 4FR0A 3QOXA 1R74A 3LCUA 3OU7A 1VPTA 2P3LA 4KVZA 5EC8A 5C0OE 3PVCA 3OZTA 3UJ6A 1SUSA 4R05A 4RTLA 3LCCA 3TM5A 2ZIGA 3LBFA 3GO4A 1I9GA 1O9GA 3PFGA 3O7WA 4PYNA 4AUKA 5ICEA 1NBIA 3HTXA 3FPHA 1R18A 5EHGA 1SG9A 1VP3A 4R8RA 4BY9E 1FP1D 3LL7A 3F4KA 2PXAA 2QRVA 4O29A 4CXMA 3FYDA 5EMKA 5EIFA 4DMGA 3X0DA 5LSAA 5DX1A 2PT6A 2ORED 3NTVA 5FA5A 3C6KA 2AOXA 3DOUA 5HIKA 4P7KA 4E2WA 2JHCA 1KR5A 3P8ZA 1NV9A 4QVKA 2YXEA 2P3OA 3B7PA 3LPMA 4Y2HA 3KQVA 3NMUF 2AOTA 1BOOA 1JTFA 1RI3A 5LR6A 2ZWVA 3SXJA 5DX0A 2EG5A 1JQEA 3BGIA 4LWOA 4QTTB 2I9KA 3H2BA 3B5IA 2QYOA 3E7PA 2ZWAA 5B1SA 5F2OA 4BLWA 3JWHA 5E1OA 3HEMA 1SQGA 3EEOA 4CKEA 1EG2A 3FTCA 3K6RA 4ISCA 1I1NA 1NT2A 3HP7A 3RW9A 1P39A 9MHTA 2JH8A 2HMYB 3KKZA 1EQAA 4LWPA 1XDZA 5HOQA 1Z3CA 3NDJA 2OY0A 4ER7A 4MTLA 3THSA 3DR5A 3G8BA 3KPVA 2HV9A 3CC8A 4KIGA 1OR8A 3KQSA 2OB1A 3FRIA 5K09A 4C03A 2ZIFA 3FPFA 2P1DA 4U7TB 2P41A 2QE6A 3OPNA 3AWIA 5FTWA 4AZSA 1O9HA 4KRGA 1NW7A 1XJ5A 1RJEA 1O54A 3OFJA 5DSXA 3T7TA 2A14A 3AJDA 3SGLA 1QAMA 3EMBA 4UOEA 4ZTBA 5DXAA 4HG2A 4IKPA 4R6WA 5K0BA 2O0LA 3REOA 3EVFA 3GGDA 3HVJA 3MTIA 2P35A 3P2KA 4PYLA 3FPJA 4PYJA 2JH9A 4P7JA 3FTDA 4EK9A 3HCCA 1M0EA 5G02A 3S68A 3CJRA 3LDGA 3LGAA 1YB2A 4PGHA 4PIPA 2B2CA 3CJTA 2PWPA 3M6WA 5CVUA 4RX1A 2B9EA 2PSSA 5FULA 3KPUA 3PS9A 1JQ3A 5HFJA 4E33A 4R8SA 1YFJA 1SKMA 1XDSA 2Y1XA 2VDUE 3BGDA 3DTNA 3IHTA 3P9IA 2IPXA 2B3TA 1RI2A 5CD1A 2AN5A 2UYHA 2P7HA 1NBHA 1BHJA 4C4AA 3KR2A 4P7FA 4DQ0A 3HA7A 3DH0A 1MHTA 1RJFA 3TR6A 4OBWA 5LQUA 3BT7A 5ERGB 2OKCA 3BWCA 4G56A 3C3YA 3I58A 3KQOA 2P8JA 2NXEA 3UA3A 5EOVA 4FGZA 1WXXA 3TLJA 4RTPA 2VZ9A 3QV2A 2IDKA 3P9NA 1JSZA 1L3BA 3KQMA 1KPHA 2YR0A 3KU1A 1KIAA 1N7JA 5EMLA 2WK1A 3O4FA 5FWDA 3FUVA 2BH2A 1DUSA 5EEGA 4OX9Y 1XCJA 1XDUA 4NECA 3HCFA 5CVVA
chains in the Genus database with same CATH superfamily
2D7CA 2FHPA 3GFSA 5P8WA 1H5UA 4WDQA 4AJ4A 2O9JA 4KQ2A 5E3IA 3QFSA 3ZDFA 2GXAA 3F5DA 3QIAA 4OXQA 3OLVA 2HJ9A 3U3OA 1YS1X 1QDUA 621PA 3G0IA 5AHRA 4QUAA 1J99A 1QO0D 1TEXA 4CG1A 2HDWA 1U7XA 1UKEA 4HWOA 2COEA 3HO6A 1R0ZA 3RVPA 3F5FA 3KEGA 4BMPB 4DCVA 3PTLA 1F2DA 1KI9A 3PGKA 4DSUA 3SD7A 3UHJA 2XTZA 1H9CA 3DAOA 3KQLA 1UPTA 1T0BA 4FFPA 4WKBA 4EBFA 5JT1A 2HU5A 2B98A 5C1OA 3U56A 2DE0X 3H84A 2J07A 5T6MA 4EZBA 3OTHA 4F3CA 3RTCA 4KYIB 4ZYVA 3NGXA 4TXMA 2G77B 3EUFA 3L0OA 5JATA 2GM4A 3MFQA 1KZ4A 2GRAA 1PWYE 4MDHA 2ZI3A 1V35A 3LY8A 4BO0A 1XVUA 3DT9A 3GG9A 2XGSA 5EE9A 4DZRA 2QTZA 2ZSHA 2HCTA 3NIBA 3B3FA 5BURA 5FO0A 2REXB 3GMIA 1AQ6A 1WY7A 1Z8FA 3Q7PA 5DGTA 3HYSA 1C8LA 4U7HA 4EGQA 1SUIA 5JSHA 1T10A 1UZLA 2CBZA 2CLCX 2I1WA 2QD2A 1IULA 2YV4A 3N0TA 3OAAD 4Y2YA 2V8BA 3QT4A 2VCHA 2MT9A 4O8ZA 5D5QA 2I2AA 4B7CA 2BKAA 2ATVA 3GJXC 3OISA 1Z28A 5A0TA 1RVDA 3FUXA 2I2CA 1E6MA 2P40A 3AUYA 4LSMA 2IX3A 3AJ8A 3TQHA 1THEA 1XVLA 2BFCB 2W6OA 5IXSA 4KI7A 4FJ2A 5AH0A 1LV8A 2OCPA 3AMVA 3CM0A 3S2FA 1IBRA 1VSNA 1P3Y1 3JRXA 4KQKA 4OH7A 4W9MC 3FHTA 4I9HA 3KWLA 1NHWA 4BJ1A 2QQ0A 3VH3A 1U0EA 3B48A 2HIGA 5JS8A 1GDTA 2PZAA 3H5WA 4NQZA 4GWLA 3R7BA 5JRDS 1K4KA 1N3IA 5FL7D 2FUKA 3V9AA 5IKMA 1JDBC 5TEVA 2Z56A 4MS1A 3IR7A 4HSEA 2FPUA 2BKLA 2ACVA 2I7DA 3V6LA 2X0KA 1IYZA 5DGHA 1T3SA 3JALA 5GIOE 2QTVB 4P0QB 1WP9A 2B8EA 1WXHA 1NUAA 1W59A 3ZI0A 2CXPA 4PLFA 3AF2A 1ZGBA 3ZS9A 1O5IA 3ACDA 2VQEB 1J70A 5ALNA 1E2MA 1KYYA 4EFLA 5CB6A 3E05A 2HREA 3H11B 1O6BA 1UQUA 3OEEA 4MUHA 4XQCA 1N1DA 4WGFA 5C31A 4PP2E 3RASA 4JUBA 1OGJA 1UPCA 3BDVA 1Y37A 5AUPB 4LFAB 1US8A 3BHIA 3UV7A 3G7SA 4ITUA 1XYYA 3TFOA 1GQYA 2F9MA 1TJNA 3LXRA 1HFJA 3D8UA 3FY4A 3JYHA 2P86A 2XRMA 5AKKA 1QRTA 3ABQB 2QG6A 1V1RA 1QBGA 3GN2A 1N6NA 3O03A 2C31A 3WGLA 2PEYA 2V3WA 1J97A 3H5NA 2FG7C 4TX1A 2NSLA 4F4CA 3D02A 4I4LA 3D1LA 3FYHA 3NAQA 3MBIA 5K0ZA 3GLIE 2CEKA 4Z4IA 3MJHA 4IFEA 2CVHA 4Q7JB 4ER0A 1JG1A 1RHQA 3SDSA 1E61A 2YNMD 4AF6A 4BAGA 1KFUL 4J8PA 4NATA 4RD4A 2KSQA 1E0JA 1V8PA 5MGNA 1IUNA 4LRTB 4FMDB 4YYZA 1AO0A 1M2OB 1NNEA 3NOXA 3I53A 1FMLA 1PV1A 2RGAA 2CJYA 3W4IA 3ZG6A 3ZV4A 4DR2B 3S1AA 2FQ9A 1V48A 4NMMA 4F8EA 1EWKA 1SBHA 2F62A 4DUGD 4NNPA 1I0LA 3JATA 1XROA 4NCKA 4G8CA 1I8TA 5CHTA 1D07A 1TW3A 4B79A 3LBYA 1R4MB 1DHRA 1L8LA 2ZCVA 1ZINA 2Q4EA 4ZAVA 1KEVA 3EDOA 4FGJA 1QIFA 1E2FA 2RI6A 3A7EA 1NVXQ 3N5KA 4LJ6A 4MUFA 4XIFA 3K0CA 3V8BA 1Y8ZA 1A5AB 2QR2A 3OMWA 1N34B 1I3LA 1KA9H 1I1HA 5GZ6A 3TO5A 3ELDA 3GWZA 1PTJC 3HHPA 1ZUD1 4I50B 3ZNNA 4C1BA 4AXBA 4B3MB 3NETA 1IB0A 2YVQA 2I6GA 