2HWKA

Crystal structure of venezuelan equine encephalitis alphavirus nsp2 protease domain
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
b'DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords helicase nsP2
molecule tags Hydrolase
source organism Venezuelan equine encephalitis virus (strain tc-83)
publication title The Crystal Structure of the Venezuelan Equine Encephalitis Alphavirus nsP2 Protease.
pubmed doi rcsb
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2hwkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2hwkA01
5E1DA 1KPGA 3C3PA 4MWZA 3JWIA 5CIYA 3UA4A 2XBMA 3ELUA 3GJYA 2OBFA 5DM4A 1NE2A 5EMLA 5ERGB 2ZBRA 2UYOA 4C06A 3Q87B 4GOMD 5CVUA 2XVMA 3HCAA 5BXYA 5LQKA 4PYNA 2UYCA 3UJDA 5E9WA 2H11A 3K0BA 3LCCA 1QAOA 1KR5A 1RJDA 1NV8A 2ORED 4RTNA 3SSNA 1FJXA 2O05A 2ONYA 1XVAA 5GP1A 2UZ4A 4YV1A 1WZNA 7MHTA 3Q7EA 4P58A 3LKDA 2ADMA 1HNNA 3HP7A 3EMBA 3SXJA 3HCFA 5KQSA 2NP7A 4CXMA 1I1NA 3NW9A 4MTLA 3M70A 4YV2A 5K03A 3DMHA 3FUWA 3E7PA 4M7RA 3TKAA 3O31A 2QM3A 2YX1A 2P3OA 4L7VA 5HIMA 2AVDA 3EMDA 4QTUB 2I6GA 2ZIEA 3OU7A 4AZSA 4FT4A 1XJ5A 3GRYA 2AS0A 2XYRA 4R8RA 5EKXA 2YXLA 3ANXA 4BY9E 1G55A 3I9FA 4HH4A 3AY0A 4RVFA 3TLJA 1NT2A 1XXLA 5DTRA 2FYTA 2P41A 5EOVA 5FTWA 3KQVA 1DL5A 1RI3A 2AZTA 3EEYA 3SM3A 3V97A 2IDJA 5ICFA 2HNKA 4E70A 4EMSA 2Q41A 5C1IA 2IBTA 3OZSA 4R6XA 2I9KA 4X1OA 3BGVA 5E2AA 2V74B 4QQNA 4E2YA 3AWIA 3BZBA 3NMUF 4BLWA 4RTJA 1ORHA 4ATNA 3T7RA 3TPZA 4U7TB 2OB2A 4QDJA 1ZG3A 2ZW9A 5EVJA 2I62A 3KPYA 3M6UA 3BT7A 2YXEA 2EJUA 4P7JA 4KVZA 1JG2A 3HVKA 3MCZA 3G5TA 3KU1A 4RTOA 3KKZA 4FP9A 4BP3A 4AUKA 1T43A 2GB4A 5K0NA 1L3CA 2PLWA 2ZWVA 3KPJA 3P71T 3BGDA 2ZBPA 4LG1A 1XCLA 1V39A 1I9GA 3HTXA 1YZHA 8MHTA 4E2XA 4QDKA 4PNEA 4IV0A 5CUQA 3SGLA 3LDGA 4HG2A 1VBFA 3PS9A 3CBGA 3UA3A 4IKPA 1JR4A 3DLIA 5M5BA 2BR5A 3A7EA 1AF7A 2QYOA 1NW8A 3B7PA 3UZUA 2PJDA 4C4AA 1KYZA 1D2GA 3P9CA 4RTPA 2EX4A 4O29A 4RTKA 2ZWAA 2VP3A 4DCMA 1BHJA 1ZQ9A 5HIJA 3DP7A 4GC9A 5E9QA 2G1PA 5T67A 4R8SA 3KR2A 1VP3A 4GUAA 1ZKDA 3RODA 2NNWB 3THSA 3REOA 4CTJA 2NXCA 4Y30A 2WA1A 3CKKA 1R18A 2CMGA 3KQOA 3SSMA 4E30A 2ZIFA 3CCFA 3O7WA 3LX6A 2HV9A 3UJ9A 2G8NA 2PWYA 1AV6A 4C07A 3T7TA 2ZZMA 4HC4A 1Q0SA 4YMHA 1G8AA 3FPEA 3A7DA 1X1BA 3AXSA 4BLVA 2YUIA 1Z3CA 3A25A 2ZZNA 5LQJA 1YFJA 1R8YA 1RJFA 2P1DA 5DX0A 3T0IA 4CKEA 1F38A 4RYLA 4ER7A 3G8BA 5HIIA 1BKYA 1NW7A 1L1EA 3G89A 4XUCA 3EGEA 1EJ0A 4QTTB 3FTDA 2A14A 4DCGA 3NWBA 4EKGA 1D2HA 3CVOA 1R6AA 2VDVE 5DXAA 4XUDA 1YF3A 2IH5A 2GH1A 4EKIA 3EVGA 3HCEA 4QVGA 2GLUA 2P3LA 3E8SA 2PWPA 3DH0A 2ZBQA 3B5IA 3LPMA 3R0QA 1FPQA 5EEGA 5EMKA 4MHTA 3A4TA 1R8XA 2PV0A 4PINA 3EEOA 2PXAA 3CJTA 5F2NA 1WS6A 5E8JA 3QOXA 1JTFA 1QAMA 5ICGA 2C7RA 2C7QA 3KQSA 3NVKI 3NWEA 4G56A 1SVUA 2V7EA 3GRZA 5DSXA 3RIEA 4PYKA 2AVNA 4DF3A 1DUSA 4KDCA 3VYWA 3G5LA 3P9NA 4WXHA 5P8WA 4DKJA 3FUUA 3M33A 1WXWA 3SMQA 2H00A 4YUXA 1VQ1A 3G2MA 3OE4A 3DLCA 2C7PA 4FGZA 4R05A 4QQKA 1O54A 1VL5A 2B3TA 3IV6A 3MTIA 5E2BA 4RTLA 3G7UA 2CL5A 3FUXA 1IY9A 2NXEA 5K0BA 1ZGAA 2R3SA 1M6YA 2WK1A 2ZSUA 3EVZA 1B42A 2O57A 2P40A 2NYUA 2ZFUA 3PB3A 5LSAA 4V0QA 1TW2A 3C6MA 3CGGA 2BR3A 3EVDA 5FWAA 5T64A 10MHA 1OR8A 3HEMA 1SUIA 2QRVB 2QY6A 1D2CA 1X19A 4GEKA 4MIKA 3RW9A 3GDHA 2XYQA 1NBIA 3QV2A 3TRKA 5HFJA 3GCZA 3OE5A 4KDRA 3GGDA 2B25A 1HMYA 2PGXA 3LBFA 5E1OA 3UBTA 1BOOA 4GC5A 3PLAE 2AN3A 2QE6A 1PRYA 1YZ3A 2AOWA 3SX0A 3EVFA 1IXKA 3DOUA 5K0GA 1L9KA 3UJBA 4XCXA 5FQNA 4CTKA 1M6EX 2F8LA 2LD4A 5FADA 3WSTA 5ICEA 1JG4A 3LSTA 4QVKA 4RVGA 3B89A 5LQRA 2PSSA 1QANA 1QZZA 4LWPA 2NP6A 1ZHFA 2JG3A 2C7OA 1JTEA 3KR1A 3I5UA 2AOTB 2O07A 3IHTA 3PT9A 5GM1A 4A6DA 4PYQA 4AZTA 3C0KA 4U7PB 5EPEA 1KIAA 4UOEA 5K05A 3MB5A 2IBSA 3FUVA 2GAFA 3A26A 5DX8A 3FTEA 1MHTA 3M6XA 2PX2A 1JSZA 2YTZA 3M6WA 4PYLA 5LR6A 4RTMA 3UWPA 5GOZA 5K0LA 3OPNA 3PVCA 2PXCA 2AR0A 4BLUA 4C04A 4BP1A 3FZGA 2PX8A 1VP9A 4P7FA 1SUSA 5E1MA 1RI5A 4P7GA 5IH3A 3ELYA 3EPPA 2VS1A 1QYRA 4PYOA 3EVAA 2ZTHA 3P2IA 4HRAA 5FQOA 3O4FA 4RVDA 3NTVA 3P2EA 3E23A 2AOUA 2IDKA 3KQYA 4DMGA 2ZZKA 1AQJA 4GOOD 1EJ6A 3LBYA 4KWCA 3PX3A 4EK9A 4IV8A 4PONA 3MHTA 1JG1A 2ZVJA 4KIGA 4KRGA 1X1CA 5DPMA 4DZRA 3EGVA 1N2XA 2FK7A 5DT2A 5G02A 3G2PA 3HNRA 3NJRA 2VDUE 3NDIA 9MHTA 1I4WA 2OB1A 3KQWA 3NDJA 1RJGA 3FPFA 5DTMA 4M36A 1SG9A 2XYVA 3FRHA 3G8AA 5HIKA 3MAGA 2I7CA 2UYQA 5F2OA 4ISCA 3AJDA 3R6TA 4FSDA 1O9GA 3GRVA 4HSGA 4R6WA 3TOSA 5LQCA 2JHCA 3HCBA 3KQQA 1NW5A 4OX9Y 4E2ZA 5LQUA 2GA9A 3IEIA 5CVJA 4DM3A 5EC8A 3FYDA 4RVHA 4C03A 2VDWA 5FA5A 3LDUA 4ER0A 3DULA 3ELWA 5MHTA 3MTEA 4GOND 3FRIA 2ERCA 2P3QA 1EQAA 4ZTBA 1BC5A 3GU3A 5FA8A 3DUWA 3D2LA 3KQPA 4QPNA 3U81A 5K8VA 3B3FA 4RTSA 1NW3A 4PGHA 1RI2A 2JHAA 2IGTA 2EG5A 1KHHA 2PY6A 5D1HA 4GQBA 2P8JA 3SSOA 3THRA 5JR3A 4FS8A 1NV9A 5ICCA 2OZVA 2P7HA 4A6EA 5EIWA 2IPXA 4X41A 4X60A 1FP1D 2JJQA 3KPWA 2YQZA 1TW3A 5FHRA 4E33A 3ME5A 3GNLA 2OY0A 2QRVA 4OA5A 4CKCA 2GPYA 5KYGA 4FT2A 3L8DA 4OQDA 1RI4A 1P1BA 1KPIA 2OKCA 4YV0A 5HZMA 2PBFA 5EG5A 1ORIA 1P1CA 2BM8A 4ER6A 1VE3A 1O9HA 2PX5A 3R3HA 4OA8A 3BXOA 3DXXA 3EGIA 4PGGA 4PWYA 1YB2A 2YVLA 3KQMA 4Z2YA 4AZVA 3PTAA 1UIRA 1ZGJA 2P35A 5E1BA 2OPBA 5E9JA 5EQJB 