2HWKA

Crystal structure of venezuelan equine encephalitis alphavirus nsp2 protease domain
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
320
Chain Sequence
DVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETDKAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSRRYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKLKGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHYQQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSSLEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords helicase nsP2
publication title The Crystal Structure of the Venezuelan Equine Encephalitis Alphavirus nsP2 Protease.
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus (strain tc-83)
molecule tags Hydrolase
total genus 106
structure length 320
sequence length 320
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2hwkA02
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 2hwkA01
2I7CA 3P9CA 3G88A 1JSXA 2QRVB 4WXHA 2PT6A 3BGDA 1YZHA 1L3CA 4CKEA 3MCZA 4LG1A 2YX1A 5DXAA 1KPGA 5EIWA 4CTJA 1AQJA 2I6GA 4P58A 5FWAA 4ATNA 5K0JA 4P7FA 4CTKA 3LDGA 4HC4A 3CC8A 3CBGA 3QV2A 5K05A 2QE6A 5E1DA 2ZCJA 4HTFA 3LKZA 4DMGA 3JWGA 3IYLW 3E7PA 4EKIA 2I9KA 1JQ3A 3DLCA 9MHTA 1L3BA 2JG3A 3KQVA 5LQUA 2R6ZA 4P7JA 4PCLA 4GQBA 3X0DA 4F84A 3B7PA 3ELYA 3HCFA 5D1NA 3TOSA 3PB3A 4YV0A 4PYOA 3BWYA 3AWIA 5H02A 2G71A 1BKYA 2ZW9A 3DH0A 4PYKA 3KQWA 3DLIA 4PYMA 3M6XA 1NW8A 2FHPA 5U4XA 4X1OA 5IH3A 1M0EA 1U2ZA 2VDUE 3C3YA 2OBFA 3EVGA 3T7SA 4OQEA 2PJDA 4CWAA 3LCVB 2PWYA 4PIMA 4X63A 2ZBRA 3BUSA 3QOWA 3HEMA 4X41A 3KR0A 2NP6A 4C4AA 3NWEA 5T6BA 1FP1D 3SSOA 2AR0A 4OA5A 4RTNA 3ELWA 5DX0A 5DSXA 3GRVA 1EJ6A 5K0LA 4DZRA 1EIZA 5EIFA 5DTMA 2H11A 5LQNA 2FK7A 1TW2A 1XXLA 3FYDA 4PCAA 5HEKA 3KQTA 3SVZA 3HVHA 4FS8A 3U81A 3UJ7A 4MHTA 3ER9A 5BW5A 2YXDA 5ICGA 1N7IA 3DXXA 4RTSA 2PWPA 1F38A 1SUIA 3NVMB 3R0QA 3UJ8A 4A6EA 4L7VA 