5HYVA 4UE6A 5A3JA 3K6KA 2CZQA 16PKA 2R25B 4RVHA 4B3JA 1BIFA 3JQ6A 2XOXA 1AVTA 2YDYA 1M2VB 3Q9NA 3ZE6A 2YMLA 1QONA 1N6IA 3I64A 3NV9A 3EPRA 2ZIWB 4PX9A 3X2SA 4KN8A 4NMXB 4PNEA 4QD3A 1JEYA 3UVEA 3KJNA 1E7YA 3KU4A 3DE6X 1O3YA 2I7CA 3WNCA 2QQFA 2G7MC 2H1WA 4CGZA 1Q6YA 3U09A 3STVA 3FH0A 1N6OA 2BH9A 3BTSA 1P6UA 2H5JA 2XVXA 1C50A 1RWVA 1FRVA 4FT4A 7REQA 1IXYA 4BNDA 3TJRA 2IBMA 3AYXB 4Z3KA 2P4EA 3F3KA 3ZBTA 3PNRA 4YMTA 1R4NB 5CLLA 3RTAA 5GV8A 2P7IA 2O6XA 4FOOA 2AK2A 3TR5A 2IWRA 5AICA 1RU3A 3SR0A 4JSTA 3QPBA 3RD5A 2DC7A 4EPXA 1E6EA 5FO1A 3VNAA 1RLUA 4MR8A 4MMZB 4LY3A 2OBXA 1P2FA 1JIQA 1P1KA 3PR1A 4ZTUB 2QG4A 3KQWA 2YCBA 3DLTA 3BH7A 4KW7A 4L8WB 4U4AA 1O03A 3PIDA 4HI0E 3E2MA 4N6OA 2H2FA 3GAZA 3Q11A 4ZVRA 3I6MA 3N8NA 2D1YA 3P0FA 3WDSA 2NZWA 4A7PA 5JALA 4OI4A 5CITA 3PJDA 3CF6R 3V1UA 5KNDA 2WLSA 4C0AC 1NBWB 5CX1B 1Y4HA 4QUEA 4RKXA 3LI2A 4I4IA 1DAMA 3NALA 3R5SA 1V25A 3DOHA 4I66A 3VPGA 4BV2A 3SHFA 3AG6A 1N5KA 4IOKA 4D9HA 4MPRA 5GINE 3LVFO 4MR7A 3ZDBA 4DR7B 2J45A 1PYOA 3AF1A 4XKJA 1PG5A 1I3NA 2PEZA 4BVGA 1SC9A 5K0JA 3CLSD 4MKGA 3DTVA 3PUYA 5BQ5A 1JUDA 2W71A 1KRWA 1Z2EA 1DWQA 1SU6A 3FFWA 5E4YA 4BUCA 4UHDA 8ATCA 3WLLA 1RKBA 4H16A 5CRIA 3TUZC 2AK3A 2FFHA 3NT2A 2Q1TA 2YS7A 1J2UA 1XHLA 4HDNA 1AYVA 3AEXA 4UOZA 1G60A 2G5PA 3NRJA 3OZGA 2HU8A 4RXTA 2YJNA 5FPTA 3NVDA 1GAQA 2WU0A 2OCBA 3N28A 4LJYA 3TIXB 5DTRA 1KU6A 2WZQA 4UCQA 4WZBB 2Z98A 3HU1A 4TRJA 2P68A 1UXIA 3H65A 3VO9A 2O2XA 3HSKA 1JLRA 1RYEA 3QOYA 4IFTA 5JHGB 1R8SA 4OXRA 2IYTA 2O2JA 1NVBA 2BBOA 2FEWB 3RREA 2A9OA 4BOZA 4X41A 1I3OA 1H66A 1GSIA 1RJGA 1EVLA 5FTKA 1KIMA 1RD4A 5KHAA 2ZUTA 3WZMA 2BPOA 4N5MA 1VMKA 1C3LA 1XD9A 2BLLA 2FVYA 1H2AS 1JR4A 1XFDA 1HSOA 4RA6A 3FRJA 4DQKA 4DCMA 3HA2A 5F5LA 3OQIB 1GG8A 1T6XA 1Z5NA 3PWTA 1KYTA 1M34E 2DXIA 3ZCQA 1LNSA 4U9HS 4EEZA 3D7MA 3RSGA 1K08A 1EUCA 2XMZA 4HQFA 4WBNA 4RCYA 4Z3DA 1RQPA 3CZCA 1FNBA 1LTKA 2EBWA 2W6JA 4KODA 3GFQA 2C00A 1L5LA 2XU5A 1GZ4A 4KAJA 5CYFA 4HXGA 1PNVA 2UZ1B 3DXZA 3VVBA 3K9GA 2NQGA 4FHEA 2REQA 2B94A 3UG7A 4D2IA 3DBRA 2VDLB 1CUEA 1QQ5A 2B8WA 4FILA 4G0MA 4ZREA 4AJ2A 1U94A 1VI5A 1RXWA 4FBLA 2Z84A 1SCUB 2HF8A 2XNSA 3CEPB 2E87A 1C29B 3ZNPA 2Q3EA 4PZZA 3WRXA 3EGIA 3RRXA 2VTVA 4DIOA 1JVNA 3OY7A 3QKSB 3U0VA 3L7DA 4CFSA 1M9NA 1DFGA 2HHCA 3D64A 3ZHYA 2H9YA 4A03A 4B87A 2ORIA 5D85A 2HEGA 3F73A 4XB1A 1CUUA 1IZ9A 4EX6A 1ZCFA 2GPAA 3Q7RA 2CKMA 2OVFA 1U6JA 3K30A 3CBKA 5EF4A 4BEVA 4KWHA 3NT5A 3PHHA 5LOVB 4BZWA 2VLIA 3LT4A 3FYUC 1C8VB 1ABBA 1U9QX 3JXEA 3JAWA 4C07A 3MJSA 3T34A 4IAOA 1QH0A 4M0KA 5C81A 4ARZA 1CW2B 1UWLA 4Y1EA 5FADA 2R00C 3BB7A 5PNTA 3MWDB 3D5QA 1G2PA 1H2RS 5DM70 3ZZUA 4FZJA 3I3OA 4EUKA 2YJTD 4FS3A 3BKWA 2JI6A 4UVDA 3U4GA 3M3PA 5DZSA 1XZPA 4C78A 4WNAB 4EKNB 1ZGGA 3RRBA 3H1TA 3HJHA 1XYGA 4JKOA 2AKYA 3IAFA 4CLHA 2FOIA 3EZXA 5SZJA 1CCWA 4HQNA 2MSWA 5KYXB 5B1HA 1UZNA 3JPYA 3OG9A 4KOEC 5DSTA 2PJZA 1M7BA 1N6RA 5EZYA 2XNDD 2XKJE 1VZ2A 4J7UA 1O6CA 4QLOA 2YDXA 3ZWCA 1EIWA 3T52A 1PV4A 4HWGA 4MQ4A 4XWGA 1E5TA 1PNQA 2JGLA 2FY8A 2LKDA 4XE5A 4YREA 5TY0A 5KS2A 1L7QA 1P2DA 2ZYUX 5EESA 5A9SB 1G20B 5AOAA 3DA8A 2FZGA 4AJOA 1IMJA 4F84A 3TNYA 2QW0X 4MQMA 3UOWA 2X0JA 1O9BA 2GK4A 4AURA 1NU8A 1JE1A 3F74A 4WPGA 4Y67A 4C4OA 2YQ5A 4LS3A 3EDRA 3PKJA 3SIPA 1MW9X 2GA8A 2VHUA 2QTCA 1LDNA 4OHBA 4MWEA 4Q5IA 3HL0A 1CP3A 4DNQA 1N6KA 5AW6A 1NN5A 3FDFA 5FOXA 3TM5A 2ZIGA 5E6JA 1GAXA 3WGKA 3STWA 1KSJA 2A5DA 4AS3A 1KJQA 5K8JB 5A71A 1Y7IA 3CX3A 1N2HA 1WV1A 2AMFA 1I4DD 4WXEA 4O29A 1RABA 5ALYA 2H54A 1RYHA 1EE1A 3X0DA 4YT2A 2ZRKA 2NSDA 3ILSA 4I8XA 2RJ3A 2REBA 4EI2A 4ETMA 2XTMA 2J9RA 1XLVA 2BJHA 3CF4G 3FZQA 1AB6A 2I6UA 1R6DA 2YVUA 2N1BA 3DW3X 4JBLA 1A4UA 4BGVA 2I33A 1VKHA 1F0KA 4D44A 1PPDA 4QFDA 2QUKA 4MRMB 1F9EA 2AR9A 3U4MA 2FPGA 4MUBA 1LDBA 1TVKB 2P2NA 1CY2A 3SXJA 3TDKA 2IYAA 3MJFA 1NUQA 5KOIA 3BH6A 2H7YA 1KY3A 1SUAA 2F6RA 4L5YA 4QTTB 4QUJA 5JROA 1X7YA 2QTNA 4FYWA 4FDTA 4YA6A 5E1OA 1UMDA 4B4DA 3IBFA 5DYIA 2I9PA 5KJ6A 4HZGA 3PLRA 5GJVC 3A9TA 1RXSA 1NBEA 1BYIA 5HKKD 2Q6VA 4OXXA 4UU1A 2IRWA 1I1NA 1WRBA 3LWNA 3WQHA 5F77A 2HH5A 3BTVA 4TVBA 3CX4A 1YZYA 3T1NA 2E4WA 1Z2OX 4AW9A 1A9ZA 4N3BA 3VGPA 5D87A 1KTIA 1XJQA 3I5YA 1AUOA 3AETA 1SD5A 2PUWA 2ZT5A 2CC2A 4GRAA 2O1WA 4P54A 5CDYA 2RD2A 2W2KB 2ZTSA 1HO3A 2P75A 4C03A 3LUDA 4G1MB 1XZCA 3FPFA 1KJYA 2RGEA 3LLUA 2P41A 5IC6A 3TTYA 1GUFA 3OPNA 4AECA 5AUOB 3MK31 1U11A 3DNFA 4IIHA 4LY6A 