5HILA 1EIZA 3P9KA 3ELDA 2G70A 5DSTA 1KYWA 3BKXA 3HVIA 2EFJA 3BWCA 3UJ6A 5GIOE 3TQSA 2GS9A 1R74A 3S68A 1EAMA 4F84A 4KIFA 2Z6UA 1X1AA 1N7IA 3JWJA 3ER9A 2YR0A 5DTQA 5K0FA 3OU2A 2NXJA 3BUSA 3QOWA 2IH4A 4DQ0A 4RTQA 1WG8A 2ZLBA 5JUWA 2HR1A 5FHQA 1G60A 3P8ZA 2PT9A 5CVVA 4YUWA 5EZSA 1IM8A 2ZCJA 2AOVA 2G71A 2UYHA 3T7SA 2N47A 4IWNA 5EIFA 4FZVA 2FHPA 4YUZA 3E05A 3FUTA 1XTPA 4K6MA 1SQGA 5LQAA 5HEKA 2HMYB 3KQTA 3V8VA 5K0EA 1X1DA 1U2ZA 2FPOA 3LECA 3EVBA 4AX8A 5C0OE 5K09A 3G2OA 3KHKA 2PKWA 5EHIA 5DX1A 5CCXA 1AQIA 5EHGA 3F4KA 3HCDA 4PYJA 3ER8A 5EMMA 4ER5A 2O0LA 2IH2A 2B2CA 5EZQA 3C6KA 3TM4A 4OBWA 3DMFA 2K4MA 3UFBA 5CCBA 5GM2A 3C3YA 3LKZA 4OQEA 2CMHA 1RI1A 3HM2A 2VZ9A 2AOTA 4RX1A 1QAQA 4Y2HA 4AZWA 5BP7A 5HOQA 3EVEA 4FR0A 1DCTA 4C08A 1JQEA 5GIPE 2NXNA 4EVIA 4GF5A 5C9ZA 3G88A 4HGZA 5KS2A 2Y1XA 3OFJA 2AN4A 2B9EA 2ONZA 3I64A 3GO4A 3I53A 4GBED 3VC1A 3AXTA 4RSRA 4YUYA 4X63A 5FULA 1Q0TA 5DWQA 1JSXA 2IFTA 4FSXA 2P7IA 4GOLD 2O06A 3ID6C 5EGSA 4NECA 2DPMA 1INLA 3B3GA 5FCDA 5GWXA 2ESRA 1YUBA 4E31A 2Z6QA 3BWYA 3OZTA 4YMGA 3IYLW 2AOXA 3CJQA 3VSEA 2BZGA 2PVCA 5B1SA 3HVJA 3VC2A 2JH9A 3CC8A 3JWHA 4HGYA 3BGIA 2PX4A 1M0EA 2H1RA 5CVEA 4OBXA 2HWKA 3DMGA 3FPJA 3GIWA 3OZRA 3P2KA 1XDZA 5F2KA 2OXTA 5LQNA 3DXZA 4PCLA 2Y1WA 3MQ2A 4C05A 4X61A 1YFLA 4M37A 3LCVB 1PJZA 3FYCA 2JHPA 3EVCA 4E2WA 3HA5A 2B78A 1SQFA 3B3JA 1P91A 3R9XB 1MJFA 2BM9A 4HTFA 2BR4A 5T6BA 4PYMA 3NVMB 3ORHA 3MERA 2CWWA 1XCJA 1L3IA 1FP2A 3LDFA 3LL7A 2FK8A 5GINE 3HCCA 3DXYA 3TR6A 2OYRA 1NW6A 2YXDA 1XDSA 2FRXA 1F3LA 4F86A 3OFKA 5IKMA 4YUVA 5KVAA 2AOUB 5DM1A 1KP9A 1EG2A 3LHDA 3FTFA 3OU6A 4WVLA 3I58A 3OCJA 4RTRA 1L3BA 1NBHA 5K0JA 1SKMA 5FUBA 2KW5A 2OO3A 3H2BA 2HTEA 3FPGA 3KPVA 5KQRA 3BWBA 3P97A 3SVZA 1XDUA 4QPPA 3X0DA 4MQ4A 3FPHA 2WA2A 4EQZA 4HTFB 4JXJA 5EMJA 5DRYA 3GXOA 3M4XA 5CVDA 4POOA 4CKBA 2ZIGA 1P39A 1VIDA 4PIMA 1G6Q1 3MGGA 4H0NA 3TMAA 3LGAA 5H02A 2DULA 3UJCA 1RJEA 1VPTA 3HA7A 2BH2A 5K01A 5D1NA 5U4XA 4P7KA 3TKYA 3HVHA 1KXZA 3KR0A 5BW4A 5DM2A 2Z6AA 5DLYA 5CM2Z 3G2QA 1NKVA 3P9IA 4LECA 4LWOA 4M38A 4RWZA 4B17A 2AN5A 1JQ3A 3A27A 5DRTA 5DM0A 1G38A 2JH8A 1WXXA 3MCTA 1R00A 3KR9A 5DXJA 2PXXA 3BWMA 5FWDA 2XVAA 5E8RA 1JG3A 1N7JA 3M6VA 3UJ8A 3DTNA 4PCAA 2FCAA 1FBNA 1VLMA 2CKDA 3TFWA 2PT6A 3JWGA 3PFGA 3K6RA 5BW5A 2IP2A 2R6ZA 2G72A 3HA3A 4ER3A 4RV9A 3TM5A 1H1DA 5K0CA 1G8SA 3UJ7A 2EJTA 3ERCA 4E32A 3GWZA 3UJAA 3SR4A 3KPUA 3FTCA 1UFKA 4PYIA 1TPYA 3PFHA 1Y8CA 1WY7A 3PX2A 2ZULA 2E5WA 4XUEA 3GRUA 4PIPA 5CD1A 2IIPA 4CWAA 4DA4A 3R24A 3LCUA 5EEHA 4V0RA 4KW7A 3DR5A 1KPHA 5EKUA 3CJRA 4F85A 3BKWA 3GRRA 1JQDA 1UWVA
chains in the Genus database with same CATH superfamily
3I04A 3K0HA 4MYHA 1I4LD 3O8QB 2BRUA 3JWIA 3UQZA 2BD0A 4CRWB 1YT5A 3AKYA 4QO7A 1MAWA 4V2IA 1XAJA 2LNDA 5FOQA 2ZSIA 3KUCA 4EDHA 4OJMX 2OFOA 1XQ1A 4MUYA 1GTJ1 3K0BA 3R1IA 4YASA 2YIMA 4Q82A 3VDXA 4D9IA 2YWEA 2R6DA 2DB3A 1IEWA 1TM3E 3O4HA 4N48A 2CJWB 1MEEA 3RSLA 3WE7A 1CRZA 3F5DA 3NW9A 4H3KB 2A1TR 3MLAA 4BECA 2NAPA 2NAFA 3QBDA 1K4KA 1A9YA 5TPWB 4YJ2F 1QLHA 4KLRA 5I7SA 1R16A 4A2PA 4FFBB 3ZLBA 4H6WA 2OK8A 5HIMA 2NOAA 1V5WA 4JLKA 4G5HA 4QTUB 1T0PA 4U2CA 4QJ3A 2PU7A 4RS3A 1EXMA 1Z26A 1LDGA 1BRMA 2AS0A 1VRVA 3JALB 3K8ZA 4NJEB 4R8RA 5ALTA 1AUPA 4BY9E 3HA2A 1G55A 3IT3A 2W58A 3AY0A 3KAPA 4DV1B 5E4FA 3X44A 1KFCB 5FTWA 4B84A 1TO6A 4HQRA 4X0EA 3ZY4A 3VFDA 1QRUA 4C3VA 2D1FA 3O38A 2OFXA 3ET5A 5C1IA 2EAUA 3GGSA 1NOKA 1QGYA 4I50B 2QTBA 1M6NA 4JC0A 5IMBA 1DJMA 3EDYA 2BONA 2FUDA 3F6SA 2ODNA 4C29A 3G85A 2QT0A 2GD0A 2ZB4A 3BZBA 5F77A 3NMUF 1KRXA 3VPDA 2FUCA 4C01A 3A2NA 3M81A 3OETA 2JAXA 5K2OA 5JQGF 2ATIA 3RYTC 2Y93A 2J3QA 1COZA 3BFXA 4NRDA 5G4LA 1U9WA 2GJKA 1P73A 4IM7A 2Y1OA 4JX8A 1PZMA 2AWOA 2ZUVA 3BCUA 4WJKB 3T6KA 4KWEA 1IK4A 2QX9A 3BQNB 4UEOA 2DFDA 4DQXA 2QZ9A 2CZQA 4TMZA 4QHYA 3GFOA 2R5FA 4MJLA 5ECYA 5A1JA 1S1MA 4F8JA 13PKA 3Q7SA 3GFQA 1K98A 3NS7A 2EW1A 1N5LA 3OLQA 3UHPA 4D96A 1G63A 2R6R1 1WB9A 1DJLA 3PS9A 4F93B 4K6KA 4I66A 3AL3A 4E5MA 2CDRA 4MPTA 4JBHA 3C48A 4AAYA 4RJLA 1W4CA 2ZQZA 3ZH2A 1KQGA 2XBLA 1CULC 2IPNA 1OYYA 4PG7A 3BRQA 3DP7A 1W29A 5F21A 4A5UA 2O1EA 1XTVA 3TJMA 2R65A 1D8TA 4XEUA 2P27A 1OW3B 3I9KA 4IKEA 5F73A 4JI1B 2GVDC 2W2PA 2AG8A 4AKTA 1EWVA 5AVXA 3VNQA 1JMYA 3U4QB 2C84A 4LJLA 2Q7DA 1E9CA 4RFSA 4KQHA 4GYWA 1UFQA 3FBWA 4GPD1 5K16A 5BYBA 4LC9A 2GHIA 4JXXA 3D54D 5J1SB 1KK1A 4ARZA 3IAS6 1FJHA 3CNHA 3VPXA 3NBUA 2MSDB 3GT4A 3KCNA 1REQB 4AZ3B 4GR9A 4Q4CA 3RC9A 1G3RA 1WM1A 4EB0A 1NR7A 4MGHA 3N3KA 2PO7A 5FB3A 1XZLA 5HIIA 5DMHA 1CUDA 2XX3A 5LOVF 1TJ3A 3AVYA 1F8XA 3T3NA 1J5XA 1XVIA 2IYPA 2QDXA 3CIOA 3KYJB 1DKUA 3GP8A 3FYSA 1U99A 3EVGA 2ZWIA 4BOUA 5JSZB 3C39A 4RVUA 1PYDA 4O5OA 5MDHA 3ILHA 1JKIA 4MUJA 3D7LA 3Q40A 1YVBA 2O8BA 3EFHA 1SOAA 2L17A 3A9SA 3I3OA 4GIBA 4ZOAA 3RVMA 5H5JA 4O3MA 2W6JA 4XDHA 2IEGA 3FNFA 3CLVA 4I8IA 1UBTS 5CDFE 1OA0A 3IBYA 4G56A 1MOZA 2BGMA 4ERNA 3DLAA 2VJMA 2FLKA 1CT9A 3VYWA 3O03A 2JFBA 4JLPA 2E49A 5P8WA 3FUUA 5B36A 3KYCA 4RPGA 4YUXA 4D4IA 4D8YA 3ZV6A 3PUIA 4XIJA 2VTVA 4EVSA 5JHHB 4RTLA 1Q16A 4XGRA 3NHJA 5JYBA 2H0AA 3CZRA 3EVZA 4FMCF 4K6GA 5KOJB 2HXGA 2N3ZA 2YQ4A 2DQSA 3R7NA 4FW8A 