2BR5A 2OO3A 4RSRA 3BWMA 3GRZA 5DSTA 5T67A 4ER0A 5ICEA 3GJYA 3IEIA 3TRKA 2Q41A 3CCFA 3AXSA 4GOLD 2JH9A 3FTDA 3FUUA 3DXYA 3R9XB 4E2YA 3OU2A 2GA9A 4O29A 3MB5A 4RVHA 2UYQA 3OE5A 2ZBPA 2Z6AA 3WSTA 1G55A 4RTMA 2IH2A 1VLMA 5CVJA 5DM0A 3UZUA 3DULA 5EZQA 5DLYA 2ZBQA 3CJTA 3DMGA 1NW3A 2VZ9A 3V97A 4AZVA 1R18A 3LHDA 2XYQA 5LQRA 4DQ0A 4G56A 1FBNA 2PX5A 4YV2A 3OU7A 1L9KA 2P1DA 3A4TA 3V8VA 5K0BA 2IIPA 5FADA 3HP7A 4PGGA 4M7RA 2OXTA 4R6WA 2ONYA 3CJRA 3FRHA 3ID6C 3MTIA 5DM2A 3B3JA 3KR9A 5EEHA 1VL5A 1YFLA 8MHTA 2P3OA 1JG3A 3I53A 4GBED 4V0QA 2EJUA 1N7JA 3EPPA 4HRAA 5K0FA 2AOUB 3LDFA 2WK1A 4KDRA 3CJQA 3A7EA 1YF3A 2ZWAA 1RI3A 3TKYA 3M33A 3UA3A 4KDCA 2OYRA 4C08A 5LQKA 3QOXA 5EVJA 5EMKA 4BLVA 1NV9A 3RIEA 3PT9A 4QTUB 3OZSA 2NYUA 2ONZA 2BR3A 2QY6A 1JTEA 3E8SA 5CD1A 2FRXA 3JWJA 2JHAA 4PWYA 5F2KA 5BP7A 1AF7A 1RJGA 2ZTHA 5BW4A 2OB2A 5KVAA 2IDKA 1H1DA 4XUEA 2QYOA 3O31A 4AZTA 4AZWA 4U7TB 1AV6A 3Q7EA 3GRRA 4R05A 3CKKA 3KQPA 4LECA 1KYZA 3G5LA 4M36A 1SVUA 4ER5A 1L3IA 2AS0A 1G8AA 1WY7A 1X1AA 3JWIA 5HIKA 2C7PA 2HV9A 4CKBA 3DMFA 4HH4A 3KPUA 1WG8A 10MHA 3HCEA 2P41A 3LDUA 1JG2A 4GC9A 3DTNA 1O9HA 3OCJA 3R6TA 3B5IA 4OBXA 3EVEA 3PFHA 4Y30A 2ORED 1JQEA 1Q0SA 5E1BA 2UZ4A 5CVEA 2JHCA 1I4WA 2BZGA 4HGYA 2PBFA 3P97A 2FYTA 4LWPA 1P1CA 3BZBA 4DM3A 5BXYA 1QAOA 1NT2A 2O05A 3TPZA 3ANXA 3FRIA 1XCJA 1R8YA 2ZULA 2EJTA 2IBSA 2PSSA 4AUKA 1P91A 3TLJA 3CVOA 5DWQA 1NW5A 2AOUA 3LGAA 4E70A 5FWDA 3OFJA 3T7TA 3G7UA 1EJ0A 1SQGA 1EAMA 3BKXA 3P8ZA 4AZSA 3P2IA 5DM4A 3GCZA 4FT4A 1B42A 1Y8CA 2P3LA 3FPJA 3FPFA 3HA5A 2GPYA 4H0NA 5DX8A 3ORHA 5E2AA 5EKUA 4E2XA 2IBTA 4C05A 3FTCA 5DXJA 1NV8A 5E9QA 4BLWA 4CXMA 4DF3A 2O57A 5EGSA 2AVDA 2AZTA 5E1MA 1INLA 3AJDA 3ERCA 1VIDA 1ZQ9A 3BGIA 3A7DA 1ZGJA 2ERCA 1MJFA 4PONA 5E9JA 5P8WA 2ZLBA 2P7HA 3NDJA 1M6YA 5GWXA 1WXWA 3SSMA 3GIWA 4DCMA 2DULA 4GOOD 3FUWA 3LX6A 4EK9A 3UJAA 2OPBA 1KHHA 4UOEA 2PX8A 2JH8A 5EG5A 