1DG1G 2WIDA 3H05A 2YHIA 4JEMA 3O0UA 3ULKA 1KAEA 4IYRA 4X97A 3SYKA 1M2JA 2VNJA 3JPWA 1CTQA 2JEZA 4HG2A 3VYVA 1KDTA 2BFDB 4TUYF 3KSEA 2VBFA 1Y3IA 3WJ2A 1FW8A 1MP0A 4B84A 2PD4A 1RLJA 1T8PA 3IRVA 4E5PA 3N3GA 3G1UA 3MMPA 1E6CA 5FORA 3FTDA 3TOCA 1BS2A 1E66A 1JYEA 1G7RA 1N7GA 1YB2A 2XAAA 3M6WA 2UV8A 1HK7A 1IXZA 1BMFD 4ZJZA 1Y4ZA 1Q7EA 3DT8A 2COKA 3O8BA 1QOLA 3WKAA 1B0AA 3BGDA 1L8OA 1E9DA 1E1RA 1JQKA 2FUNB 2GBLC 3NYRA 1C1YA 4KGXA 4XZ3A 5H5JA 3HEBA 4N0PA 3VZRA 1ZR2A 1SOMA 4NYMQ 1J23A 2H7JA 3AIKA 2BGUA 1WULS 3KLPX 3O47A 2FSIA 1UPUA 2JK1A 1MC8A 2GXQA 2PPLA 4JYPA 4FB5A 1GTG1 1T5LA 1XK6A 4HT3B 5LQUA 3LFYA 1ZDMA 2HDHA 1M0TA 1T0JB 3PSHA 3SBEA 4BP9A 1OXSC 3M8KA 1TJ5A 3UC5A 2ZJBA 4URFA 3RYIA 1SXGA 4AK9A 3AZQA 1WCIA 3L7AA 3C3BA 3PDIA 1U2TA 2HWUA 3CNNA 4RY9A 5GJWC 3W9BA 2H4XA 2VNIA 4U2EA 3ZHBA 4KUGA 3HDVA 1NQTA 4H6VA 4HUQB 1ZBQA 1I6LA 1KF0A 2D8AA 4B7XA 4F4FA 4EY5A 2C0QA 3KK0A 3D1JA 1PPPA 4Y98A 1NVEA 2CUKA 2FOLA 1KYIA 1K63A 4JQSA 3UWDA 5JA7A 1EWMA 2X0DA 4HDCA 1ORDA 2C9OA 5D3MA 5BN4B 1N2OA 5HK8A 3TL2A 2WEKA 5B6IA 2ZAYA 2PANA 2QEQA 2XYQA 1V1JA 2FMKA 3LKDA 2GX6A 1J0BA 1X0VA 1W4ZA 4NENA 1BA3A 2V1UA 4Q4AA 2GCEA 3LO8A 1TIKA 3D4OA 4KIJA 4D8BA 3PDJA 1QV7A 2BLNA 3L07A 1ONSA 5A4DA 3GT7A 1CS4C 3ESZA 3GIDA 3PC6A 4MV4A 5K99A 3GLGB 4U6SA 3UFBA 2A9QA 4DM3A 4H1VA 5KDDA 1C3OA 1HL7A 2O8CB 2B1NA 5KYYA 5FUYA 4II2A 1TAGA 4M53A 1MKYA 3GR6A 1PQWA 4BFUA 2WIFA 4PLVA 1ZIVA 3Q6NA 4FSDA 4MWCA 3C3EA 4HFJA 3P2MA 3AVWA 2O8DB 4RQUA 2NU8B 3Q9UA 3AHGA 4KMMA 4LGMA 4DDTA 3N2GB 1BQEA 3UANA 2II6A 2OT3B 3L4SO 4PXSA 3TM4A 1KFXL 3EW7A 2QX9A 4EHHA 4ETIA 3G13A 4KWEA 3NIGB 4WURA 2JJYA 4Y1RA 2JKZA 5FCDA 4ENRA 5DU2A 2WAMA 4GOXA 4IH1A 2BWJA 3BQNB 2FZ4A 2YNMC 3THRA 5FA8A 1E9SA 3HYNA 2FFQA 2E7ZA 2I3ZA 4GI5A 4ON9A 4ZOLF 3KAKA 3VMFA 1T4CA 2JZNA 3HYCA 3PNMA 5HF6A 4XR9A 4E5DA 1LS6A 2PK3A 2IYSA 3T0IA 3PFKA 1EVJA 1Z2PX 1LFDB 4KQXA 1L5RA 4QDXA 5AK6A 3OT5A 2CFSA 2VAWA 3IE2A 3KOZA 1PDVA 3CGWA 1G38A 5ECDA 3V1LA 3CCBA 3CLRD 4ZV9A 1QYRA 2SKDA 4GRIA 5K4AA 1CUYA 1PP4A 4AJIA 4YT5A 1G4AE 3CH7A 1KH2A 3U3DA 3RU7A 3U1VA 3WLJA 1CR2A 1JR3D 3IPXA 2OLEA 2AE1A 2AFIA 2B5VA 1WM1A 2PX6A 1TCCA 3ZY6A 3INGA 5AHWA 1FBTA 4K40A 4G5XA 2CF5A 1CUJA 3PFBA 1FX0B 4FFOA 4NYIR 1R0LA 1Z6ZA 1ZGAA 2O14A 1GTVA 1VSUA 2QQGA 2TS1A 4OF4A 4D6XA 4HNUA 3WV5A 4KGDA 3EA4A 3ZXXA 2PYIA 5J2UF 2PZMA 4JQCA 5T4EA 1DJPA 1TYBE 3DEHA 3JQ9C 4Q48A 1HNWB 2J3EA 1ISHA 3OKCA 5LNK1 1H4SA 2A35A 5ESWA 1TW2A 3T6KA 1WPGA 2VJYA 1PJZA 4DARA 5SYMA 3IV7A 1WCXA 1YR9A 2O52A 5IC5A 5L3ZA 1EXMA 2QD5A 3V7FA 1GPWB 3GNSA 3REFA 2B37A 3OE5A 3ERVA 4Z5XA 1D04A 1JLMA 2H4FA 4GQBA 4F92B 5L4LA 1QG2A 4XUCA 1MIHA 3A4VA 1DAKA 2DPLA 2OXTA 4WA8A 2QR3A 2BFEA 2O5VA 4QT4A 1SU7A 2P2CA 4QWWA 4PNHA 2R11A 4TM8A 4FXPA 4PX5A 3RTDA 4RD1A 1AU2A 3H8BA 3CVOA 2F4NA 5HJ5A 5CLIA 1RSZA 1F2TA 3NBFA 3OEWA 4Y7CA 2MWMA 3RVLA 2JLRA 4ONEA 1Z8HA 4KJZA 4ZI5A 1SUWA 4IX1A 5CFPA 2WNHA 3EYAA 5FHQA 5A03A 1MA3A 4UCFA 3A4IA 1OH5A 3KQTA 4LZNA 1IBKB 6ABPA 4F93B 1BX3A 2V1XA 2ZUFA 3TLCA 2C7BA 4MQEA 4G5GA 4C20A 1WB5A 2Q46A 4ND7A 3O9VA 1H8ED 3E5RA 4GKVA 4NBLA 1DZIA 2Z30A 3W5SA 4QULA 4BX3A 3LXSA 2Z3WA 1P6QA 2GLXA 1VG8A 1Y1PA 2JLZA 2Y9MB 4G2NA 4KX5A 1HFEL 3E5NA 4HNAB 2O3QA 1KH3A 3ZYZA 1EXDA 2OPBA 3CPEA 4CCWA 3WOVA 1JDBB 1ORTA 1R2QA 1MB4A 3CLSC 4QTZA 3R0ZA 5THXA 2GN2A 3LC2O 1L9XA 1TF7A 3M2TA 4RIIA 5JPIA 4QOSA 3VZBA 4I05A 2OQIA 5JTTA 1XQ6A 3HFSA 1M1UA 2GF9A 3PHJA 1PR6A 4RLQA 3E84A 1XEXB 2JFPA 4KO1S 3CA8A 1HDYA 1U5AA 1Y4SA 3K9WA 5BUCA 1U6KA 1KZGB 4PNZA 2WFMA 5IJXA 5C8YA 3BPMA 5FLEX 3E03A 2H9AA 4OW0A 1WMFA 4N18A 1ENOA 3F3MA 4JQZA 1VE7A 3QY0A 4WV3A 3GFFA 5KYNA 5EEHA 3W6OA 3K0FA 4CETA 4Y0AA 2BEKA 3EDCA 2CLMB 2PUAA 2ZANA 2PU5A 3C7AA 4N03A 1CF9A 5TMPA 1J5PA 2OO7A 5FT9A 2HLDD 2GFIA 1LK5A 5FAXA 4YP7A 1EVKA 1HE4A 1RAFA 3FGNA 3ROTA 2R6NA 4KZKA 4GWGA 4BZXA 3CVWA 3DC7A 1CUGA 1U0OC 3BL8A 2IHTA 3GRYA 3GC6A 1KQ3A 3NI2A 3TSAA 3CO5A 2J30A 1U9JA 3KOOA 2EFJA 5LZ5A 1ULTA 1Q12A 1V16B 1O08A 2QN8A 1JN0A 3C85A 4J03A 4JYBA 4TUYB 4Q8GA 2IZ7A 3B78A 4JBXA 4O4HA 4NCAA 1I1QB 1EFRA 1S2OA 2PMKA 4YRQA 1PZHA 2QJRA 1OGYA 3NBXX 2I6TA 3O31A 3F9CA 2AEEA 3IBGA 3P9XA 1SXJE 2WJJA 3KCQA 4JXKA 4LJ7A 1JEQB 2CY0A 2ZDHA 3OICA 3W34A 3QITA 4QE3A 1LNZA 1VPDA 2GZSA 1C1XA 3DBLA 3OCJA 4AZ3B 1X1CA 1ECGA 1QYVA 2AMVA 4FDLA 4AYWA 4K6KA 5F1PA 1WKCA 2LIPA 2NP7A 2WJ4A 3ITDA 2VR1A 2QVBA 5GZ1A 4F7DA 3EVGA 2OFPA 5CJ2A 