4OBEA 2ZUFA 2GJSA 4RIIA 4E7PA 1SUFA 5IT4A 3T3GA 1TA9A 1UBUS 3M5WA 3TZCA 3QF7A 5ISMA 4OHKA 4DIMA 1PBNA 1MNQA 2XYQA 3BIFA 2RHTA 1G5FA 2WNSA 3C3BA 3F7MA 4R69A 3WKEA 3OE5A 4KDRA 1IUKA 3JD3A 3HFSA 3IODA 3FXAA 2IZ1A 4GI2A 5F78A 4GWKA 2BFOA 2BIFA 1H2RS 5AJYA 3LXRA 4MAAA 1E5TA 4TYPA 4TWRA 2G17A 3ETEA 1ENPA 2F8LA 2HA5A 4ZFNA 5FADA 3RHZA 2ZCVA 2OMKA 1WZIA 2BZSA 2AGAA 4NP6A 1B0ZA 3L4BA 4XRRA 5CYGA 1DBSA 4H1TA 5KMGA 4JUFA 3NNNA 4DR2B 2GKSA 1X7GA 2PRKA 3CHYA 3EASA 1GZ6A 4K9KA 3S2EA 5K8TA 2GVZC 1LFAA 4CLOB 1JR3E 1ML3A 4BQOA 5J2UF 4F5DA 1KAHA 3U3KA 5CGQB 3IHTA 3WAGA 2HRRA 4RABA 3P5VA 4GI1A 4DR1B 2HRDA 3OCWA 4IO0A 3M2PA 1A8IA 3N7UA 1MW8X 2B36A 2MINA 2Q3CA 2IBSA 1E9EA 4F2WA 3MTGA 2WFZA 3TLZA 1RYNA 5F3RA 2C97A 3K31A 1X7YA 4KN6A 2ID7A 1YS1X 2LV8A 1HKUA 5DGCA 4U2FA 3SFVA 3OHSX 5EE0A 2VYQA 2CZCA 3RHTA 3D4BA 3TZ6A 4D9HA 4JB8A 1V3QE 1NLJA 3JATB 1ZINA 4JU9A 5D5QA 5IH3A 2C5BA 3EPPA 1C1XA 1USKA 2F1KA 4CW7A 2J08A 4WEOA 2A6PA 4U3JA 3IT0A 1N2CA 1L5GB 5TJ9A 1YI8A 3E8XA 4I4CA 3N53A 4KK4A 1SXPA 1BTOA 1UR5A 3COPA 3LWNA 2YWCA 2UVDA 3PFNA 4MV1A 3WHIA 3AF5A 4MUGA 4MB2A 3RU3A 1H2FA 1A04A 3AG5A 2Z1DA 4OHUA 4OJNA 1WPQA 4DZRA 2NQIA 3LFTA 4TKZA 2BTQB 1YVEI 3NDIA 5KNCD 3H17A 2G88A 2HF8A 4DHWA 4U6NA 4DEVA 1Y1RA 4KSCA 3FKJA 4M36A 2ZJ6A 1WCWA 3QKTA 5BQ3A 3FH0A 1SVMA 3HDJA 4TMTA 3DE6X 1GGFA 1MO4A 2D1SA 4RZUA 2BEWB 3R6TA 4PZ9A 4W9MC 2NT4A 3A0RB 3EIHA 3FOCA 2X0RA 1JLKA 2HYDA 3HN2A 4XOIA 2IU3A 2R7NA 2YRWA 3CUKA 4G5XA 3DZDA 1AZTA 4AS2A 4E2ZA 4PLWA 1T36B 5EC8A 2PS0A 1DC5A 2ST1A 1PG2A 2AHOA 1YSCA 3KJHA 4J03A 4PAQA 4ER0A 5H9VA 2ZANA 2C5HA 1Q3KA 4DB2A 2ATCA 1W9HA 1XV5A 1AGPA 2NV6A 3DUWA 4CL2A 2XZPA 4BJ6A 4XRGA 2GM9A 1M72A 3IAM1 4ONEA 4UFNA 5FOVA 4DANA 1ZOLA 1U2GA 2Y0PA 3UKDA 2I2FA 3KFLA 1T25A 5L51A 1R0XA 4GQBA 2BSQA 5CXSA 1JAYA 1NV9A 2IHBA 3SC3A 1WXEA 3TIFA 2QYTA 1MX5A 2WNIA 1PJSA 2F3SA 4ZODA 1PIPA 3Q3EA 3BSYA 2AN9A 5HHTA 2V0NA 4FNGA 4OI0A 3ZWBA 2OD2A 1EZZA 2IPAB 4L5CA 3U4CA 3HD3A 2QRKA 3TMYA 3FLAA 3ITKA 4ZVVA 4B76A 3N2EA 2ONCA 3QX9A 5J4KA 3L7KA 5LJLA 3D6NB 1EAYA 3LTEA 4C0BA 1U0HC 5EG5A 1YS2X 1V3VA 1WP9A 5IJ0A 1EU1A 2C9MA 5CB0A 1VI2A 2DFTA 1Q1QA 1R6UA 3QLUA 1Y1LA 4FFPA 5AUOB 1HQCA 1LF5A 4G0OA 4MI7A 5FAKA 5HKOA 2ZXFA 4CFZA 4YGYA 3QWBA 4QOSA 4I2VA 3EA0A 3F71A 3WLTA 1B14A 3V4PB 5E1BA 3T0GA 2G5PA 2BHTA 2W2OA 3I9MA 3QOYA 5J2TF 1KYXA 2K2WA 3HVIA 3RYFA 2Y1FA 2DZDA 5KDDA 2H9IA 3JQDA 3BEDA 3BERA 3GJ7A 4Z2AA 4LUCA 1NIJA 4F3KA 1N7IA 4B8YA 3M0EA 4EG4A 4JBYA 4DLUA 5CX1B 1YJBA 1G18A 1BX1A 1ZP6A 2ODPA 3LHFA 3NIWA 4M0EA 5EZSA 1HGXA 4LOJA 5FBRB 4CCYA 4D8TA 1HFKA 1IIBA 2ZT6A 2YXNA 3Q3CA 3HXLA 1N9GB 1SQGA 4FNAA 1EUCB 1E7QA 1KYTA 3V9AA 3FKQA 3C74A 3LKBA 5H68A 1QUEA 2B5VA 4RKEA 2EF1A 4OH7A 4BWGA 5IKPA 4HZGA 1TUBB 4U2KA 3NBZC 5EQFA 5CCXA 5EJEA 1Y7TA 5EERA 3H2JA 1XZGA 1CQWA 3F4KA 4C4PA 2RG7A 3OEHD 2MWMA 4KQEA 4NBNA 4KYUA 1L8QA 4BNDA 1FDRA 1FFHA 5CG1A 5K3OA 5ENZA 1E66A 4CF5A 5HTOA 1V11B 4L2IA 1ODJA 1TB4A 2FLWA 2Z9BA 5IWCA 5DH9A 2JLZA 1ZAKA 3UM9A 2PTHA 5J59A 4ZCIA 2ZBGA 3MS2A 4LIPD 3CW2A 4DADA 5LP6F 1QOPB 2CBZA 3HM2A 2AOTA 4ZMSA 2A4KA 1CX9B 1RBZA 4FR0A 1J0AA 3CX6A 4QU9A 5CDUA 4NC9A 4EVIA 2ZTMA 1TFRA 3G88A 3OFJA 5A0VA 2BGIA 2YWBA 2ONZA 4N3BA 1I4TD 1Q2XA 5DIZA 1H4QA 3F8TA 5DNUA 3OIVA 5GZ6A 1AKNA 1E3WB 1W96A 2HBYA 3GO4A 1X0VA 2DJGB 1TZCA 4H7JA 2CNOA 3I5MA 1ZNWA 3KZVA 4JP1A 2E4AA 3JTEA 1RPAA 5BSMA 1QCZA 3PDIA 3QE3A 2BCGY 1Q0TA 2XU4A 1NJ2A 3IMFA 5ITZA 3GFGA 1JYEA 1XQWA 2P7IA 2ZK7A 1GL7A 2PKYX 3C3AA 1YU9A 4G5RA 4JQCA 2B1QA 1INLA 3B3GA 5E6RB 1C7RA 1L5WA 1XDBA 2LVBA 4X65B 5ALKA 4JJAA 1KQ3A 5KSPA 5HJ5A 3CJQA 1X7ZA 1J33A 2OFWA 1G59A 3D0RA 3USZA 4GL2A 1OGYA 2QR2A 3D6AA 4TVOA 1G7SA 1LTHR 1RWNA 5CVEA 4OBXA 3W1VA 3U09A 3MWYW 3H6SA 3IH5A 3WA6A 2AUMA 3NQ41 3QPCA 4MW2A 2H1WA 4UTZA 2C42A 1T8PA 2Y66A 5G41A 2EBHX 2JJMA 1EYZA 1B3RA 2F8SA 4HVLA 2R9VA 5H1YA 4PXSA 1QP7A 2XU3A 1MJFA 4EMBA 4CM3A 2VA9A 1KI2A 3L9XA 1RWOA 1FNDA 4EMUA 5FWXA 1FB5A 5EUBA 1R0ZA 2PD3A 3KDPA 2QN7A 3TMPA 1G7RA 1Y1PA 1AHHA 1B1CA 4A8TA 3TVDA 2FHSA 1XDSA 1CETA 2BGLA 3EAQA 2RHJA 3OMLA 4YUVA 3I6QA 2CLMB 1XLUA 2DUMA 2XMQA 2NU9B 5F5LA 3FE2A 4ESHA 1QZ3A 2X1LA 1R9NA 4D4JA 4X20A 1KH1A 2Q4RA 1DKIA 2FPUA 5K0JA 4PAOA 5CVMA 2KW5A 4IJMA 2HTEA 4B7CA 1XCBA 2OXFA 2JIZD 3VPFA 1B8OA 1C7ZA 3VHLB 1E4OA 1I2ZA 2DY0A 2MHCA 2JI6A 4C20A 3GXOA 1UP7A 3C8HA 1BZYA 1SCJA 2ZIGA 2RBEA 1YMVA 3DM9B 4F3CA 1NRWA 2M6RA 4B3MB 1KU0A 3S7TA 3GOHA 3SSAA 1GFIA 4M1QA 4ZUXU 2EQAA 2RGXA 4I7EA 1OFIA 1BW9B 3JQFC 1P44A 3LI2A 2PFSA 3CT4A 5AVOA 5JMOA 4QYMA 1G5PA 3KJZA 4HB2A 1I51A 4IQ8A 5U4XA 3TKYA 3ROFA 1PQWA 2LWIA 1PP4A 2WJPA 3R9IA 4RGQA 1S3IA 2OP0A 4WXMA 5KX5F 3RYCA 2XNJA 1TMKA 3PLRA 4LY9A 3UF0A 2YYSA 3V32A 5B6JA 3CPHA 4FR5A 2GRJA 3VQTA 4WVFA 5JFTA 2AMJA 2HWWA 2Q6VA 3BWDD 4YHHB 4I1RA 4P9NA 4LOAA 2E85A 3PFGA 1ZSVA 2JAPA 4OSOA 1WCIB 5AIAA 2GMWA 4CI9A 2FWAA 2ZRAA 3T5GA 4Q18A 4UAGA 1QG2A 4KIUA 5AW6A 1C3XA 2RHBA 2TS1A 2V1XA 4L9RA 3GBVA 4BVHA 2XCLA 4BJ3A 3S4YA 5I4IA 1D0IA 5B6IA 1R3DA 4MLCA 1I1HA 4EHIA 2I91A 2O8NA 2ZIVB 4JGGA 1GITA 3AW9A 1EGHA 4OM7A 1C9EA 4R9NA 3R24A 4ROTA 1ZNZA 3QEKA 2FPPA 3VV3A 4ALIA 1I3OA 1SIOA 2GYVA 3ASZA 