5K0CA 1D2CA 1PRYA 3HVKA 5GOZA 2AOTB 3MERA 3LCUA 5DPMA 3DOUA 1RJDA 3TMAA 2Z6UA 5GM2A 1RI5A 2B3TA 5CCBA 4DKJA 3OU6A 3PX2A 3IV6A 2QRVA 5FULA 1VP9A 5HILA 3NDIA 3UJDA 3P2EA 1EG2A 5G02A 1QYRA 2NXEA 1O9GA 5IKMA 5DM1A 2P40A 2E5WA 2NNWB 4FSDA 4CKCA 1VPTA 4WVLA 5EMMA 4QQNA 4V0RA 2R3SA 3NVKI 3M6UA 4KWCA 4BP3A 4RV9A 1XDSA 3A26A 4PIPA 3EVDA 3C6KA 3M70A 2ADMA 2UYOA 5T64A 5LQCA 4YUVA 2ZZNA 1R8XA 4MWZA 5CIYA 1KR5A 1X19A 1VBFA 5CCXA 1KXZA 3LPMA 2YUIA 3NW9A 7MHTA 4YUYA 4PNEA 4QDKA 4RTLA 1ZG3A 3D2LA 4ER3A 3UJCA 1F3LA 4P7KA 2AN5A 2OZVA 5EHGA 4P7GA 1ZGAA 2GH1A 5EEGA 4E2WA 1UWVA 2G70A 2PXCA 3MHTA 2ZIFA 5C0OE 5MHTA 2HTEA 2ZIEA 3TFWA 5K01A 1XDZA 2PX2A 3NTVA 3AY0A 5EOVA 3SSNA 5FTWA 1P39A 3MCTA 3PTAA 4DA4A 1G38A 3P9IA 2BM8A 1I9GA 2B25A 3SMQA 3L8DA 3MAGA 4RWZA 4ER7A 2VDWA 2P8JA 2XYVA 2AOTA 2AOWA 2ZSUA 5DRYA 2CKDA 1AQIA 1WXXA 4A6DA 4QQKA 4KVZA 2JHPA 2BH2A 3LL7A 2PXXA 1JR4A 3UJBA 3HVJA 5ERGB 1FP2A 5DX1A 1R74A 4YMGA 4IKPA 2VS1A 3P9KA 4IV8A 2F8LA 1XDUA 4FGZA 1ZKDA 5LR6A 3I9FA 2AVNA 2UYCA 3G8AA 1XCLA 1JTFA 4QTTB 3VYWA 3KHKA 1D2GA 2LD4A 3I64A 3GRUA 3I58A 1BOOA 4PYQA 3HA7A 4EQZA 2ZZMA 3PS9A 2YTZA 3KQSA 2IH5A 4FSXA 3ELUA 1R6AA 3BT7A 4OQDA 1VQ1A 3LBYA 4OBWA 1YB2A 4RVDA 5HZMA 5K8VA 1WZNA 2WA2A 3E05A 2XVMA 3A25A 3NJRA 4YUXA 4RTPA 4PYNA 2G72A 1Z3CA 3GDHA 4YMHA 2WA1A 1QAMA 3KQYA 3GU3A 1KPHA 1KPIA 3B3FA 4NECA 2XBMA 4EKGA 2PY6A 4ZTBA 4GOND 4YV1A 3TM5A 5GIOE 2IFTA 1YFJA 1DCTA 2CL5A 2PXAA 3FZGA 1G6Q1 3G89A 1M6EX 5C9ZA 3G2PA 2O07A 4AX8A 3F4KA 3K6RA 2C7OA 3DUWA 3HNRA 4PINA 3UJ9A 4BP1A 4YUZA 1UFKA 4C07A 4IV0A 1SUSA 2ZFUA 2NXCA 4MTLA 4FP9A 1BC5A 3KU1A 3HCCA 1JG1A 3UBTA 3BWBA 3TQSA 2EG5A 3DR5A 3GNLA 2YXEA 3VC2A 3P2KA 1KP9A 1PJZA 3O4FA 3T0IA 3NWBA 4PYIA 3UA4A 5E8JA 5JUWA 5EMLA 3LECA 4OA8A 5CVDA 3NMUF 1KIAA 3MGGA 4POOA 1I1NA 2H00A 3JWHA 3REOA 2BM9A 2OB1A 4X61A 4MIKA 3GXOA 5HIMA 2PVCA 4C06A 4ER6A 5K0EA 1RI4A 3KQOA 2P7IA 3KPWA 