1M2EA 4MZSA 4OK6A 5ALDA 2G6TA 3HZRA 1YJCA 4MDFA 1DF0A 2XIJA 4WINA 4WN9B 4RTSA 1MRSA 1Y7PA 2HL6A 2PH3A 1MFZA 4FZ5A 1EFUA 4II3A 3HJUA 3JR7A 3MXOA 3SKYA 4MROA 3GLUA 5HGJA 4IIGA 4ZTZB 5D3QA 1E8NA 3TSCA 3HE3A 1KZYC 3F9IA 1PUIA 2NUAA 4QARA 1L5HB 5TGTA 2HHNA 1EVZA 2W6QA 4HNQA 4BNTA 1QS0A 3KLBA 3SHOA 2NTNA 3EOBI 3IMEA 4YH1A 1P62B 1Q1GA 2WVAA 2FH5B 2Z58A 1ULAA 4M8IA 1R66A 1RHKA 3D3JA 4QJ4A 1CE8B 3PFIA 3OA0A 1MB9A 3VVLA 2J7QA 2I62A 2R97A 3QBDA 1ZLXA 3AU9A 3AFGA 3LT0A 1A9QA 2HRCA 4FSHA 1P1JA 4ZT4A 4NFYA 3JQGB 3STTA 4CIVA 1M74A 4XSGA 1OILA 1RI5A 3H42B 1RZ3A 3GP5A 3HPRA 1DG9A 4Z7JA 3PD7A 1QCCA 1UBCA 1Y4DE 2G9ZA 5TS3A 3JRNA 1FRZA 1E3SA 2O2HA 3H1GA 2E4VA 3IE0A 3LPDA 5E9JA 1E1QA 4PS0A 5DGIA 4KXYA 3E9NA 2HIAA 1IY8A 2H4WA 2QWXA 3TKYA 2OEPA 1E3JA 3AY7A 1N9GB 1PX2A 3HNPA 1Z0IA 2FPLA 3WLHA 1JDSA 3DBHA 3LX6A 4AT1A 4D46A 2VJOA 2HXGA 1HC7A 5EPUA 4PYQA 1Z62A 4N01A 3MORA 1T9KA 3S29A 2RAUA 4X60A 4C3VA 2VL7A 4O4JA 4FD2A 1ZD3A 4LXHA 2AYZA 3AR9A 3PHIA 3MAJA 2CHUA 3PNPA 4MLCA 4P58A 1FXWA 4GMGA 4QXMA 2ID7A 1CUVA 3X1ZA 1KEUA 1OA0A 1QCDA 1R4ZA 3SZOA 5CH3A 1NXSA 1KEEB 2GGSA 4MRAA 4WFQA 3MP2A 1S4QA 3N0VA 3RU3A 2G3YA 1AX9A 2AUTA 4K2AA 4K9KA 3TQRA 1WDMA 4ARBA 1LBIA 4ID9A 4LZJA 3TOXA 4DLLA 4RKFA 2GR9A 5FYDA 1YE8A 4I5DA 1XALA 1XYVA 2O8BA 4TN1A 3UK2A 1ZVJA 5L3VA 4TSRA 5HJ7A 4JA2A 3V8PA 4ZOLB 3ZLUA 3HCEA 1WXQA 2F1JA 4ZOAA 1PFKA 5AW9A 2VF4X 3FB4A 3SJBA 3A9UA 1T35A 1TGYA 4NJMB 3O38A 4PQEA 1SQ6A 4WNCA 3EWAA 1R8XA 1MPTA 4LHSA 4PV7A 5ITWA 3N39C 5JCZA 5JYBA 2NV0A 2YCLA 3FZYA 2BI8A 1O0BA 1GA6A 1SVKA 3C6MA 3LP8A 5ECGC 3JZFA 1ZGJA 1EAYA 1DDIA 5K3EA 1QH8B 5B37A 3EY9A 4DE5A 2BKXA 3QMMA 1JW9B 4GEKA 3DUFB 5LBTA 3VPDA 2IGTA 2Q5HA 3KYCB 4NOLA 1UL1X 3GU3A 3V4PB 5HIAA 4B45A 2JIMA 3L6OO 2I3GA 4PWZA 1WQ4A 1JLLB 4MX8A 4QM6A 4TGLA 2EOAA 1L5MA 1JPVA 1QRDA 1S3IA 3CT4A 5I9LA 3NXSA 4YRFA 4QH6A 4DL9A 1NMQA 5GVSA 2PNFA 3RYCA 4EY8A 2CLDX 3ESDA 3M4XA 1P2VA 1Z6XA 2QAGC 3PNSA 4FZVA 3EH2A 5J2UB 1XNHA 4E5YA 5DULA 3D4PA 5FR1A 1CUDA 4Q3LA 3QUTA 2PV7A 3D2CA 1N0VC 4C06A 2H2HA 2HPAA 4UREA 4OA5A 2Z4RA 4MAMA 4YECA 4I1OA 2ZM6B 3MJCA 4H4DA 5JMOA 4C2UA 4F5WA 4UNNA 3OCZA 2JAPA 2ZEJA 3LRPA 4L50A 5KTRA 3KDSE 5AJZA 2CLEB 1N0HA 3ESAA 1L5FA 3UHFA 5C3UA 1RRMA 1TM3E 3M1AA 1NJSA 5U4QA 2VPWA 4RVGA 4EZEA 2IZ0A 4R2WA 1KI7A 1NBAA 3SE0A 2JFVA 4F4HA 5JOQA 1WNTA 1E3WA 2XTAA 2ZATA 1MVLA 4D3YA 5I3ZA 2IYYA 1LI4A 1C4WA 1KIFA 1PJQA 2XAUA 4Y6RA 5CTJA 5C0OE 3UJ6A 1NHGA 3IDZA 5SY9A 4MKHA 1PTJA 1N2ZA 3ROPA 3HTXA 5GJCA 3HXMA 1KOLA 4JELA 3GJQA 4NCBA 1EZ1A 4C4RA 4CL2A 2VPYA 4OXYA 2BU3A 4REMA 2PLNA 3C5EA 3VU3A 3BGSA 5LLTA 5LSAA 5AFSA 2PT6A 4MW4A 4YJGB 1Z47A 2PR7A 2ZE8A 5B4UA 4DPMA 2AOXA 2JFBA 2SCUA 3DAPA 3FYUB 4J91A 4L0MA 1X15A 2ZROA 2HRDA 4TT3D 1T4DA 4RH3A 3SQLA 3V1YA 5IABA 1D2EA 5F1OA 1E3QA 3EY4A 3VNRA 3H3JA 1O4VA 5AK0A 1D2RA 4YR7A 3IVRA 3IAAA 1QLHA 2ZYWX 4XD7A 4CZ2A 2GRJA 1ABEA 2QTTA 3OEHD 1E9FA 2Z6VA 4PZLA 2PMEA 3C24A 2ZJ2A 4OQFA 2YVKA 4JQOA 4DIUA 3E7PA 1DRUA 1BW9A 2QZJA 1W0JD 4F9FA 2AU1A 1A04A 1NXPA 3GMTA 2VH2A 3B6KA 4Y8VA 1YR7A 2IIVA 2JBAB 2ZAGA 3FETA 5C80A 1MEMA 3EA5A 1J2EA 1ME4A 2PQMA 1EDEA 3EIHA 2QX7A 3ENZA 1GSAA 1WW8A 4KXMA 3WBFA 4GMXA 4ALKA 821PA 2HDOA 1D6MA 2XDQA 2XXBA 3UCFA 2XOKD 3PDWA 1DDGA 3TW6A 3DZBA 3WK8A 1U2EA 3KZKA 5A6SA 4P93A 3P19A 1ECLA 4MTLA 2HPVA 3ROEA 4C7MA 3FBTA 4EW3A 3G8BA 5BV7A 2ZSIA 3V6EA 1EGAA 4KXFB 1V1MB 1PGPA 1X3SA 2CXTA 2Z4TA 4YRJA 4MUMA 4Y2PA 2VP4A 3BA1A 3GVXA 3HR4A 2OB1A 1U7PA 3HWRA 4LY0A 5K3FB 3UMVA 2YMPA 3BB1A 2P30A 4KAFA 4OL0A 4DEVA 6PFKA 2UZJA 1UDAA 1TTQB 2O48X 2Z9CA 4MUYA 1AXRA 5LNK6 4W1SA 1SD2A 2R1TA 3IH5A 4RF4A 2X9VA 3SOZA 3NC1C 1QAMA 4OOEA 3TZLA 2JD0A 4L5IA 2PZLA 4ZTBA 1JMKC 5FOVA 4DRXB 1IZ7A 1OLSA 3IVCA 4ZAXA 1MIOB 3WGQA 1LV7A 1THTA 1H3FA 4PYLA 1FFXB 4KG7A 4OGKA 2QZPA 5EIOA 3W5UA 4D9GA 1NFRA 3HV0A 1QLWA 1XMVA 2HU2A 1CLEA 2C1EA 1OWNA 1SBTA 2OECA 4XGKA 4AJKA 5A4AA 1PWXA 3M6IA 4IEIA 1ISMA 4RX1A 3CEMA 1X87A 5HFJA 1YFJA 2PRYA 1LWNA 2C4UA 2QV7A 3BYZA 2UYHA 1QG0A 2RBKA 1ZNXA 2VQFB 1H5QA 2G1UA 2XWBF 3WWZA 3C5HA 3HDTA 3QKRA 3G9TA 4B82A 3B21A 2JB9A 2G40A 2NXWA 4KLAA 5H68A 3K71B 3I28A 4HDAA 4Z0TA 5HTKA 4B7AA 3ZZ0A 3RUHA 4MUNA 1Z5ZA 1KC1A 4D74A 1EFVB 1R88A 3UICA 1T2EA 4RPGA 3REGA 4D43A 3HRIA 4LHZA 1U0BB 3K72B 2VDOB 3UV6A 3GF4A 3MTBA 5CBPB 4LGYA 5EEGA 4HNTA 3KJZA 3DDWA 3WYGA 5EUQB 2BFNA 1YS7A 4FYJA 4CPDA 5I9IA 3BEOA 1ND6A 4XFDA 3CLRC 