2IIVA 4V24A 4WRRA 4MR8B 4X8HA 3OKPA 3LBAA 3VISA 4CDGA 4I07A 3BIWA 1JQ5A 1U0FA 5CPFA 5SZIA 3NX4A 2YV3A 1CIJA 1PVDA 2CFRA 1B74A 4UUMA 4UZFA 2IV7A 3RROA 5KTKA 1PQPA 3KSZO 1E1MA 2LR0A 4GZMA 3I6ZA 3QNMA 3E48A 3ELUA 2FSIA 2OZLA 4P22A 5E0OA 1JQPA 2IX3A 4BQFA 5JXJA 4L73A 5ERGB 2UYOA 1NASA 5E3JA 1QP4A 3TIIA 1RP1A 1X0XA 4IPTA 4KAAA 1ATKA 1U9VA 3WXMA 4M1EA 1OUMA 5E9WA 4BN5A 5EGWA 3J81k 1YVDA 1UKFA 4QNMA 5K9ZA 4YAJA 4YP1A 4A0QA 1L5VA 2BMVA 1U8AA 4ZVMA 1XMIA 5JDCC 4CLRB 3TTVA 3CX3A 3EMBA 2NO7A 3GVXA 3CWZA 4N6GA 4X84A 3NEPX 1SC6A 1RKVA 2P68A 3S99A 4C76A 2IGBA 1FFDA 2PK3A 1MIOA 2AZ4A 3IB6A 4I1OA 3TLKA 3WNZA 1V8ZA 3VR4H 3C6ZA 1R0YA 2P3OA 1DQNA 3JPWA 1ORTA 4RQBA 1Z0JA 4KK3A 1GAWA 2QI9F 3GRYA 4CCSA 2A94A 3BDAA 5LC1A 1XKGA 3BK7A 4HDMB 1YHNA 2BEUA 3JAKA 1AS0A 1X14A 2ZIXB 4TTPA 4V03A 5DTRA 5EXEA 3L4BC 3MT7A 2JCYA 2CV2A 3DPSA 2VUUA 2FETA 1ECPA 3KOMA 3NDPA 3PC3A 5A4IS 4WUVA 5JCZA 2IBTA 1IM5A 2PBHA 2GBFA 3ZPXA 5HNKA 1T2NA 1JECA 4Q9HA 1SFRA 4BPRA 3H8CA 2VXBA 3A1SA 4HQLA 2VTEA 3FJYA 1A9RA 3STHA 1MHWA 3BD7A 3IP5A 3QU5A 4D74A 2ZWOA 1DDGA 4L72A 3KPYA 1SZDA 1C9DB 4TV8A 1V48A 2G09A 1N78A 2ZJ3A 1RWMA 3W06A 2EJUA 3ZVLA 4A82A 3DMDA 2DHEA 4PXYA 1YA8A 2F48A 1GXSA 5LP1A 1GPH1 5FI3A 5J5VA 2QGFA 2JIBA 3T9BA 5ALWA 1DMSA 4G36A 1XCLA 4EMTA 1I9GA 5CW1A 2QT1A 3O3CA 3FCSB 4UHBA 3UWDA 4LBVA 3GHYA 4PO8A 1K5DA 2QRUA 2FWJA 4LI3X 4ZQGA 5A4FS 5DM70 1ZL2A 5KVQA 4ZD6A 4E6PA 4G85A 6ADHA 1RPZA 1Y1KE 1V35A 2XRFA 3UXHA 5KNLA 1D2GA 1OHHA 3NBYC 5J23A 3I1FA 1Z2AA 4YAKA 2VCEA 5ILGA 1VG1A 1Y48E 4HPJB 1Q84A 3O2JA 2ZWAA 5T4HA 1FS5A 1XCGB 5BMVA 1KJQA 5HIJA 1ICEA 5DLQC 4CT5A 4NE7A 4P83A 2FAXA 1AKEA 2AG6A 1OROA 3KVRA 3OM1A 4HJRA 5HUQA 2HH5A 4OQPA 4KLZA 4QX6A 4TLLB 2FFJA 2NTNA 2WM3A 3IA2A 3PWKA 3MT0A 3GCDA 3V1YA 1HT1E 1WCYA 4F2GA 4AN1A 4YRAA 1P5HA 4MLDA 1DUIA 1EVZA 4D3ZA 2ZJ7A 2Y05A 3BIXA 2EJBA 4HYYA 4LHXA 1JLMA 2WMYA 1IOVA 2UDPA 4O0LA 3WWZA 2HJGA 3AFIA 4AM8A 4BLVA 1CEYA 1KK0A 2V8BA 2H17A 4D4LA 4LOLA 3P20A 3DT8A 2UV8A 2V7PA 3KXIA 3QHAA 4BYGA 2NM0A 4JLJA 1P7VA 3EGEA 3RD5A 1Z17A 1ND6A 1OU0A 3HHEA 3VUEA 1LBTA 3W7BA 4FQ5A 1RLIA 4N5MA 3Q98A 4XGKA 3D8NA 1ESEA 1GPMA 3VH2A 4UNRA 5EMHA 4OVZB 5EMKA 4L3WA 3ANMA 5E8JA 1JTFA 2HDNB 1Q7CA 1VGRA 2J6HA 1FUUA 1MT0A 1TZJA 2Q4TA 2D0OB 2V7TA 4OI1A 1JFTA 2VWGA 3V5NA 1BXZA 3IPAA 3TLCA 4B46A 2V7EA 5EN4A 4DF3A 4DLAA 1AK9A 1DUSA 2XZDA 4M46A 4LVNA 4BL5A 3EG5A 3UTDA 1TMOA 4N7JA 5JY1A 1A5ZA 3LUHA 3NDRA 4N54A 4JUBA 5CLJA 2YJBA 4R05A 2E1PA 1JMKC 3L02A 1EGAA 3QBTA 4CVNA 4B6JA 3EB9A 2PJZA 1EG7A 1QIHA 1ZM7A 2R1VB 3WV5A 3HBAA 3MRXA 5H4GA 1ZGAA 5E7QA 2F9FA 4RA6A 4C2AA 4Q7QA 1FP4A 2E7ZA 1WOYA 1X1TA 2B20A 3G8CA 5EWJA 1DXHA 4Y2SA 3D4NA 3FDIA 3TRIA 4N8EA 2XD4A 4R2LA 5JZBA 4QGHA 3DDHA 1K6EA 1Y4AE 1KWGA 2RI6A 1FTQA 3GCZA 1LPBB 1NLFA 4RJTA 3LSYA 4NYJR 3VSAA 1BOOA 1Z5GA 4C0LA 1FFSA 2HGSA 1Z33A 2Q5IA 5TJHA 4B44A 1YFJA 1JVSA 1M6EX 5F35A 4QECA 4D3FA 5BSHA 4D02A 4PCUA 3PSHA 2WOJA 3NFRA 5JE8A 1ZU5A 4DB4A 4LWPA 4Q1VA 1EHIA 2NP6A 3HCWA 5IAJA 4L4YA 2XIQA 4JUIA 2C7OA 3U7JA 2FZ5A 4LHSA 1R4AA 1YJ5A 4LQDA 2YYYA 2HO4A 3A2LA 4TZKA 5B7QA 4BQEA 3LZDA 3VJRA 4ZKDA 3IUQA 4P86A 1NBWB 1DJNA 1OVGA 2GAAA 3CBKA 4ND1A 1U02A 5CA1A 1LPPA 1S8FA 1ONOA 3CWCA 3E1SA 2I34A 4ANFA 3NT2A 4UU8A 3TTXA 1BE1A 2D5AA 2IZ6A 4UAVA 4Y2JA 1CJUC 1C3EA 2O5EA 4G4IA 1TYZA 1YK1A 4U6QA 4AZ0A 3CMCO 4BX8A 2WP0A 2FYEA 2VS1A 2EGHA 3DE3X 3H75A 2G9UA 1QGZA 3IUJA 4EEKA 3TDKA 3H3FA 4L02A 4AF8A 2NU7B 2W8ZA 1VJVA 3O8BA 1FVFA 3B9PA 2GPWA 3AI3A 4KX5A 3UUFA 1QS0A 3VV2A 3HLKA 5COAA 1X1CA 4UFOA 1FP4B 3SDZA 3A4VA 4P36A 1IPHA 3ZD6A 1VPWA 3NBXX 2VDUE 4Q02A 1LTKA 9MHTA 1O1YA 5IKOA 2SKCA 3NDJA 4M54A 4YJ3B 5DBHX 3FPFA 1SNKA 1QLJA 1IN7A 1YQTA 2VAVA 2CF5A 3K5PA 3ZWYA 4ISCA 3WL7A 3N7AA 4QT0A 5LD2B 1MTOA 4Q9NA 4MYSA 1QZXA 2H2GA 4RK6A 1H6DA 2YY7A 5CVCA 2PUVA 4BB9A 4CV2A 2DY1A 1HXHA 1WIWA 2CY0A 3FPSA 3KQQA 3P32A 2P79A 4GXTA 4JMLA 4YCSA 3H9UA 3KAJA 1EFVA 2ZSFA 2ZM5A 3SKYA 3PRMA 4O0MA 4B45A 4D56A 1FQKA 1HYEA 2RGYA 3G1WA 3E1KA 5E6UA 4HDRA 2XKAA 3C24A 1NVFA 3HJGA 4U0KA 1QK4A 1U6IA 2AXNA 1ME3A 3D7KA 3TRDA 1OAKA 3U81A 5HKKA 3KETA 1WKCA 1V47A 4OMCA 3CSUA 4NBUA 3KLOA 2DCAA 3V4SA 2NSJA 5A2GA 4PBSA 1R0CA 2GILA 1E61A 2QK4A 4GQIA 2P8JA 3ILYA 4G5FA 3THRA 5KYXB 4W5NA 1Q0RA 2BFPA 2Y1KA 7ABPA 2WE8A 4CMAA 5MN6A 1GAXA 4DC9A 1BFKA 2NUTA 4TKVB 1S3GA 1Z2DA 1G20B 2IZ0A 2OVFA 4X1KB 1M8FA 5HQJA 4NCJA 2P3SA 3ZV3A 4E33A 5FBVB 2J4FA 3AB7A 4K9LA 3NUQA 3SJAA 4FBGA 2Z9CA 1G291 1AGRA 2O6LA 2QTTA 2ZS8A 3CEHA 3T7DA 1QTQA 4IZ6A 4R0VA 1Y1QA 3W9BA 4H7HA 4AO6A 3K4PA 4ER6A 2VJNA 3QITA 4BWFB 1ZIOA 3O73A 4DJDC 2PZEA 1G19A 2EZ4A 2UZ4A 3D43A 5B4VA 3UB4A 1JS1X 1I80A 4WCFC 3KQMA 3AY6A 4H3HB 4ZP1A 5F33A 1UBSB 2HK8A 4HNVA 3TTWA 3FYUC 2JRIA 4DV5B 2IZZA 3ZYCA 2FGJA 5CX4A 4QPZA 3B7GA 1YL5A 5LNK6 3DDSA 2B1NA 1U8TA 3MS4A 3QIVA 3QKRA 1U4SA 2QZSA 1YR2A 1L7PA 3KJXA 4FONA 3TAXA 2DCBA 4P92A 5DB4A 2ACEA 2A2ZA 2HY7A 1FYDA 2FP4A 4I4TB 4M1TA 1BDMA 1DAIA 1TM5E 3P8ZA 4F71A 2QTVA 4TWBA 5DHQA 4AXBA 2ALJA 3E9EA 4RVSA 3OX3A 4DKXA 2B35A 3ZZUA 3P5BA 3QEMA 1IJEA 3DE4X 5B3JA 3TD6A 4FZVA 1EFAA 5BN4B 1LX6A 4FJ1A 4JKIA 1FU8A 5ALOA 5JNLA 5BOSB 3I76A 