4RVFA 4E31A 3LKDA 3FPHA 1FJXA 1QZZA 2PV0A 2XVAA 5K0NA 3DXZA 4K6MA 1T43A 2P3QA 4RTKA 5C1IA 3EGVA 3OFKA 1YZ3A 1ORIA 5CVVA 4RTQA 3C0KA 3G2OA 3KR2A 4F85A 1SQFA 1VE3A 5ICFA 2C7QA 4XUDA 4EMSA 2IH4A 4KIFA 5LSAA 4HGZA 1DUSA 2NXNA 4M37A 2KW5A 5E2BA 3GO4A 3B89A 5EHIA 5EKXA 3TKAA 4QPNA 4BY9E 3ME5A 4RYLA 1KYWA 5KQRA 3TR6A 3FUTA 5D1HA 3DP7A 4HG2A 3PLAE 3KKZA 5HIIA 5B1SA 3HTXA 3G8BA 1RJFA 3OZRA 3GRYA 1P1BA 3OZTA 3TM4A 1JSZA 2G1PA 3AXTA 5M5BA 1RI1A 1NBHA 3FUVA 5K09A 5GIPE 1SKMA 2BR4A 3FPGA 3UJ6A 5JR3A 4M38A 2FK8A 2FCAA 3G5TA 1XJ5A 2ESRA 2DPMA 3KR1A 4EVIA 4KIGA 5HOQA 2XYRA 3VSEA 4MQ4A 1QAQA 5FA8A 2HNKA 4RX1A 2CMHA 1RJEA 3CGGA 1IM8A 2B78A 3I5UA 5KQSA 2IPXA 2AN3A 5E9WA 3EMBA 4E30A 4FR0A 2GLUA 2B2CA 4R8RA 5DTQA 1UIRA 3RODA 3BXOA 3FTEA 3HCBA 4HSGA 4FT2A 1OR8A 2YQZA 3MQ2A 2YR0A 3S68A 2N47A 2FPOA 4Y2HA 3EGIA 3RW9A 3FUXA 5LQAA 3IHTA 1NBIA 3PFGA 2Z6QA 1MHTA 2V74B 3H2BA 4GF5A 3ELDA 4E2ZA 3B3GA 4F86A 5KS2A 1JQDA 1O54A 3C3PA 1G8SA 2JJQA 4U7PB 4XCXA 1VP3A 3ER8A 4YUWA 2O06A 3BWCA 1NW6A 3G2QA 3SXJA 3PVCA 2AN4A 1FPQA 2OKCA 3KQQA 3R3HA 4GC5A 2VDVE 1TPYA 3T7RA 5ICCA 3M6WA 4KW7A 3PX3A 5E8RA 3EVBA 3A27A 1ZHFA 1IY9A 3EEOA 3C6MA 2I62A 1X1CA 3EEYA 3M4XA 4BLUA 5FA5A 1Q0TA 1N2XA 5GP1A 2EX4A 4QDJA 3P71T 2K4MA 4RTOA 2ZZKA 5DTRA 3DMHA 3HVIA 4OX9Y 2HMYB 4LWOA 5EQJB 3SGLA 2ZIGA 3FYCA 3GWZA 4X60A 5FCDA 3THSA 3EVZA 5EZSA 1XVAA 5EPEA 4E33A 4GEKA 5FQNA 5K03A 4RTJA 2V7EA 4C03A 5K0GA 3R24A 2IGTA 3UFBA 4E32A 2HR1A 5CM2Z 1L1EA 3KPVA 5DT2A 2QM3A 1D2HA 3KQMA 1R00A 3FTFA 1EQAA 4PGHA 2PKWA 5FUBA 2YVLA 3KPYA 3EMDA 1RI2A 2A14A 3OPNA 2AOVA 5GINE 5FQOA 4QVGA 2PLWA 5HIJA 3O7WA 4GOMD 4XUCA 3K0BA 2O0LA 1BHJA 1SG9A 3EGEA 3OE4A 4Z2YA 4PYLA 3HA3A 2UYHA 4GUAA 2GB4A 4R6XA 1NE2A 3BKWA 5CUQA 5DRTA 5LQJA 3LCCA 4HTFB 4DCGA 2H1RA 1TW3A 5GM1A 4JXJA 1JG4A 3KPJA 3Q87B 3BGVA 3UWPA 5F2NA 3FPEA 4IWNA 3LSTA 1XTPA 5EC8A 5FHRA 2IP2A 3HCAA 3SM3A 1X1BA 