2VJNA 5BQFA 4RTMA 3N2LA 3VKUA 1TKRA 1WB4A 3LUFA 1W36D 4QAJA 1ZGCA 2RB4A 3QU4A 1PR3A 2NYVA 1UFRA 4XGIA 1E69A 3RR2A 1FNSA 2P5YA 2ZZKA 1JHUA 1EWLA 2PJUA 5FI3A 3UH0A 2CN1A 2AUZA 2OAQ1 4IMIB 4PIMA 2BTQB 1X0XA 5HJ2A 3GOQA 2QTGA 1ISRA 1YJXA 2HQ1A 3NIFB 4HDMA 4HLUC 1Y5MA 1I4OA 3UJNA 1ZJWA 3CSDA 3SSNA 2ENWA 4N1AA 4X1KB 2YRXA 2CWWA 4O2BA 2R96A 4M98A 2P9TA 4O5AA 1PR0A 4UCWA 5LB4A 4DRYA 1XUOA 4LF7B 3K4PA 3RQSA 2XXAA 4KRFA 1SBZA 4ARUA 1QHHA 1JECA 1W47A 1P73A 1YKSA 1Z7BA 3OF3A 1WMDA 4EFDA 1KZ9A 1S7GA 1SCQA 4GOJA 3WYCA 5DHUA 2HMSA 4GX2A 2R3SA 3E7DA 2PR2A 1LA2A 5A0VA 2XF2A 1W5EA 2ZUSA 4GHWA 3P5UA 1OX5A 4K9QA 3I83A 5JSYA 4Y2TA 1OPRA 2FRDC 3AP1A 4D8UA 1RQ2A 3HLKA 2VRCD 2QDXA 3EN0A 3W3AA 1N2XA 4NABA 5FDFA 1K27A 1UXJA 1ZM7A 2HBRA 4LY9A 2XADA 4DT1A 3MSXA 1XRRA 4FCCA 5CDGA 1BXGA 5KNCD 4BMNA 1P4RA 1AYUA 4K1XA 3OHPA 4P35A 1ORIA 5AP9A 1KO7A 1KI6B 1AUQA 4RTRA 4PZUA 5EJ9A 1S3GA 4RC9A 1Y9EA 3NQ41 5H3CA 1SOUA 1D4FA 3MIIA 3BCNA 4OK5A 3I6BA 3QX8A 2NUPA 3IT0A 3CW2A 3W5JA 4OFXA 3WGTA 3EVEA 3C0RA 1G5IA 3WGYA 3P0IA 3WL8A 1J5EB 3ESYA 4P1ZA 3H5RA 2FEKA 4DGQA 5I7UA 3DB1A 1M6DA 2Z8XA 1OZGA 4QGSA 3KPYA 4Z4CA 2BCGY 4FFLA 1F51E 1Y9AA 1Y7TA 1FFBA 2D1QA 3V55A 4MZDA 1DT3A 4ER5A 1EFAA 1TJ3A 1JLSA 3H1PA 3EXHA 3T3PB 2J9ZB 3Q0TA 3SNHA 5A5FA 4AJ1A 4K87A 4G9BA 5F51A 1JSCA 5KPDA 1A9XA 3FMGA 1UMKA 2BMFA 1L5SA 1PQ4A 4DIBA 2ID4A 5IHPA 4OLAA 2PH7A 2EIXA 2XUJA 2ZSAA 3G9QA 3ZN2A 2BR3A 2G9VA 3KTOA 4V0QA 2G1JA 4NOMA 2HWKA 2DF8A 3WQSB 3ROXA 2HNKA 2EC5A 4KAAA 5FUQA 4J1SA 3H9EO 1HLDA 2PXHA 1P9LA 4QBFA 1YL7A 1MOQA 3RB8A 4XEUA 4TTAA 3UMSA 2GZRA 4FDMA 3BUSA 4RJJA 4LTNA 1YI8A 5JZMA 2IKQA 2CK3D 4IOMA 1NOKA 1YBVA 4EWLA 3FCUB 4JOCA 4MWZA 2C7QA 1OAOC 1ULUA 4D4GA 3PIRA 1G16A 2FEPA 2EBHX 1ZJ5A 2ODBA 4LYJA 2AW5A 3S2EA 3QOWA 1E18A 3UJBA 5JYEA 3S2YA 1E9BA 3DQPA 2D1TA 1H8HD 2GUWA 2ZJ4A 3IT1A 4QDJA 2AYNA 4NNOA 1Y9DA 1YS9A 2GD0A 4MGEA 1GLOA 1UMCA 2I55A 3LPCA 3OIFA 3WXEA 2GAAA 3ID6C 2X3YA 3OKAA 4Q03A 5FBVB 3A4TA 2Q4RA 2WU1A 4XASA 2QGNA 3D3KA 4UM5A 1QH1A 1SG0A 5FEMA 3FGOA 1G9SA 2ECPA 2GD1O 1NPDA 3MERA 3N58A 4YWJA 2P78A 3S44A 1JPUA 2Q5LA 4UTZA 1ZWLA 4A92A 2QRLA 4D9EA 4PFKA 4AXXA 2A86A 3QXJA 4I08A 2PDAA 2CL6X 2CLKB 1COZA 3HU2A 4RV4A 2OYRA 3U62A 5BRAA 2W0SA 3ZH2A 1XA3A 1ZSNA 2AYYA 2KB0A 4ILEA 4L5CA 3ZU3A 5JBNA 4OQEA 2VDRB 2W6ZA 2YX1A 3ABZA 2DFTA 3SIRA 3MA0A 2YWHA 3A9CA 4IDNA 5IK2D 3HVRA 1PYDA 4B1FA 2RJOA 4D4JA 4KN6A 4I07A 1PFWA 2HA5A 3AM1A 2CVOA 3C7DB 3EGOA 1TQ2A 3U17A 2VA8A 1AGRA 1GTZA 2PLFA 3WGIA 2XUFA 1FP7A 3CRQA 4LMAA 3VPHA 3ZCXA 4HXDB 1G8AA 1WOYA 2JLUA 3H2YA 1I10A 1TRHA 1QO0A 1QTNA 1NTOA 1FQWA 5KSWB 3OVXA 4CM4A 1TF2A 4W5TA 3ZWNA 1UINA 1XCMA 2Y67A 3PNOA 4PR0A 2PUFA 4LRQA 1P0IA 4UDOA 3ZHTA 4LF4B 1I4EB 3U0BA 4FPXA 1E2PA 4U2FA 4YYEA 1GPUA 4HOYA 3DKIA 2Z04A 4YJ2A 3M5CA 2YJZA 1T34A 3Q88A 2BSXA 3A11A 5DRYA 3EXIA 3ECSA 1QFZA 3THWA 2IQIA 1QAOA 2X77A 2PSDA 3C3JA 3HFGA 3U5TA 5LJLA 3IUNA 2DCCA 3UUFA 4G0NA 1RS0A 1GZ7A 2ZQ5A 3Q5DA 4ZVPA 3R8CA 5JXGA 3T5CA 4DR3B 3Q8MA 2H5IA 1H23A 3FDZA 1FPMA 1UEIA 5I7SA 3A14A 4FINA 3VHRA 5KNBA 1X1DA 1A4IA 1DC7A 1QR6A 1PJ4A 2VPZA 3EOZA 2A0YA 3MT8A 4IIEA 3RRMA 1ZFNA 1DMRA 5CLGA 3H5OA 2H4HA 1A1SA 3JQFC 4IDOA 1XKLA 4LJSA 5IT9A 2QM7A 5CFMA 3RRJA 4M37A 2AI1A 2KX7A 1UQTA 1THZA 4HNHA 1RWNA 2M9MA 3B9QA 3HR8A 1EHYA 2IU3A 1P80A 4ND4A 1AKWA 1XVTA 3MINB 5LVAA 3KZMA 2IEYA 2WG2A 4L28A 3UK6A 4AZVA 1AS0A 3HXPA 3VV2A 3KETA 4DLBA 3D3QA 3IVGA 4BXOB 4AKIA 7GPBA 2Q5QA 1VCMA 1PJCA 2A4MA 4QQFA 4CF6A 3GUCA 2FNAA 5HMLA 2IXAA 3DFIA 4JB8A 2W0MA 4Q1DA 3T9EA 9GPBA 4UARA 3NJ4A 5MN6A 5F3WB 1PTKA 4BQRA 2DCBA 3W6UA 2X42A 3CZ9A 3A06A 4PQYA 4FIPA 2GO7A 4WNIA 4MDEA 4RH1A 5LQSA 5DTEA 3F8WA 1R10A 3G6WA 1GUZA 3AHDA 3I9V1 3LHIA 1XX6A 3W4JA 2V7PA 1W49A 5H0IA 2PBRA 1LDEA 2V74B 2IHJA 3A1CA 4LMPA 4JP3A 2PBHA 1DQYA 4X7RA 3M49A 3SBOA 3A10A 1CR0A 1PQUA 4MPJA 3PEFA 1L4UA 1XTVA 4EPTA 4L3VA 1FYDA 1CJLA 3LPLA 1ZUIA 1CV2A 4QFBA 3WNBA 3MTNA 3SX2A 3B38A 3R0VA 2HLHA 4QPCA 2SICE 3VSCA 3O8NA 4F3KA 4JI6B 3F5QA 4HSGA 5FAKA 1P18A 3LCVB 3OIYA 2XUOA 3MEQA 4BNWA 1P5ZB 2OUIA 1I33A 3P52A 5HW0A 4LV8B 3ZLJA 1NGSA 4PGGA 5IHXA 4QQNA 3BOSA 1GUDA 4U7FA 5FTJA 1U9IC 2XV1A 3EXFB 3MMNA 4HH4A 3OZFA 4HUJA 4CUKA 4ZN6A 5A6VA 1JWBB 1B0UA 2D5IA 3OCVA 4J0KA 2A9KA 2PWAA 1HLPA 3U1TA 4UZEA 1WB9A 3K6JA 3CYFA 2DKFA 2X5KO 3A6EA 4ZVKA 2HK6A 3C16C 2P8SA 3UW1A 3K8UA 1YULA 3SSOA 2NG1A 2WJIA 1IY0A 2ZJOA 