3H4MA 1QVAA 1MB2A 4J16A 3YASA 4J07A 4IQ0A 3RNVA 4TZ0A 3I6YA 1UT5A 3CA8A 4IIJA 5FTKA 1T5OA 2QVZX 3IILA 4DY6A 1BDBA 5HM8A 1AKUA 1N6PA 2OV8A 2Z98A 2AIRA 2HDHA 3AI1A 5KNBD 3OBBA 1ISMA 4KYIB 1OXUA 1GQQA 2GCIA 2MSWA 1QYDA 2PT5A 3KD3A 1Z8NA 1K6MA 3OESA 4WZ6A 4BKPA 3T8YA 1LSSA 3ZDBA 3ER8A 3O7MA 3QEJA 1NVTA 1XALA 3MCVA 4C3OB 3VR4A 1L4HA 4ZVPA 4MVJE 3VI4B 1X8KA 5TPZA 4DG8A 2BLLA 2HSZA 4A10A 3Q7PA 3DQZA 3WGTA 2O6XA 5H83A 3S6JA 5B1IA 3ZTTA 4URYR 4AP6A 1JQEA 2Q2QA 3ORRA 4LK2A 1KVQA 4BLQA 1UDBA 2G5TA 4IJ5A 2OGSA 1OH8A 2ZVPX 3B6IA 4V3CA 2P2ZA 1FLAA 3JQ7A 3RTBA 1QO0D 1TQHA 3TXAA 5JJIA 3UW1A 1DBQA 1SBHA 1ODFA 1UXOA 1FVXA 3FR7A 1LDYA 1NP6A 1NRXA 3AM5A 2HJRA 1X9GA 2O9JA 2ZUUA 3CR8A 4UCWA 5H3CA 4G4SO 2DPMA 4NHOA 1SURA 1U2PA 2OXCA 2W2MA 2XWBF 3HB5X 2WZQA 3IDFA 2EKPA 3WY9A 3TLXA 3I2FA 2DFNA 4BSQA 4FYMA 3KSRA 1VSQA 2PBLA 3GX1A 3R7FA 1E6UA 4UQPA 1JEEA 2PA3A 3P2KA 2BUAA 2C5EA 1Y3IA 4PQEA 3UFXB 3WDLA 3G6KA 4C7BA 1EPUA 1N0HA 2Y1WA 3D59A 3DZCA 3R5SA 2Y0EA 3HB0A 1FXWA 3FMVA 4Q4JB 3ZHBA 1RLTA 1VKOA 1LBQA 4KITB 4KZKA 1XU9A 2G1JA 1KO1A 4E2WA 3IVCA 1NVEA 3N3GA 2CLOB 3GLVA 3WRYA 3AYXB 3R8FA 3MERA 4ZMBA 5L45A 3EXHC 4LS3A 2YZ2A 2XB2A 3TX2A 1O5OA 3TCKA 2QTZA 2XUQA 3ETHA 1E9DA 4MS4B 3BMOB 1NVVR 2FRXA 3BM5A 3BFVA 1EHYA 4ECAA 4F3YA 3OTOB 1JEQB 2BDLA 4PF1A 2WWXA 2FDRA 1HDGO 1WU7A 4I0WB 1R0SA 2XXBA 3E9DA 1S4QA 1YBMA 4NYJQ 4RJKA 4Z4CA 2VQFB 3U26A 3MHHA 4F5YA 1A1VA 1JPJA 4HWRA 4D4GA 1YDFA 4CE6A 5F7OA 2VUTA 3H2BA 4HDSA 4D79A 1LWNA 3MWKA 2WJ6A 2BDZA 3QHQA 3L0OA 1UEIA 2AQ8A 3OC0A 1HSOA 1KY3A 1OWMA 2EZ9A 3IHPA 2C3YA 5CFNA 1RMYA 4II7A 4DMMA 4H0NA 4G1CA 2L42A 3NR2A 4MV8A 1YU6A 5D86A 3K8UA 2PX0A 4CDNA 4NBSA 4PSVA 5B58T 4DVJA 4LSWA 2HA0A 2X41A 3TNXA 2ZQYA 4DC0A 5FFFA 3WHPA 1Y6GA 2WKPA 1U31A 5EE3A 4BPBA 5DM0A 3QVGB 1WXQA 1GUAA 1L7RA 2V6GA 2VYVD 3K0KA 4S2EA 3WISA 2O7QA 3IP9A 3QTLA 4Z9XA 5IZCC 3VTZA 2CKDA 4RZIA 1XN1A 4ZN6A 4OB7A 1ECBA 2VSYA 3U6BA 1PTJC 2A0WA 2GETA 3FPKA 1EUZA 1G8SA 1O58A 2BCEA 2WAAA 2WSBA 3RBZA 4H7EA 4G0QA 3KPUA 5KKAA 4BBZA 3EG9B 4Y0VA 4C1BA 2B7BA 4GZ6A 2C54A 3G8YA 5IRCD 2ZULA 3ZW7A 2EFYA 1BU5A 2TRSB 4KRYA 3S1AA 2IIPA 3EZFA 4RY0A 5CLFA 1O2DA 2ZE7A 4IVPA 2GYUA 3CZ4A 4V0RA 5GONB 2NO1A 1SC9A 5ALMA 3V55A 1MP0A 1V1RA 5CPBA 1O0CA 1CUUA 3MD9A 3GRRA 3EBLA 3RRYA 2ZCUA 1ZR2A 4HLCA 2XJ4A 3C3KA 1HH4A 1PGJA 1CP2A 4R1PA 1M2EA 1QF9A 4JI6B 4AMGA 5BR8B 1YNSA 1OF1A 1NVAA 1USVA 1V6AA 4D8XA 4X5OA 2C4TA 1VI6A 1DTSA 3A28A 1NBEA 4GP7A 1DQYA 3N2ZB 3G2HA 1BXKA 2DQ4A 4N79A 4GLLA 4IUDS 4LXXA 1LI4A 1KR5A 1W4ZA 1WXFA 3QE2A 1PZHA 5D5PA 4GYJA 3BSFA 1IE3A 2Z30A 4PVDA 4ZT2A 2IPLA 5AKIA 3C3CA 4KI7A 4ZI3A 1EFTA 2C1EA 1PUXA 2GI4A 5CGZA 3FYHA 2P86A 1TOAA 4QRDA 1Z4IA 2JCSA 3INYA 2AF3C 2WIKA 3I8OA 3M70A 4GEGA 3WA7A 3O0UA 1E3WA 1LJ8A 4GE3A 4UMFA 1CD5A 2Q27A 3GG2A 1V1JA 1RR6A 3A58B 3Q5DA 2Q3DA 3A9UA 4CF4A 4L7VA 5BSRA 3QRWA 3BBAA 1MXFA 3HCOA 3V6MA 5DXFA 3H86A 1UC8A 4Q9LA 1RXUA 4IKOA 4EG8A 4Q0MA 1EUDA 1HYHA 2I78A 1HDOA 3C1UA 4LN1A 4F4IA 3VAYA 1C4KA 2B3DA 2Z3WA 4RVFA 4K7JA 3SM9A 4RNAA 1KNQA 3O8DA 4F5ZA 2FYTA 3DO5A 1NF2A 2XSZA 3TECE 3LCMA 1AKMA 2WTXA 4D0LB 3DUFA 1SEVA 1SK8A 5FTMA 2WUVA 3JYLA 5ADWA 3M82A 5GJCA 4MUFA 4P80A 1ZIVA 4Q3NA 2XQKA 1RZVA 1M76A 3WWPA 3MOSA 4WBNB 4OHYA 1XQ6A 2ETVA 1ZKMA 1TUBA 3JD2A 4HK4A 4ZT4A 3RASA 4YT4A 2W6PA 2FSGA 2X76A 621PA 1EP3B 3IAFA 1EZ4A 4KMOA 4RGYA 4NH4A 4XQ0A 3CVWA 4FE7A 1VM6A 2Q3EA 2ZS9A 4GPIB 2BY4A 5KJCA 1IQ0A 4US1R 1XCMA 2HIGA 3E18A 1VLVA 1U8FO 4WA7A 1HQYE 3G5TA 1NPTO 1VYVA 4BKMA 1FDVA 3HLTA 1XZKA 2CD7A 1J2YA 1OAOC 2ZWVA 2E02A 2QSJA 3O8CA 4EI9A 2R44A 4PN3A 4LWZA 4MW5A 1WUIS 2F64A 4H7FA 5FV7A 3R3WA 5L7YA 1E4EB 4MEBA 1JA9A 2GEFA 3BJMA 4AYXA 5JAOA 4ARCA 1BMDA 1DO0A 1MPTA 3UCEA 1HT0A 2G25A 4HG2A 3CBGA 2B4RO 3ECSA 1JUDA 3UA3A 1XCPA 1YZLA 3CKLA 3E9NA 3FSJX 4IKPA 4PHGA 3A7EA 1AF7A 2WM8A 4F5EA 2OXEA 3EULA 3JYOA 2RGRA 4FSHA 3PNVA 1RYMA 2V7QD 4O29A 3AP2A 1I7PA 4P32A 4RWEA 5DN9A 4KX3A 3DD1A 5EMNA 3UC5A 2V4ZA 4LRWA 4YLGA 3B8HA 3SK0A 4CEJA 4UCXA 4N9QA 3OE1A 4ZI7A 3QVXA 1TZ2A 1TAQA 1UBRS 2QX6A 1HX7A 3LOPA 2JLSA 4BNLA 1UBKS 1GA4A 5IKEA 2ILVA 1XKQA 2WA1A 5MFPA 4FHCA 5LU8A 3ND8A 1BFDA 4WCFA 1SRRA 3B21A 2XNHA 1BMQA 4RYDA 1Z8HA 3E0XA 2ORIA 5FDFA 3DPIA 3M6AA 1Y6JA 3C3WA 1QS0B 5ARDA 3WR5A 3EJ6A 1E3TA 2G6TA 3H0EA 2VYND 3QTTA 3WMEA 5JFGA 1E7RA 1S4VA 4N4ZA 3V42A 2OTCA 4BJ5A 1XZIA 4CKEA 5K6TA 1EWTA 1TEXA 2Z2JA 5JSYA 721PA 2FR8C 1ZGBA 3R5XA 2W48A 4LMRA 3DZJA 2ZT7A 5AW4A 3ZHXA 3CVOA 4RANA 1XHLA 3ABIA 1KZHA 4OELA 4BB6A 1DJOA 1ZN9A 4LBYA 1SC1A 4FE4A 5CRIA 1AT1A 1PWYE 3C7DB 4UJ5A 3E03A 3LO5A 4M60A 1WS6A 1XWIA 5THKA 1AD2A 2B1RA 5I5GA 4XTCS 2XD9A 1KZ7B 1UJ6A 1SVUA 4IDFA 5AM4A 1CEEA 3IOEA 5G4KB 3L5OA 1I7SB 2BWJA 4WXHA 2WY2D 1RJWA 3GFFA 4O63O 3M33A 1SBIA 4WESB 3D3WA 4YROA 3DV0B 3SMQA 5CD9A 4ZVTA 5JBNA 3OZDA 4JASB 3RRMA 4E22A 1NVUQ 3L7AA 5KOJA 1XZBA 3LG2A 1M10A 1VL5A 3D2BA 3R7WA 3ZGXA 2XY4A 1MPXA 3PHWA 4F7DA 3B8EA 1NWCA 5DEIA 3ZV7A 1U9XA 4HXGA 2P1ZA 3C5HA 3SQNA 1IHOA 4PQGA 2EF0A 3R6GA 3EVDA 3KIPA 10MHA 2I99A 3SE0A 3CRRA 1SUIA 2QRVB 2RG1A 4GEKA 4N0PA 1BWRA 3L3BA 2I22A 5K1ZA 3G6WA 3QV1A 3RH0A 3KT8A 4MCIA 4EUFA 4CEIB 3UANA 