2ZVJA 3SR4A 2NXJA 2AOXA 1HMYA 2P35A 5EMJA 2YXLA 5FHQA 3THRA 3EVAA 4FZVA 3EVCA 4QPPA 1X1DA 2IDJA 2Y1XA 1NW7A 3MTEA 5KYGA 2CWWA 4C04A 3EVFA 2VP3A 1QANA 2HWKA 1NKVA 2B9EA 2GS9A 2CMGA 2GAFA 1IXKA 1HNNA 4QVKA 5CVUA 4ISCA 4PYJA 1V39A 3E23A 1YUBA 2ZWVA 2Y1WA 4R8SA 2PT9A 2PX4A 5E1OA 3SX0A 4KRGA 5HFJA 1DL5A 3GGDA 3LBFA 3P9NA 1ORHA 2EFJA 2OY0A 3VC1A 3HCDA 4B17A 4RVGA 1G60A 1WS6A 2C7RA 2NP7A 3M6VA 2G8NA 4RTRA 5F2OA 3HM2A 2PGXA 3G2MA
chains in the Genus database with same CATH superfamily
4UBIA 3G88A 3EFOA 3ZDBA 3H65A 4HGQA 2Y4OA 4HQLA 3UIEA 1U0JA 2V6BA 3UBMA 1XKXA 2IEIA 3LWZA 1C3XA 4P58A 1WABA 3FE2A 3OESA 4FYYA 4LHXA 2H2WA 4MAAA 4N3BA 3TZKA 2HJGA 2ZOSA 4C6HA 3FFBA 3MPOA 5L95A 3D7KA 3DQZA 3RJ5A 1C30A 3D6VA 4DLRA 3C87A 3PBHA 1J09A 4CDCB 6NULA 1ZVKA 1Y7TA 3C8MA 1OLSB 4G1EB 1WULS 4PG7A 3VPDA 1EWVA 4D8WA 4DMGA 3Q8WA 8OHMA 3IYLW 3GJ7A 3N70A 3Q1KA 3TIVA 1MS6A 2VNAA 4JFAA 2ODPA 2QW1A 3E27A 2R6ZA 3IE0A 1Y1LA 2G25A 4YAEA 1UDXA 1XO1A 3CWZA 1JWAB 1EP3B 1GUZA 1YBAA 1AGYA 2R9NA 1O96A 2JANA 5TS3A 1JPJA 2EV9A 5DASA 5C1PA 5HTOA 1PLLA 3FWNA 1CRZA 3L7AA 4X95A 5H02A 1Z34A 4RGVA 3DL0A 3OLZA 1VE5A 4H3VA 1JIIA 4N5NA 2J3QA 2RIPA 1SKYE 3PNMA 5D85A 5HCUA 4ZTUB 5DBFA 2XCTB 2VCEA 2C8VA 2LW7A 5EI5A 2O5RA 4OQEA 2I34A 4KPUA 4ZGGA 2J0UB 2NTNA 4RPKA 2ZBRA 3UUEA 2GWRA 3HEMA 4J1NA 1A7JA 4MRNA 1XZGA 3QGMA 4Q3CA 4W6QA 4X20B 2HW8A 3GJTA 2ACKA 4L07A 5AW2A 3L01A 2FRQA 1FP1D 3SSOA 1WUKS 4BFZA 1XEXA 4IOKA 3OPXA 1Z22A 1NY5A 1FFAA 5AKEA 4AKHA 2GFIA 4I55A 4PLGA 1EIZA 3AEQB 3RJZA 5EIFA 3UAZA 3CO5A 2Z04A 4CPDA 2JJ1A 2QXUA 1P2VA 3KOWA 4FS8A 4IGIA 4X1IB 5DHTA 3DVAB 2NVOA 3RUAA 4D9CA 3KOZA 1ZA2A 2JA2A 4GP9A 3UJ8A 2R9VA 3LV8A 4F8EA 1ONPA 3RREA 1AQLA 3GRZA 3RSZA 3TRKA 2YJCA 3RVMA 2IS6A 2D2EA 2VP9A 3OUZA 1UZMA 3KEMA 3K1TA 3IGFA 1UMCB 1T9CA 1GN8A 2QL5A 3OEED 4M0DA 4H0CA 5CLIA 1AXGA 1U7WA 3WKBA 1RADA 4BAZA 1BH2A 4HDMB 3OE5A 4I8DA 3ZJYA 