1GOTA 4HL6A 4R41A 5BN5A 4YV0A 1RAAA 1U2GC 3LT1A 5KWVA 3UMBA 4E15A 2JGDB 4RCVA 5CM8B 1TCUA 3WIVA 2B30A 3NRBA 1LPNA 5ITSA 1A9XB 4O4IA 1QPBA 4RGVA 4CNBA 4AIIA 2K6GA 4L4SA 3KJFA 2FAXA 3K5HA 4REQB 4HWTA 3TTVA 1H6CA 5B7QA 4TTRA 1D9XA 3MPOA 4MV6A 3FIJA 3M5PA 3K5PA 5DV9A 3GI1A 5EKSA 2F3SA 2RG1A 2RH4A 4MVJA 5D7BA 4MJLA 5I7HA 3VTFA 2YC4C 1OXTA 2PKYX 3IODA 4PANA 1U1IA 4HWYA 3NWEA 3CW9A 4FYHA 4WERA 4MQ6A 4F38A 5M04A 2KS6A 1PW7A 3X1KA 1TVEA 2BP7B 3UTCA 4I2NA 5CB8A 1AQIA 1JEAA 3LQ2A 1LPMA 5JCJA 3MGGA 1EDOA 1ODLA 2HKIA 5HF5A 1HDZA 1IXSB 3N76A 2HWXA 4Z9AA 1NX6A 2ZJ7A 5ELMA 3VTAA 4BJ3A 1Y1RA 3R9IA 3FA2A 4P3XA 3WMEA 4BIMA 3HRKA 3NH9A 4C6SA 3D8SA 4KMOA 2O23A 5FYQA 3UMFA 4EA9A 1TYAE 5B7NA 4BLRA 5H80A 5E3HA 4LJ5A 2YFKA 5AJUA 2VQDA 1T3LA 1GUYA 3TPCA 1UKFA 4N54A 2VWQA 3FRHA 1BFUA 3CRNA 1TX4B 3FF4A 1MJNA 3ONEA 3QVUA 4TWIA 3JQ9A 1NRIA 3KWBX 3PEEA 1IM5A 2R6HA 4FS8A 1GL6A 2EX4A 4Q7EA 4ZEXA 4F12A 1W5FA 1JL3A 2ACWA 3MJVA 4J2TA 3PK0A 4R1NA 4U02A 2ZBRA 3NGMA 1ZMBA 2C9DA 1JI3A 3QFRA 2WJPA 2PXXA 3Q87B 3EGVA 3ZE8A 3WAKA 2QT9A 2WA2A 4MEAA 2IYRA 3BMCB 4ERXA 5JAHA 4C2AA 3NHYA 2JGAA 5DM1A 4U7PB 3DV0A 2BM1A 3H9JA 1VHWA 4DG5A 1JWLA 1QR2A 4I4TA 1JHZA 1T6ZA 1FUYB 2ZSBA 3VOTA 1KKLA 2NZYA 4XX0A 2J46A 1SVLA 1WG8A 4K6GA 4CQLB 1FTNA 1GARA 3CPSA 2ZTVA 1IJKA 2AA3A 1F7VA 2V0GA 1D9ZA 1JG6A 1FSFA 2WUFA 2FE8A 1YSCA 2JFNA 4WZZA 2ZB8A 1S5PA 2HIHA 5JQGF 5JR3A 2Y0CA 4GMDA 2P0YA 1BMTA 3SEQA 1QXPA 1H69A 2QNBA 4Q4LA 4PPGA 2WBFX 2VSXA 5EJMA 3OJCA 2KWIA 3KJHA 3H5TA 1T5SA 4PLZA 4Z0HO 5EXSA 4IO0A 2BKEA 2A0WA 4LHEA 4US2R 1AKTA 2VXBA 2Y77A 4DR4B 5IWAB 4F11A 1NW3A 4EQZA 4M8NE 4WZBE 2IZ1A 5CNJA 3LUKA 4NMWA 2DEUA 2OC4A 1FZQA 1U7UA 3VR5H 2QSYA 3K9QO 2VUHB 1VM6A 1DTSA 2GAIA 3DYBA 5CXQA 3LCCA 3QYAA 4FFWA 4LDAA 1NMYA 4AUKA 3O7WA 2C5BA 5F33A 4ZZ0A 2E4AA 2IEIA 1QK4A 3FZEA 4X1YA 4TXLA 4J3NA 3OZAA 4HUTA 2W6NA 1KYXA 3F4KA 1II0A 2QRVA 4QODA 4CL3A 4TV9F 1ZRSA 3IB3A 3UK1A 5CT5A 2A9JA 1Y7LA 4DMGA 4J0DA 2AI3A 1QDLB 2QUHA 5LKRA 5B3JA 2OA0A 1I30A 1ZD2P 4LGCA 3DF7A 3BBLA 2GEDA 3LBNA 2W58A 3NYWA 4OCZA 3CUTA 3T9AA 5C35A 1CQIB 3CFYA 3PGXA 1KVRA 4N40A 3KCNA 5HRAA 4TRRA 3OM8A 4UUPA 4LSWA 1VL8A 1LQTA 3W31A 2PCJA 4YQZA 3CLHA 4Q4HA 2F8MA 1SQ0A 3UMJA 4BBJA 2FUEA 1SXIA 3AR5A 4EYKA 1Y8QB 3A36A 1H9AA 2ZWVA 2DFDA 2WZBA 4GKAA 2AIRA 1Z5UA 1X1QA 2KBEA 1W85A 2ADFA 3OPYB 2PGIA 3QRWA 3GLSA 4JJ6A 3VU9A 4YPFA 3WLIA 4FMBB 5CEJA 4RMHA 2X0NA 4Z0NA 5A3QA 4M0LA 4LCJA 1G2IA 3BQMB 2UZIR 3QUAA 4HDSB 1PS0A 4RE5A 1YB4A 2QAGB 4F96A 1RACA 4E2FA 2FCRA 5IYZB 4KLZA 1D8TA 2CNDA 2GZ1A 2OZLB 3TLZA 1W36C 1IRXA 5TF0A 2EFCB 3QBEA 1XDZA 5A9RA 2R1VB 2QRGA 1GG2A 1OPXA 3OQHA 3DC2A 3LQRA 3ZDCA 1M1YA 3WGUA 4JI5B 4EATA 1E2IA 1A5BB 1GKIA 1ORRA 1PIPA 4YRIA 1OR8A 3AVTA 1Q1NA 1Z83A 1ZVKA 3UXYA 1AT1A 1B3RA 1I2ZA 2V0CA 1QCYA 2B4QA 3TW8B 5BN1A 3GW8A 5HDQA 4C5AA 3HMKA 1NJ5A 5KEIA 1D1QA 5K3DA 3RS4A 1O54A 4Z8YA 5E4TA 1YR6A 1BCRB 1MO3A 1ZOPA 3AJDA 3CSUA 3IXLA 3SGLA 1GQOA 5DNDA 2JA2A 4LX8A 4EIWA 5EKDA 3JY6A 2WOOA 2O0LA 3PUZA 3HUUA 5BNFA 5KOJB 1ZW6A 2NPIA 2I80A 3UNXA 3AINA 3TNLA 4IQ4A 1BX1A 3P2KA 1LEHA 5FIUA 1X7GA 1SCIA 1TXGA 2NPOA 4LN1A 3RK0A 1JGTA 3AHJA 2WT9A 2VT2A 1D2MA 1X80B 3MRSA 2B9EA 3TD2A 3CF0A 1FIUA 5DYNA 5FBRB 1AKNA 2DY0A 4WX2B 5COQA 5DLQC 4L8VA 3EIWA 3P9IA 2DR2A 5I51A 3PJGA 4IDQA 2BFWA 2P7HA 1YHNA 3FFXA 2IEZA 4ARCA 5REQB 2HSZA 4EYEA 4KR0A 4CM9D 4DAOA 1CK4A 2ODNA 3ISVA 3OPYI 4JN6B 4G56A 2PIDA 3BICA 1VYUA 2F9FA 4QBKA 4BVLA 2P8JA 4FGZA 3CKMA 5DXFA 1N4DA 1JAYA 2BGNA 1VGVA 1G20E 4ZJUA 1Z6TA 5LP6A 4JI8B 1OLUB 3ZE9A 1QWSA 3A6ZA 4A0HA 3L7IA 3IOEA 1Q0QA 2GN6A 1JDTA 5CK4A 1KYVA 4B3DA 3OEYA 3GL9A 5B7PA 4XPIA 4RV5A 2HO5A 1MGPA 1O5OA 1DZ3A 3K1YA 1LPBB 4HGNA 4DWWA 1H05A 4EABA 1KK3A 1T4BA 5FQOA 3WB9A 3PE6A 2EP7A 3GCGA 4XX1A 2WYWA 2F17A 3OT4A 3EUEA 4C14A 1MZPA 2PRJA 1F0NA 2VAMA 1E8MA 2YN2A 3SJAA 5LQDA 5KMGA 1XP5A 2DUMA 2DBRA 2WABA 1HFWA 3BD9A 4XLTA 2JDIA 3A6HA 2O2CA 4ZUXU 4BX0A 4M7PA 1AURA 5F64A 1KJJA 1QV9A 4A6XA 4ZCTA 5AD1A 2QLTA 4C9BA 1WW2A 2C20A 2GPNA 2VNAA 3FOBA 3G17A 3C4JA 3SC2B 1JXOA 1TD1A 3ZE2B 3GB9A 1W94A 3WHPA 4EMTA 3ZX5A 1E7MA 5F78A 3BWKA 1Y8CA 4XLLA 4MWOA 5DNAA 1HT1E 1UBJS 3ZE0B 1JH8A 5IVPA 1RI4A 1JIIA 1ILEA 1H1LB 2ZSUA 3KKKA 2NYRA 4EBBA 4RS4A 3ZWDA 3GCDA 3KJEA 4GYKA 1SQFA 3GQBA 4MIEA 3TG8A 4C76A 3M70A 2G6BA 3O2JA 5AI5A 4KLRA 1XHEA 1NP3A 1TEVA 2CLHB 4GZMA 4R3WA 4E3ZA 3WMFA 2GXUA 5BVHB 4DMYA 