1PNRA 1AKVA 5HSGA 3FVTA 1S96A 2ZYIA 2A1UA 4OOFA 1DTWA 2ADFA 3U7FB 2D2EA 2P0YA 1C4OA 1NNSA 1O8BA 1ZBDA 2Q5FA 3QJ5A 4EF6A 4JL8A 4KTTE 2NQ8A 1JFSA 1QWSA 4CMJA 1DG3A 3HP1A 2HADA 5F76A 3GLIB 2ODQA 3B89A 5LA6A 3IV2A 2XNCA 3LVBA 3VR2D 2NYAA 2PKCA 5A05A 3QX7A 3BCHA 1XHEA 4Q12A 5DHUA 4ZVQA 5ES3A 2DPHA 2J8ZA 4YWJA 2GT1A 4KAFA 1KIAA 4RWZA 2X8JA 2IHNA 3UQYS 4HNUA 1PG5A 3TZHA 1RBMA 3FUVA 2FWMX 3TUIC 2NADA 3E3AA 3B1FA 5DX8A 2X2OA 2YL2A 3ZIAA 1JEAA 5FORA 4R1SA 1QYIA 2OBXA 2PR2A 4QXRA 4FHGA 1X8LA 3GD7A 4ZC1A 1GVHA 1KFUL 2WRZA 1ORDA 2YWXA 3UWPA 5ALYA 3MTJA 5HF9A 1U2DC 1FSGA 2NU8B 3B79A 1YR3A 1CHDA 2I03A 7PCKA 2EG9A 2PXCA 2JJ2D 3CZQA 4GKJB 2HC9A 2LZ0A 3FZGA 1VP9A 3H5NA 2YOHA 1SUSA 4P7FA 2Z58A 1F1BA 3M89A 4R2XA 5FTNA 5KHOC 2VBCA 2HJ9A 5JVDB 4DMHA 2W00A 4UXJA 5D5HA 1NMYA 3VDMA 3QVVA 4WKPA 1STOA 2H92A 3P2IA 3SS7X 3PHIA 1Q3TA 1XZJA 1IOZA 3AV3A 4GHWA 3QE9Y 4J0HA 4G0UA 1BFUA 3K20A 4DMGA 1XMQB 4XDZA 2OZEA 3BWVA 3SJUA 1V3UA 4OJQA 4AY4A 4PP2E 2OORA 1CZHA 3BHMA 5JCXA 3SF8B 3H8SA 3BMNB 3T1OA 1FBTA 3BL5A 3UOWA 2XUKA 3AFMA 4KQFA 2YXPX 1QGUB 4AP5A 2P0AA 1T8UA 2IY8A 3D0OA 4C4OA 2FEAA 3QPDA 4TUYF 4ND4A 3FNHA 1CV2A 1T1SA 4B4WA 2QPOA 3BFKA 5KJEA 4W5QA 3AM1A 1H5UA 2OLEA 3TZEA 5AVUA 2RGBA 1K5PA 2VRNA 1S7GA 2I2XB 5IUJC 4H35A 4BQQA 1V16B 2VDLB 2X9GA 4MWOA 1GPUA 1VHWA 5LQUA 2CMFA 3IEIA 1LPOA 1LW7A 1NONA 2Q5HA 3EXG2 3MWLA 5AKZA 1TYEB 2VDWA 4B2LA 4BMVA 3HCPA 3U3DA 1CUVA 5K20A 1Q7RA 5HQTA 1CSBB 4R2WA 1Z36A 3LDUA 3ELWA 1G21E 3EZGA 1Q7TA 2GTIA 3BMXA 3FRIA 3V7FA 1E64A 5JZVA 4BFCA 3OC6A 2AEFA 5AJHA 5IJXA 5CBPA 5DVZA 2Q49A 1TF2A 2YWFA 1A77A 2ZETA 1DWUA 3D3WB 3OEED 5LIRA 4J1SA 4OQLA 4JT2A 3ZDYB 2O8DB 1KHHA 4AICA 1UBNA 1UKVY 4FFMA 2O3UA 5FR1A 2AMVA 3GVIA 2Y1CA 3RIHA 3BRWD 2W2VA 2H6EA 5I4BA 1PWXA 5IBQA 3DLTA 5EYPA 5EZYB 3Q9NA 5G1OA 4AKEA 4B3XA 1H6BA 5LQMA 5FHRA 4INAA 1YZVA 3HLYA 1JBEA 1PX2A 1J0BA 3LUBA 3PQ5A 3W2TA 3TYXA 2J30A 4TVKA 1QOLA 5AVWA 1RZRD 2P7UA 3W5SA 3VPHA 1I30A 1ECGA 2OFPA 1C9MA 1O9HA 1JIQA 2JS7A 2QAGA 2A92A 2OHJA 4DILA 3KELA 5LDDC 1CNMA 3BXOA 3RB8A 4UHCA 5KNBH 1GZHB 4PGGA 3H9BA 4PWYA 1PNQA 4KE9A 3T34A 1RAHA 2BAGA 3E9RA 1NM5A 2F3UA 1YO6A 4DR6B 3AV0B 1XD2A 4KIJA 4QOJA 3MW8A 1QFZA 2FPWA 3V4ZA 5ALUA 4I55B 3PWZA 5KKNB 1I33A 1XU7A 4GGOA 4LYJA 3WMFA 1IZ8A 4B85A 1BCSB 3GEPA 5BOVA 3L4JA 3NTXA 4OYRA 2MSKA 4HEJA 2RAPA 5T7BA 1NLYA 2QW0X 3ER9A 4MDHA 4HDNA 4O2AA 3K1AA 1J2UA 3L49A 4LYYA 4P84A 5CTJA 3LQFA 1PUIA 1SVKA 4LNAA 2P6UA 2NZWA 1R4ZA 2BE9A 4BGVA 3ZIAD 1NQUA 2WDPA 2W90A 3OEYA 2HU7A 5LVAA 2R8YA 4YUZA 2FE8A 5C4GB 1NUAA 1XAHA 3VH3A 3W6UA 2HMYB 2O3JA 4EUKA 1EK5A 5JXGA 4TL7A 3K9FC 4WD3A 4HFJA 3OQ6A 2NVOA 4R3UC 3X1KA 2H1IA 3RF7A 1AIPA 1J1IA 1HURA 2FUG1 1Y1SA 5JALA 1OC2A 4LE2A 3LLCA 1Y6RA 2O48X 2V4MA 2Z5GA 5KDLA 3SNHA 1JV2B 1GA1A 5EKDA 4U2GA 3WLMA 4Q3EA 4ZZ1A 2M1ZA 3KKMA 4I50A 1GU1A 2ID8A 3B1WA 1P19A 4GGPA 4XX0A 4E5UA 5A0FA 1XEWY 3QSDA 2WD9A 4EZEA 2JLUA 1ME4A 3IPCA 1NMQA 2QLFA 2ADOA 3WYCA 2IQIA 4XLZA 5JIBA 4WINA 5TARA 4D41A 4URWR 1Q12A 2DU8A 1OASA 2ACVA 3DTVB 3FKSD 4LGVA 1E6WA 2YZKA 3I83A 5K3FA 1H22A 3QVSA 4E4YA 3IHWA 3PC8C 5BN3B 1J8QA 2YYAA 3I5XA 4GF5A 4QNRA 4J2OA 1BGXT 3HB9A 2OD7A 4WH0A 1OYWA 3UB3A 4TM7A 3EQZA 2PJRA 2AYOA 3MTVA 3B38A 5DM1A 2I8AA 1YIAA 2I67A 1MX9A 1N0WA 1T9HA 1WV1A 4WNAB 4JCCA 4UNNA 1GGHA 1CUGA 2FN7A 2PRYA 4TL6A 4FMDF 3ROMA 5DM60 1TEHA 2G7MC 2YVUA 4LVOA 2R8EA 4PZPA 3WLIA 3TEJA 3NIGB 3RRZA 4PLHA 5EP4A 1CUYA 2OV3A 1L9XA 3VSEA 4DUPA 3TRHA 4OP3A 5AWFC 3IERA 4CCWA 3PDJA 4XWTA 4OG2A 1ZFNA 4TUYA 3ZX4A 1V4NA 2D5BA 2XUPA 3A3YA 3RAPR 4PR0A 4EM6A 2CNDA 3DC2A 3HWWA 1N6IA 5L95A 5EIEA 4PT5A 3EXHB 2IU0A 4H59A 4DCUA 2YHUA 2Z3ZA 1YRBA 4TUYB 5BN5B 3TTSA 1GSIA 1TADA 1Z6TA 3AESB 3LZCA 1L3IA 3NCHA 4TLCA 4DG9A 4JOBA 2FK8A 2QV7A 3REQB 3IBFA 4WLNA 3TL6A 3WGMA 4PHTA 2Z2YA 4BX0A 2HJSA 2WPDD 5LMCA 4ZKEA 5JG7A 3BK1A 2OC4A 3HXMA 3DTVD 3PHJA 2YINC 1KO5A 4X3OA 1K75A 1NP7A 2EATA 3I58A 4G8CA 1M2VA 2QRQA 4QWMA 4RF2A 4UHKA 2O4UX 2Y4NA 1C7EA 1SCBA 2M6LA 1TMGE 3IVRA 2XMZA 2Y6EA 2WAMA 2WA2A 2UVPB 2HDOA 2XUZA 3P2MA 3CYFA 3EPKA 5AQ1A 2W37A 4FJ2A 5HM6A 1CUEA 1OXSC 1QIKA 4FJCA 1QFYA 4ZCMA 5LQSA 4DUZB 1J9ZA 1RJEA 4OGGA 4LQLA 4P0QB 3PPYA 3BA1A 3V8MA 2JLRA 4LDJA 3ZHYA 4TKVA 1Y08A 4P7KA 1AHIA 4Y6RA 4B3FX 1XJQA 3EXAA 5DN6A 5JD6A 5FXMA 1Z4JA 2MT9A 3GMIA 4B17A 2ZKIA 5EIHA 3ZVRA 1WDMA 2VTDA 4N7BA 4YRDA 3W79A 3ND6A 5HXAA 221PA 5FWDA 1L6IA 2WVHA 2XE4A 2EX0A 3BWMA 4TZTA 3SNKA 4ZZ0A 3DTNA 2R1UA 1NNUA 2WU3A 1Z35A 1H85A 4R0MA 3L93A 3WIDA 5J4LA 3PDWA 1YJAA 1Y80A 1BMFA 1U7DA 5K0CA 2ZRGA 1QFXA 2JEZA 5DHFA 1UXJA 2CNKA 1HM5A 3DEKA 3PFHA 1A27A 2X1VA 3WKCA 2JANA 4YMSA 3R9WA 2YJ8A 3ADKA 3F73A 3H2HA 5AKYA 4BNXA 1PNTA 2BEJA 2QD2A 1SIBE 2ZT8A 4NS1A 4G89A 3BEOA 3DQPA 4AJ4A 1NURA 1YI1A 2FMIA 1FL9A 1MORA 4C43A 3OEWA 1PZNA 1F9AA 1BG6A 1UZAA 2W8BB 4F85A 2WUFA 1I6WA 3U4MA 3AIMA 2H16A 5JZEA 1UBJS 1SVSA 4YJFA 1KPGA 4CIAA 4P3XA 2CVHA 5CIYA 3DCYA 1MQ8B 4I55A 1Z2NX 2PDAA 4BJ1A 1JG6A 1GL6A 1FS6A 2RK4A 1ITOA 5GV8A 3M99A 4TTTS 2X4GA 4KFCA 4MO2A 3I72A 1QMGA 2GZDA 3CBJA 4QL3A 2X8LA 1NAIA 4UASA 3UAZA 3L0DA 2X23A 3OUUA 3QFTA 2XXAB 3PG5A 5E6SB 4NK4A 2HPZA 1VGQA 2EFCB 3K32A 1VIVA 3K53A 1W5BA 4AMBA 5JNRA 1YB5A 3VOSA 4DNQA 1WZCA 1RBQA 2OQIA 1O95A 4H27A 1ISHA 3FWPA 1BWPA 3N7TA 3COYA 2RJ3A 4HADA 2OILA 2ZRPA 4XIGS 5BVGA 3U60B 1KDRA 2NQGA 3S3QA 3ZDXB 2NP7A 3D0QA 4QARA 2Q4OA 3DGFC 1CY6A 2WFLB 2PVSA 3EF0A 5JLJA 3RUPA 3SIXA 4EZBA 1DEKA 1Z15A 3RSHA 1YAHA 4CDCB 3AT1A 2GCOB 4QSMA 1F2TA 3MSCA 3EFOB 3EMDA 4FFNA 4H17A 1JR3D 2PS3A 3ZZTA 4CM9A 4PAMA 4FT4A 4PLZA 3DCIA 3ZDZB 1FFAA 4FLFA 5I45A 2TMGA 5EKXA 2O8DA 1MC8A 3NBMA 1GKYA 1FTNA 1Z9BA 1P9LA 3U56A 4R9VA 1VL0A 3HR7A 3I5AA 3WC4A 4EARA 1YB7A 1H1LB 1U8YA 1P1HA 3CH2X 2P41A 4YCLA 4NCBA 2GD2A 1C3OA 5F12A 2HXSA 3GFTA 1Z39A 3SM3A 3ESYA 5SZHB 2NVUB 4EMSA 1FTYA 4OKNA 1HO3A 3BS4A 3NPMA 3OZSA 4AF7A 1RM4A 2G5GX 4YAOA 2AB0A 4MUNA 4Z0PA 2O8VA 4Y2YA 3EXFA 5FOXA 4NCKA 1RS0A 3VU9A 5D3MB 4ZYZA 4CM6A 1MVLA 3ZWMA 1YB1A 4CM8A 4X6HA 1IULA 4ATNA 3F6YA 1LRJA 5ALDA 4J0QA 4QDJA 2H06A 2BN4A 4IMRA 2ZQ5A 1WHSA 1LPSA 3HACA 2HX1A 1L7DA 5DTIA 2EEZA 1N2EA 1T2AA 3QMWA 4I9NA 5B37A 3L7OA 2RGCA 4P7JA 3HZHA 1JZQA 3MQFA 3SLGA 1P74A 2GSDA 4ZO4A 3Q0TA 4BP3A 4NI5A 5K0NA 4Z3DA 1LS1A 2H18A 3C6YA 3TBKA 2XRYA 2I1QA 2YFKA 3WB0A 3HADA 4E13A 4ZEVA 4NONA 5KYWA 2ZYRA 2HLPA 3W5CA 3OLCX 8MHTA 3FBTA 1V7QA 3I09A 3ZD9A 4Z7NB 2HW8A 4JI7B 3LDGA 1I4EB 4DJAA 4J9UE 2JGRA 2V9CA 3B6ZA 2JGLA 4G4JA 2CD9A 5BXQC 2GN8A 3JWPA 4EJSA 4TV8F 2R6FA 2JAHA 3G9TA 5EJ8A 1F20A 3HY6A 4H08A 4R01A 4BQRA 4ZK2A 3O1JC 4DCMA 3LE8A 1E1DA 1PJ2A 2OCXA 2BMAA 4M9SA 4GC9A 5AUPB 3HGMA 1N3LA 4HJXA 5C31A 1IU9A 2YV4A 1CWUA 4PQFA 5MGNA 1WP4A 1T2CA 3KU4A 1WW2A 4ZCTA 5GZ3A 1P72A 1FUIA 2ZUCA 3OEHA 4JUDX 3UUEA 1ZUIA 3VZQA 3NUZA 3AL2A 1R18A 3KQOA 4M9CA 1N8SA 1OV4A 5E4TA 4BE9A 4Z4HA 1GNPA 2ZSDA 2RD2A 4AJIA 1HZZA 2ZI3A 3KE8A 2IS4A 4B73A 4UTRA 1EVYA 2CLEB 1DWQA 3QW2A 5DP1A 3ROGA 3T7TA 3ZXYA 1X2EA 1A4RA 2BFEB 5FOTA 1POWA 1NPYA 3FTQA 1HTTA 4AN0A 5SV2A 4C89A 4F96A 3NASA 5DGXA 4W5JA 3Q11A 4Z8YA 3G0GA 2NZUG 1YQXA 5LA6B 3TXYA 4L5BA 3ITNA 4ER7A 1SXJB 5JXIA 2PG3A 2XRZA 4JQSA 1XUOA 3T54A 4RD0A 1HYGA 4QTTB 2UXCB 2VLIA 4DMUB 4FJ0A 4EKGA 3DMPA 2Q4DA 1NF8A 3KQHA 4TQGA 3L18A 2GASA 1P7YA 5MGBA 2ZBQA 5EEGA 3ODPA 5HMMA 4U02A 3STYA 3QMVA 2VF8A 4Z1MA 2E21A 1E77A 5SYNA 3TR5A 3ESBA 2CUTA 1ZIYA 5JCOC 3V1MA 5BW8A 1OAOA 3RKUA 3LUAA 4KQGA 4P7BA 1LZKA 4YHBA 5KYYB 3ZV4A 1GM5A 3G2MA 2JGKA 5LB2A 1VG8A 5IANA 4WN9A 4FS3A 3REQA 4IH1A 2WHXA 2P9ZA 1SHTX 1WR8A 3SY8A 2IPMA 2P40A 3EYWA 1J21A 2O2IA 3PB3A 5BNZA 1IMOA 4JVLA 4B3JA 4XVUA 4WCDA 2CVFA 5KQMA 3OO1A 3D6SA 5CFQA 2FZVA 4EF4A 2HA3A 1NMSA 3AUSA 3AFNA 2PH5A 3TD9A 3IIMA 4LVCA 4C6HA 1EP1B 1JEQA 1G66A 2XVXA 3CUVA 3MAJA 1DVRA 4FWBA 5IAEA 5E1OA 3ZNOA 4C2BA 1N2HA 3VSBA 4JI2B 1X9YA 1A97A 4J49A 3ZC3A 1S2OA 2JFFA 4TMKA 2WNHA 4LBWA 1BEZA 1L9KA 3MB8A 3ESDA 1UT8A 2G0AA 4FBLA 1H69A 4B8ZA 4CQMB 4EGFA 2V59A 3S3TA 3THOA 5DI3B 4AY5A 1JG4A 3WL5A 4AUNA 4ALMA 3DKRA 2QUBA 2I4TA 3NC0C 4HV4A 2C8KA 3QWHA 4OPMA 1OCEA 2CDNA 2WDZA 1L5HA 3MN1A 5GM1A 5BSEA 1ZRMA 5EUQB 4A6DA 4H60A 4KRFA 2VK8A 1QJ4A 2YJNA 3M49A 2O7NA 3ZXXA 1AKQA 4CM9D 2JLQA 1E3JA 1POXA 2QTNA 2GAFA 2WU4A 3A26A 5NLLA 5K3FB 2QTWB 4BO9A 2IZ5A 1FFEA 2YTZA 1E7WA 3C16C 1QHFA 2JI8A 4RK4A 2GBLC 3C7CB 4RVCA 5CBPB 2GK4A 1U9IA 2DWCA 1O7JA 2P9BA 4H1UA 5GOZA 4AQDA 1RWWA 2HRZA 3FVWA 3OFSA 4DNPA 3A6EA 4C04A 3CU5A 5KOHA 5LXTA 1YBAA 3MLBA 4WXRA 1RI5A 3AHGA 4P7GA 4BCDA 2JCXA 3HKCB 2YHAA 4L4UA 3R76A 1BE8A 4BLOA 4EX7A 1M8GA 3V7NA 4LJ4A 4PVCA 4TXLA 3ZJTA 2V55B 4MV9A 2TMDA 1PT6A 1TAHA 2ZZKA 2AG1A 1VJ1A 4I1IA 3GPDG 4OXKA 4OK3A 5AXDA 1DLJA 2O3QA 3MVEA 2IV2X 2UVPA 1E6CA 1OLSA 3E5MA 3ZWOA 3SX4A 2PPLA 3OFVA 1XDWA 3NHRA 4UE3S 3LT1A 3BXFA 2QUHA 1SQ6A 1I4WA 3D02A 4CNQA 5B7NA 5EKTA 2PFKA 3K8OE 4LJSA 3I4FA 2M32A 1OMOA 4L51A 3ZN2A 2QSZA 1JU4A 3N0WA 5HIKA 4LI0A 1GMYA 1CY1A 2PYDA 2AZMA 4KHPB 3G79A 4KQ9A 3U17A 2RE8A 1G6OA 3OHMA 1SB9A 4NMHA 2EBFX 3DMNA 1NSYA 2JHCA 3ML1A 4P3OA 4UHFA 4Y9RA 3WNBA 1H3NA 4AJHA 3EQ9A 1ADGA 3CVJA 3OAAA 3RM3A 4ZV4A 1QYXA 3CMMA 3HDYA 1XMOB 2H1FA 2L18A 4Z3OA 1GCBA 2X19A 3LY8A 3OX4A 1N5KA 5J40A 3QQ5A 1MA0A 3PFIA 3OOWA 4DGQA 1TL7C 4FNOA 4M9XA 5B7GA 4QHSA 1RM0A 3DNMA 3T41A 1PL8A 5IN4A 5AI9A 4JA0A 3B20A 3G0DA 3GY0A 4TT8A 2PS1A 1SUPA 4CHGA 2RHCA 5ICCA 3DO8A 1IN4A 3UMBA 1EDEA 1QFMA 2PYZA 1FP1D 3G49A 2YMMA 3OY2A 1XA0A 2FQ1A 4URFA 4YP0A 1PX0A 2PWZA 1F2UA 2AC4A 3AEXA 4JWKA 5AICA 4E5VA 2OY0A 4W7HA 4XM2A 4EAAA 4IMPA 2J9FA 4IUBS 3RUAA 2O2DA 4YXWA 2JFUA 2QP9X 3WG9A 4W5WA 1OI3A 1Z83A 2PBFA 2V7VA 1N8KA 1I3LA 4FLEA 4C0XA 1QP0A 3OOSA 5EZ6B 4RHEA 1ZVVA 1TQ8A 1O0BA 2R1TB 4K1XA 3KM0A 3CVVA 4ZHQB 4O6VA 5DLPA 4ZEMA 1QV7A 1BE6A 2J32A 2RHHA 3A8TA 3A4NA 1LB1B 4WUTA 2H5EA 3S2GA 4YPOA 3TFOA 1UPUA 4X1KA 2GXSA 3M4JA 1F2CA 1PWZA 5LLDA 3P9KA 1SUEA 1XL1A 1G4AE 1ZD2P 5LP6A 2W7TA 1KYWA 2DSNA 1XQYA 4PN7A 4BQVA 4Q4LA 4D6PA 1N0IA 1RAFA 3CVUA 3IR6A 3S68A 4F84A 4JYAB 3K70D 2IT1A 3UPDA 2ZI6A 3IVGA 1XB2A 3E9YA 1LI7A 1NQTA 2JI7A 1DXYA 4Q39A 1X77A 5HRUA 5JUWA 4IIHA 2OOSA 2WJZB 5IF3A 1PLLA 1IM8A 1W88B 2PKRA 3DB2A 1N2IA 4GMXA 4D44A 1JN0A 5HEKA 2UZ3A 3V2GA 1OX5A 4KSBA 3CF6R 5A4DA 2Z4TA 4A0SA 1EM6A 1PN3A 1DC7A 2CXXA 4CG1A 2H1CA 4F2DA 4MUAA 3EVBA 3L0ZA 3QOFA 4Y18A 4EO7A 3UWSA 