2AVNA 2XBUA 1XLTA 5IP5A 2ZTMA 3E8MA 3CJQA 4FYYA 3SYMA 4KQ1A 3WO1A 4MYSA 4J16C 4B3HA 5AXCA 3OI7A 1KOJA 1U63A 5EJIA 3DYIA 4MPDA 1ATIA 1M0WA 1YO6A 2QJTA 3O1IC 2IPMA 3DMYA 3H11A 3ESBA 1WKBA 2D59A 3ND8A 1LK0A 4KGZA 4S12A 4BO8A 4K6OA 4O59O 1R0SA 3O4IA 3RTBA 4RJLA 2VWGA 1GLNA 2IYEA 3RVNA 2GZDA 2IPPB 2FA9A 3COZA 3WLEA 1AGYA 1CNMA 2JPDA 1TECE 3C3DA 2VXOA 3I6QA 3KVRA 4WASA 1Q14A 3U49A 2W22A 5EZQA 4A16A 2VP2A 5ETJA 1XI2A 1U0NA 2IV2X 3ODGA 3T8YA 1P5HA 2PLAA 1KHQA 4JD5A 1ECCA 2VDKB 2IL1A 3C4QA 4HO1X 1B7GO 3EGWA 4RO0A 1DARA 2VPIA 3AQIA 5ALFA 4ZYZA 5BNWA 4RTOA 5DMHA 4OQZA 3FTQA 4JGBA 3S6JA 1H9BA 4D4KA 1XZFA 3F5MA 2XPCA 3K5IA 4P4TA 4TT8A 4XYMA 1XU7A 3ME5A 1AU3A 3T1OA 1NUSA 1NE7A 1RFLA 3LO5A 3G2LA 3X43A 3TL6A 1VIDA 3HB0A 1Z26A 4MLDA 5FOWA 4EYGA 1H85A 1VB5A 1QOZA 4MW7A 4PGFA 2R6R1 4PCVA 1M2OA 3PNLA 4RXUA 2HADA 4AZWA 4HMPA 4JR0A 1BO6A 2MOKA 3LA8A 3R3VA 3R6LA 4MYHA 4UHFA 4WKPA 4ETNA 1FOEB 3WI7A 4UBKA 3L79A 5JQGB 1BHSA 3P9RA 2NUBA 2D7JA 3PX7A 5F73A 2GQ0A 3L1KA 4JLAA 2WWGA 4ZO6A 1PVOA 4QLAA 5HZKA 2XW6A 1ZKDA 2XZDA 1RTTA 4DB4A 3VXKA 2QHXA 5C1IA 5CVDA 2B25A 1WX1A 2UVPB 1NN0A 4MP8A 1ODSA 1X13A 5AJYA 3CZQA 4I50A 2XBMA 3JQRA 4XUEA 1FMTA 5B55A 3L40A 4PQRA 3RHZA 3PXUA 5C1PA 2CNBA 4OGWA 4O25A 1N6PA 2Q6LA 3GFBA 3QVGA 5TSDA 3JVEA 1U2DC 4MGIR 5EG5A 3OTWA 4LYHA 1QBKC 1USGA 2GEVA 1EEHA 2ZSJA 2QXYA 3AKYA 3G2PA 3H8VA 1OH7A 1XLUA 5DTQA 4TKVA 1P31A 4IPTA 3SBDA 3MTJA 3GFGA 1XD2A 1BJTA 4FWTA 2MMCA 3A7DA 4Q8HA 4C05A 1VE3A 3D5EA 1BCSB 2PRSA 2EV9A 2CXOA 4PFJA 4LFBB 3WKEA 2WLTA 4K9MA 2BTEA 2YINC 2Z95A 4XSVA 4BDTA 1P77A 5JNWA 3G79A 1IATA 3HBMA 4UEQA 1F12A 3LQYA 4EY7A 5KOYA 2NO5A 1E0DA 1XXHA 3GLGE 2O0MA 3GJYA 3GRUA 1XPRA 3DD1A 3A04A 5IZCC 1PADA 3CVXA 1EFKA 3GJ6A 1E79A 2VJQA 4F6CA 4IGEA 3FAKA 1R4NA 2H2IA 1JQ5A 2WHQA 5B3AA 1S96A 2OUKA 4UTVA 1YUNA 1PGOA 1X8LA 3HADA 2ES4A 1GPDG 1JKIA 1GU1A 1V8OA 2Z8ZA 1JT2A 1P3DA 5D6OA 5AKLA 2RHBA 1FMCA 5IASA 2HMAA 1EFPA 5CFRA 2A1UB 1RPZA 1PWHA 3QXSA 3Q41A 1POXA 2ERCA 2PX2A 4ER6A 4W4TA 2QN9A 1OSNA 3O3OB 4CMEC 1V8ZA 4Q37A 2C2ZA 3TNJA 2GZ2A 3QFTA 4HD8A 1K8XB 1EXVA 1OYVA 4TXJA 4IV0A 4BBAA 3MQFA 4QRGA 4X6HA 4REZA 3ETDA 4JY7A 2WWXA 2EJVA 4EB3A 4TL9A 2PT5A 3PZRA 4FGLA 1Z4PX 2NZ2A 5HPYB 1XAHA 3Q7EA 2ZU6A 2Q9AA 5I9BA 4C43A 1UR5A 2YWRA 1Z5VA 5T4HA 3ETLA 2A0KA 4ZRMA 1MEEA 5KINB 4ZVUA 5EHXA 4P31A 5DT9A 1RZVA 2ZTHA 4G4SO 5L53A 1VDZA 4S2UA 3TW4A 1M1XB 2FX2A 1TGVA 1SVOA 2H2AA 3HJNA 4QXOA 4NEQA 4MVJM 2IT1A 2N1MA 2AXQA 1L5NA 4G0UA 3ZNOA 3IE1A 5ALLA 1C7FA 3I3TA 1V11B 3C39A 1Q3KA 2AJDA 2C0PA 4OHKA 2EYQA 5EJEA 3B1KA 1IWBB 3ED1A 3LHKA 6NULA 3PQ8A 5I47A 2R9VA 1YBFA 4RELA 2XRFA 4OYYA 3ROFA 4HZUB 4XJVA 3FN4A 5ESDA 1TM2A 1SXQA 4WZBA 3OE7A 3URMA 3IXMA 4TMWA 1J33A 2YJ9A 3CRVA 3HV2A 4TV8F 2BUCA 3OLXA 4A8JC 5HSGA 3CKYA 3DE2X 3I2GA 5FPKA 1ITOA 2PA0A 1VLJA 3W7BA 3DZIA 2E4UA 1V6SA 4YAFA 5JFOA 1ATZA 4JGIA 3TLMA 3PQDA 3O90A 5AJVB 5HZGA 4TYNA 4XCQA 1JG3A 1UKVY 3QJYA 1L6IA 4QX6A 4NBKA 4ZMBA 3K1AB 5BXQC 4INPA 3H2GA 2PO7A 1L5VA 4D9BA 1PSDA 4I99A 5IS2A 1G59A 4CKCB 3CRRA 4RA9B 4LYGA 1XC7A 4DWJA 4E46A 3IV2A 3E8SA 4JLMA 4CLOB 4ZYTA 3R5XA 5D1NA 1RXVA 2VF8A 1SBQA 1KBZA 2P5SA 1G17A 3JWGA 3LXUX 1TU0A 3B79A 2QMYA 3ZGOA 3GJ4A 2UZ1A 4HDQB 1YT5A 2P9JA 4WK4B 4BOYA 5JU6A 2XH8A 4YRLA 3IAM1 1TU4A 4O0MA 1Y1LA 4HX2A 1P1CA 5TGDA 5K9ZA 4DLYA 1E7QA 1ULSA 2FMTA 1MAVA 3AF5A 3MS7A 1F2AA 2O4CA 4YYUA 2C9YA 2BTOA 1RWOA 3CWCA 4BC1A 1G4UR 2CJFA 4WFIA 3S40A 4BMCA 2WOJA 1DSSG 4BX2A 4DYVA 1T0IA 1P8JA 2YV1A 1S02A 2HX1A 4Z51A 1H1DA 4QOJA 2ZWMA 3QLVA 4JMPA 3JYQA 4IDGA 2Z6AA 2RMKA 3PBKA 3TDMA 2B20A 5K3OA 4OH1A 4LXGA 3RT9A 1FYWA 1QX4A 4YJFB 3R8FA 3K9BA 4R3DA 1VHLA 5LOVA 2P1ZA 4BB5A 1V7QA 5I7WA 5LYYA 2NO0A 3MJDA 5LDDC 4DCCA 1X1AA 2D8MA 1SUFA 2I6QA 3TE6A 5JFGA 2PO5A 1UPBA 2VXCA 4DN6A 5A4JA 3JW8A 3R0QA 1ZIYA 3MWDA 2VAVA 1NKVA 4OHOA 5ALXA 1H8EA 4ZYLA 5B3KA 3RBZA 3DSRA 5DGCA 4QRIA 3LY5A 5BORA 1T1EA 4PZAA 1CFJA 1UEXC 4GXNA 2NU6A 5LYJF 3RGWS 4C08A 3IUYA 3B6ZA 1DNPA 1TM4E 4R1TA 4WNAA 5E9QA 4R71A 1R8YA 1WXEA 2UUCB 4LV6A 3ND7A 1BD4A 2B7LA 4ND3A 3VR6A 3GP8A 5H3HA 2AS0A 4N8EA 3VNQA 2IZ5A 2C2KA 3I2FA 1GKKA 1BMDA 2C29D 3PVZA 4J1TC 4LJKA 4YCDA 4O2AA 1ECPA 4RD0A 4WK6A 4BLPA 4CCYB 2HK9A 5DBFA 3V4RA 3QBJA 5HS6A 2VPQA 3OY2A 3WWDA 4X00A 2JLXA 4I8DA 4HLQB 2K2QB 4UJ5A 3P0HA 4J75A 3OSZA 1C7RA 5KKNB 2P77A 2DYKA 4GLOA 3RU9A 2Y2VA 4DQDA 3L8EA 5A9SA 1HQCA 1QIMA 5K0CA 3TBKA 3WA7A 2AEFA 3PPVA 1GCUA 5GGYA 4AWBA 4N47A 4NICA 1YKGA 4N39A 2LCQA 3R3ZA 5JV5A 7REQB 3U5ZB 1MJHA 5JAUA 1ZA1A 4FFDA 3I8OA 4OREX 3HY3A 3FB1A 4IIJF 4CTNA 5ED4A 1AO3A 3I5AA 3IOCA 1R8JA 4DCJA 3H8CA 3ELWA 3ZXIA 1KS2A 3EAFA 4YAWA 5J40A 1XV5A 1U8UA 1ZICA 2RONA 3C7CB 3HKBB 1Y1SA 2MHCA 1LDMA 4NDNE 2NN3C 3D7SA 4ID3A 1NQVA 4N5DA 4ARSA 5I7VA 3PQEA 1HOXA 1N5LA 1RVV1 5CA0A 4WSOA 5HKAA 3ANLA 4CI0B 1QC5B 1HT2E 3C9EA 3NT4A 2Q5EA 3WLQA 2YZ2A 5IDXA 4MXDA 8AT1A 3EZ9A 4A5OA 1L7BA 1H6AA 3IQXA 3LT2A 5IVIA 4WMLA 2KBFA 3TLXA 2PAAA 2VKTA 1DRVA 2L18A 3K8QA 2MR6A 3F96A 4G0PA 1IDOA 4TQGA 1PE0A 2D0IA 1SPXA 2HJSA 3NKFA 3T1QA 3V7YA 4I5EA 5GADl 3RG8A 1KEWA 2IYLD 3QEBZ 3ABRB 4N41A 2AUXA 2G08A 3H87A 1KI1A 4RACA 1SRQA 3WKDA 2VSOA 1PI3A 4ABTA 5CXSA 2IHNA 1TT5B 4DV0B 4BQFA 4JLPA 3DE1X 2OZ2A 1LQUA 3S0JA 4LZLA 1ZEJA 2CLOB 2ZPTX 1V8DA 1Z12A 4QSHA 3MFYA 5FWXA 3O26A 4MQUA 2OYCA 1E2UA 1YA4A 1T8RA 1W4BA 1GR1A 2R5WA 2RFLA 3DO8A 1FYEA 4IY1A 3UAYA 2ST1A 3F3SA 4Q9NA 4CKWB 2BGJA 4NS4A 4N3NA 2OPHA 3BL6A 1M2HA 2QXUA 3T9FA 5ADHA 3L4EA 4JNCA 2X2PA 4HNGA 1WY5A 4ZVVA 3V3TA 2W2KA 4JJZA 1R6TA 1EQUA 3I30X 4H0FA 4KXUA 1Z6YA 3GFRA 1YL5A 3FVVA 5HE9A 2HV8A 2FRVA 1J49A 1H65A 1NG1A 4WW0A 3X1XA 1ZAYA 2EG5A 2FT2A 2XUKA 4LWOA 1XBTA 4K46A 4YV7A 2VTEA 3MELA 5IBRA 1Z6QA 3K70D 2CJPA 3F78A 2GCIA 3LNTA 3NC0C 1AIPA 2FPKA 4ESHA 4QJ3A 4FYVA 3IURA 4NYIQ 3WIEA 1MOSA 7AT1A 3FOWA 5ALIA 3NHRA 3WFJA 3WNDA 3AI8A 4JEHA 3TMYA 1NT2A 4DADA 1O6ZA 5IJ0A 2FR8C 4KWTA 4YXWA 1S3FA 3I4LA 2IITA 2C99A 1H2HA 4X3PA 3WTBA 7ADHA 3OETA 2HA2A 4ER7A 1K3TA 3INYA 2VHFA 1OASA 4CJXA 4TLDA 1A4XA 3DMTC 3AILA 2Y5BA 1PK7A 4R2LA 2FLWA 3SLGA 2BONA 1CJCA 2HK7A 1ISPA 2QE6A 5YASA 4X7MA 2CHGA 3O91A 5LM3A 4AZSA 2AJBA 3OVZA 4D8IA 5AKZA 2FO5A 1NW7A 3LBIA 2D2IA 2INGX 4UOEA 4PZCA 4B9AA 5JD4A 1POPA 1TTHA 5DXAA 1JA9A 3IFSA 4IKPA 4JBNA 1U1GA 2JHGA 2NT4A 3PRPA 4HAZA 1R0KA 1FUIA 5HK9A 2VRWA 1MAAA 2Q5FA 4JDUA 1P1IA 1QHSA 2GD6A 4PIPA 1W46A 1Q22A 4LI3X 5EIBC 4C7JA 1CUHA 1EGQA 1Z18A 1ZQ1A 2QXTA 1J2YA 1IBCA 3LOUA 4TV8B 4ALJA 4YIKA 4RPKA 1HWYA 4LQCA 3WC4A 1SG6A 3QNWA 2J0UA 1FP6A 1ML4A 4M3NA 4XH9B 5EWLA 3PUWA 1N8TA 3GGOA 4UTOA 5B53A 5KAPA 1NQCA 3QA9A 1SKUA 3JU3A 3W77A 7YASA 3U7FB 4Q3CA 2GCGA 2Q45A 3L4BC 1BDBA 2DH6A 2YHSA 2VPXA 3PXCX 2FSVA 3BXGA 3DT6A 3I58A 4UXIA 2AV6A 4D8YA 1CS0B 1M67A 3PDHA 4Y6OA 3WKBA 4KDFA 4XYGA 3KU1A 4RHEA 1X7WA 1Y7HA 4EPYA 3D43A 1B3BA 1FVHA 1W19A 4HWPA 3BIWA 2I7XA 2OGZA 3LK6A 4V0SA 2I4RA 4QBIA 1N5JA 3DG9A 5A5GA 3MD0A 4CMCA 3ADOA 3HZOA 1U2GA 4IG9A 4NH0A 4GQAA 2YY7A 5K3CA 2C84A 4AMUA 4E5NA 1W36B 3DVQX 1J0DA 1XN1A 4WLUA 1YCGA 2NU8A 5AKIA 3FJYA 3FPLA 5KYVA 1DKLA 1T1RA 3C3XA 3AR7A 2F90A 5ALRA 5LMUB 3HYLA 2V65A 1GPNA 2E4YA 2CKDA 4GMFA 2GKOA 1JDNA 2IYWA 2RHOA 2OHOA 1HDOA 2BD0A 1ENZA 1ZXLA 2ZBGA 2D5BA 2EQ5A 3CEJA 3QQ5A 4IP0A 1YR2A 4UFOA 4ZZ1A 4M1QA 3HKCA 4DXAA 1QRSA 1UAAA 1F14A 2BGKA 4JJGA 1W52X 4JT9A 4S0XA 4UFNA 5DW3A 1UAGA 4FW8A 3X1YA 1E7SA 3TCXB 5SZHB 4FJCA 1XNQB 2O8NA 2QGZA 1KEKA 4F5DA 1WBJB 3RFCA 1WOMA 5ALVA 3WWOA 3IPCA 3KB6A 3OX4A 4C7OA 3EZGA 3V5NA 5T3YA 3J7AC 5DN6A 4MYUA 2VIIA 3DCIA 3L0DA 1HM5A 4L5JA 1R0XA 3IQFA 3ZW7A 5JAMA 1DS6A 3DLCA 3JTMA 3PR2B 4RBNA 3T7CA 3NVKI 3VJRA 3I1JA 5KTSA 4G09A 2VNKA 1Z16A 2GAFA 3IPYA 3L1HA 2A30A 1RQ7A 3MS4A 4MUXA 4RTKA 1AU4A 2BDUA 2Q5JA 1W75A 4J0HA 3TDNA 1I2AA 4ZDKA 3BGWA 5THKA 2CDAA 2PQ0A 1UKZA 1GY8A 5D00A 3AESA 3M1YA 2QLLA 3OLYA 3S55A 1AUVA 5LYJB 3PEWA 4KR7A 1RMYA 3SKVA 3HKDA 4IHJB 4JLNA 1R6UA 1MX1A 1Q0ZA 3KKOA 3MLAA 3ZHRA 1HRDA 4FYIA 3EFHA 5FFNA 3RC9A 4NZMA 2PVSA 4H17A 4Z99A 1BY8A 1V37A 2O4UX 3JV7A 1UT8A 2V0NA 4RENA 3LP6A 3SSMA 1XMPA 4ACAA 1UAYA 2NVOA 1P0PA 3KJGA 4D8WA 4EY4A 5D5PA 3VC3A 2RI1A 2O1SA 1GYQA 2BFOA 2ZWIA 3L82B 5T4BA 4ED9A 2FRAA 3MTGA 1D0SA 2XCOA 3CR7A 2VF5X 3WQBA 5JH3A 1WJGA 1IM8A 2DLNA 5ESRA 3G68A 1N2IA 2C83A 2Q4TA 3CUWA 4JK3A 2AZ4A 4G07A 4DPKA 3FE2A 3TRDA 4P38A 3EW9A 1S2LA 2D54A 4RTNA 3CR3C 1NLJA 4YAJA 5B30A 1CPJA 2X40A 1ADBA 5EE1A 4D41A 4TYPA 3DNMA 5AW1A 5IM4F 4JLDA 2XHZA 4IWNA 3L05A 3WBKA 1N92A 1R1DA 3RT1A 1GNVA 5E2IA 4IIJB 4IH4A 1DGQA 2CMKA 4EB0A 2J85A 2J3JA 1E99A 2ZUBA 3UJ9A 1DQZA 2QU7A 1C7ZA 2I6SA 4PAQA 1B8VA 5JFTA 4EUHA 3D8RA 4NPAA 1CTEA 4HYYA 2TMKA 4M0WA 2C7RA 4JDPA 2I4MA 3BXEA 1LVGA 3LKVA 1YVBA 4DYDA 1DL5A 1NQWA 2JI9A 2J67A 5G0TA 5JNTA 1W48A 3TS1A 3VDQA 5EHIA 3ZVLA 5MFZA 3HCRA 3USES 5AW0A 1ZUNB 1AN0A 2I3DA