4KV7A 1UKBA 1FW8A 4LC0A 2PKWA 1U81A 4LFCB 3WYFA 4QASA 5AVQA 2NV0A 1PQYA 3IT2A 1K88A 3OZBA 4NS4A 3IKTA 4BKQA 1CU1A 1IHUA 1PZXA 1E9BA 1Y5RA 3K7EA 4JB0A 2OV6A 5KWJA 3DMFA 1R8JA 1ZRHA 2J9FB 3OD1A 2VHJA 3SR3A 4MS1B 4HXFB 1FDUA 5T6MA 1D4AA 1TJYA 4HGQA 2NSHA 3NTUA 4EYKA 1ZGGA 4HRXA 2GZHA 4BASA 3GLFB 3AETB 3UK7A 2PZ8A 4OSPA 4DFDA 1E2DA 1ZISA 2C0QA 1KH3A 521PA 4XB1A 5LMZA 4HGZA 3X2EA 3ENZA 4H15A 3TSCA 3MTBA 4WV3A 3AVWA 2XADA 1YA6A 1YMUA 4TWJA 3THXA 1E4YA 1XFAA 4KQJA 3GJ6A 3H04A 2B1IA 4XGQA 2MYUA 4DVGA 3ICQB 3RE1A 4DR4B 3LU1A 3NIDB 2CCJA 1QG4A 4FSXA 3GN1A 3T1VA 2ZIXA 2HHHB 3N05A 2J0VA 1HUQA 3KSMA 1PEAA 3DEFA 2QN1A 2V7UA 4HLUC 3RSZA 3EIQA 5EQTA 5JASA 1BE0A 2JD2A 3CF2A 2G8EA 3IYLW 1H23A 4HLUA 4Y1GA 2XU5A 3EGOA 4RD1A 4IRMA 2PX4A 1ZW6A 3AM4A 4C7OA 1RZ3A 4K05A 1WHSB 1GARA 3ICPA 2I7TA 4LXGA 2QLLA 4R3WA 5IAKA 2HLNA 4EW2A 1ODSA 4WNYA 1Q0ZA 1RM3A 4M0KA 1TTTA 3EVCA 1M8KA 3OJLA 1YL6A 2GFIA 2HRBA 1XRPA 1DDOA 3LY9A 3GMDA 4UMVA 1KC1A 2Q4BA 1B8VA 2KQUA 4KGZA 1XCJA 3CB4A 3WHLA 2EBUA 1L4FA 1OKKD 2I2BA 1LLQA 2VJOA 4XE5A 4CGZA 4BMYA 2YXDA 1H1LA 2E1RA 2W98A 4NPCA 4AP9A 2QIPA 2VUIB 3HBNA 1RXSA 2VF7A 1XVLA 3CKYA 5G2OA 2ANBA 4JYZA 3ZJVA 4AKGA 3OCJA 5DBOA 5B4TA 4RF4A 1MAVA 4G2TA 1T1RA 2BGWA 4O4HB 4EENA 2IYTA 2DQZA 5FT9A 4RORA 4ZYXA 5IM4A 1U4OA 4XYMA 4NMXB 5IM4F 1BO6A 3GPBA 2ODEA 2FQWA 1HYBA 1WABA 2HSDA 4TLBA 1ACMA 1F06A 2A5JA 5CVDA 3TLEA 3WKAA 2IOYA 2VHSA 3EOAI 5AJWA 2IIBA 2FH5B 3LA8A 1AK2A 4HN9A 1BY8A 1DG9A 1VXOA 2VHEA 4TN1A 1E58A 3COZA 4CTOA 4W4TA 3EY4A 5FI1B 1OGIA 1W85B 5K01A 1BEUB 2KLBA 2C5LA 3JQFA 2WHPA 1T0HB 3G2QA 5G3ZA 2OYCA 1N9ZA 1N6KA 5DT9A 3EDOA 4GMGA 2C2XA 1WUJS 5BYKA 3GL9A 2QB5A 2PRZA 4PU0A 2RJNA 5CEEA 3I23A 3WGNA 2QVBA 2BI4A 4DCSA 2R6ZA 3PUVA 4ZOLA 2ZT5A 1Q1GA 2ASVA 2PM8A 3LHIA 3DDUA 3ERCA 2FXIA 1WPXA 2I6SA 5JSFA 4MDEA 1NPZA 3ETGA 1LSOA 1MLDA 1PW7A 1COWA 2N46A 3BHJA 3SJZA 4DV2B 5JZOA 1G3MA 4RMGA 1GPWB 4YCJA 4EB6B 1I6MA 2D8AA 2BEWA 2ZTVA 1O0EA 4WLEA 4TSRA 3DFUA 5FPSA 1JBQA 1R8QA 2WV7A 3WYNA 2AQHA 5CFRA 3GBPA 2R47A 4O1HA 1VMEA 3JQCA 4XR9A 4QICA 1UAGA 3SS9X 4W99A 2HEIA 3CNQS 2OM6A 1PEKE 3C98A 4XTRA 4HT3B 3OWHA 4LMPA 2FFAA 1IG0A 3KX1A 4NOKA 1QDEA 2E0IA 4O8CA 4ALJA 2XT6A 5G0VA 3HZRA 3L8EA 4P34A 1Q1AA 4GOMD 4YCNA 1DGQA 3EZ7A 3EZ2A 5CH5A 3RGGA 3DFMA 1TL9A 3R7LA 3CBQA 1V6CA 2IHJA 2ERYA 1GG2A 3KOWA 4HWKA 3MJRA 3OCZA 4LZLA 2UUCB 1U7TA 2HMSA 3SSNA 3OF2A 2O05A 1XVAA 4GX2A 2NPIA 4JOQA 5GP1A 2CL7X 5IHXA 4YV1A 1YT7A 3S70A 3ZHRA 1U1FA 3IV9A 3LX5A 4INZA 1UJ2A 3ROXA 3NYQA 3HUDA 1KEVA 2HSJA 3OWXA 2OESA 4GR4A 4GX1A 1QP8A 4PHFA 5JAMA 2RAVA 4JQOA 3CO5A 3BWXA 3DMHA 4PPQA 4ZU3A 1SU7A 3JAWB 3WLFA 2VK4A 2ZOSA 3T9AA 3RU2A 2C2WA 4Q34A 2CKMA 2HKIA 2CVPA 2Q3FA 3EK2A 4DQVA 3B51X 5FUQA 2B8WA 3PD0A 2VTBA 4YCDA 3BIOA 3D5TA 2X8AA 4N3NA 1PL0A 2JJ1A 4WK4B 1JDVA 1MENA 3GYBA 4RQUA 2EP8A 5EUCA 3OSUA 1G16A 2VCHA 3Q0EA 3ZU2A 3EZYA 2GAJA 1A2QA 3OCVA 3OJFA 1BRTA 4LZAA 5BMVF 3NAQA 1E5LA 1HDCA 1GKUB 5EWLB 3RFUA 4D46A 2G7ZA 3PQ7A 4HQKA 3H1GA 1H2EA 2F1RA 4GSLA 4R40A 3UMGA 4ID9A 1ULBA 1AB5A 3I42A 1C8KA 1KS2A 3UAWA 3WRYC 1FDWA 2ZPUA 1ULSA 2CXPA 3FNBA 3ED5A 4G24A 3P7MA 2ZUDA 1GTL1 1L7OA 2KX7A 1JH9A 4MS4A 1CZUA 1JG2A 3HVKA 3T35A 2CFOA 1O97D 4WPGA 4DCTA 4X64B 3IO3A 3U1VA 1MT3A 4AWAA 4WURA 5J43A 1BS2A 3F67A 4GLBA 4CIVA 2CUZA 2G77B 5CT9A 4UW9A 1XPUA 1B0UA 2VAPA 4OOEA 3RG2A 3SPXA 1O9BA 5FKJA 5C1DA 4YDHB 2AEJA 1IXSB 2DBZA 4TKLA 1E1QD 1ZIXA 2JFZA 1GDTA 3PD7A 1VBFA 3PEVA 5ESWA 4D9BA 3CNEA 2HCRA 4R1MA 3U5TA 3UZUA 4AZ0B 1SCQA 3I30X 1KYZA 1KU6A 1RE0A 3BG5A 5GONA 2CVQA 1UJBA 2VC2B 3LNCA 3V3TA 2D4AA 2C58A 3IURA 5AVZA 4HNAB 4RTKA 4RD6A 3AKZA 3CVXA 3T3OA 4P4TA 5ETJA 4AC9A 4ARSA 4RF1A 3W5UA 4I08A 4HNTA 4AYWA 2O19A 1MOQA 1PR5A 2C2MA 3PQ6A 1Z38A 4B43A 4BZPA 4F1JA 3CLKA 1M1NA 3PQ8A 3P9YA 3ZQJA 2G82A 2CMGA 3SD7A 1EDZA 4R81A 2FDXA 5IJ9B 3O7WA 3Q2IA 2PL9A 5IUKC 1XLWA 2G8NA 3H5TA 3MTQA 1EUYA 5CURA 1A72A 1N0VC 1FC0A 4HC4A 1FP6A 1E62A 4XH9B 4FYXA 3AXSA 3CUSA 2JD0A 2VYNA 5KJ6A 4JP3A 1IQRA 1H2WA 3NFYA 3PHHA 3QEOA 4UTPA 3U7HB 3WGKA 3EDQA 3L8CA 4X6YA 4DJFC 4O59O 4UM5A 1XBTA 5LCXA 4M87A 2WFLA 4ABYA 1A7JA 2DHQA 2H5LA 3HMQA 3UO8B 1YRHA 1E2UA 5CLIA 2FW1A 1I2MA 4ZDWA 4OCZA 2G8LA 2WFMA 2EZUA 2GCNA 4RVNA 2B5WA 1YZNA 4MHTA 5A03A 5F7JA 4BO5A 1ODIA 4W1SA 4FB5A 2A0FA 4GM4A 4P54A 5JAHA 1NC1A 1VJ5A 5JXHA 1RAAA 5DHSA 3NWEA 1CYDA 4KGVA 1KSFX 1LV8A 2J0SA 3F7TA 1KAQA 4QULA 4UBKA 1K97A 4JHXA 5EWJB 4EAQA 5KTMA 3L41A 2LW7A 3H11A 3KYIB 4P5DA 2QDKA 1OGJA 1T8SA 1HYQA 2FI1A 1IB0A 2R1VA 2HB6A 2X22A 4G23A 3PC4A 5ED4A 1N36B 3RYHA 4DUGA 4E6EA 1KOFA 2XNSA 1XZHA 4I1VA 1PBHA 4IGEA 2AWNA 1GNVA 1BYUA 2O7VA 1OIXA 2NZYA 1IY9A 4YJFB 1XRQA 3UUGA 3URKA 1QLWA 2A0XA 3KXLA 3PQCA 1I2CA 3N6XA 4KGXA 2B2XA 2OQRA 4BX2A 3GLFE 1OLXA 2YIVX 1OH5A 4YJKA 3AJ9A 2PN1A 2F1GA 1PYOA 1QVRA 5FWAA 1M2OB 2WJHA 3WFJA 3A6KA 5IZ4A 3RW9A 4MEJA 1US8B 1GRRA 4Y6SA 3Q9LA 4QUHA 1GYPA 2IXDA 2FP3A 4KYTA 2FZGA 4YAWA 4BV2A 1AMNA 5CT5A 5JNWA 1LPAB 3N8DA 1CUSA 1UPTA 1VHJA 2E87A 1GTRA 2PGDA 4ZCSA 5G0SA 1PRYA 4LJRA 1O77A 4NARA 2IHYA 1QIIA 4JSTA 3CEJA 1DOHA 3ROTA 1PK9A 4X62B 1U0BB 1ENOA 1LWOA 2GZAA 1E59A 1UZNA 3L6RA