4RTMA 2XITA 1S8AA 1NBMD 4NEHB 1LPAB 1VLMA 1XK6A 3M83A 4YLGA 4CIDA 2XHEA 4K05A 1ZYUA 2G7YA 3T41A 2ATOA 4X6HA 1WU7A 4C3ZA 4K7JA 2ZREA 5TQ0A 3BK1A 4NZOA 4QDTA 1YAJA 4XZ3A 1T2AA 3VC3A 5K3OA 5KNDA 4CIVA 1K8ZB 2HL6A 3NT2A 4Y2GA 2A5YB 3TBFA 5JXGA 4D1YA 1GRQA 1W47A 3CF4G 2CNDA 4KVAA 1FS4A 2EJUA 2FCRA 2ZQ5A 2ACEA 4PG4A 5JAHA 1R0KA 2XZPA 4D4GA 4KN5A 4HX5A 4PQYA 1GKKA 5CK4A 3TDMA 4F91B 3C74A 4MW7A 2BMWA 1NX6A 1TJ5A 2Z56A 4MW9A 5JJLA 1CHDA 1V3QE 2VSOA 4JLSA 3E0XA 4QTUB 2NYUA 4Q4AB 3H1EA 4LTDA 4KTTE 3LQKA 5C8YB 4GD3Q 3RPEA 1S8FA 3KG2A 1ZJYA 1GAQA 2E4VA 2PRSA 4QVIA 3RQSA 3WL3A 5DDIP 1SQ6A 2HF8A 2WE8A 5KVAA 2A9VA 2P2DA 5LB2A 3WIDA 4A1FA 1FC0A 3ESQA 4C6TA 2PO5A 121PA 4C7BA 2BF4A 2R8YA 3GRRA 2G8LA 1KYZA 4D45A 3WL4A 1JDVA 1RSZA 2QN9A 1ZBDA 1CV2A 1YIDA 4Q1CA 3LTNC 1HY3A 4L4ZA 1TJYA 3KPUA 3M4YA 3E0QA 2VP0A 1B00A 1MAUA 4GC9A 4UPVA 2WE7A 1T3TA 4NDAA 3TQIA 4QC2A 4RU1A 4HF7A 4GI5A 2QP3A 2B1RA 2DQSA 5IUKC 1T36B 5FI5A 3E1KA 4L8VA 4WLNA 2Q1TA 1C7JA 1F14A 4BNXA 3UICA 2R1VB 1LTQA 3M34A 2V3VA 4O4HA 4PS0A 4Q66C 4E21A 4UHDA 3P0HA 2GPTA 4OFXA 4RKWA 4RVCA 3VAAA 2W2NA 1A27A 1NFRA 5BN5B 5LMCA 2H1FA 1MEJA 4YP0A 3WMWA 9GPBA 1W8IA 2PH3A 3AHGA 4YCCA 4ZRMA 3CG4A 3UHOA 1FBTA 2APJA 1N8SA 4RACA 1O0EA 1NW5A 2HA7A 5FWDA 2A9QA 3CA8A 3B1YA 1CPYA 2I4LA 2NZXA 2IS2A 4BOUA 2H3EA 3BFJA 1B6SA 4JLJA 4C0LA 1A2OA 5E2AA 1K7YA 3FPFA 2C20A 2HPVA 3OJFA 1XHEA 3K31A 3T3HA 2A88A 4RFVA 3GX1A 5CHVA 5AJTA 1T3HA 1QKJA 2XBUA 1I4LD 1P80A 4UNPA 2ZI7A 4F4FA 4ENVA 4YCDA 1E61A 4AKSA 1MGOA 1TIBA 2HDHA 2IC5A 4FOOA 3AERA 2Q3JA 4V3CA 1PT5A 3IOBA 5KNLA 1F7VA 2WABA 2YHIB 2Q9UA 3Q9LA 2XSZD 1JILA 3JD3A 2PM8A 4KYIB 4OHXA 2QB5A 1MTZA 3HB9A 1MA3A 4GPBA 3FUWA 2EWMA 2OPBA 5EE9A 3L1IA 1WVMA 5KTOA 1GQQA 4UOEA 4G67A 2AIRA 1E3WB 2CVZA 4KFSA 2GEJA 2ZB7A 3AJRA 2QMHA 1U4SA 1UFVA 3HVKA 3ML1A 4B44A 1X7ZA 5K0CA 5K6RA 5M34A 3I3SR 3KDPA 4BNFA 4M9XA 1AK1A 2FP3A 2Q29A 2GZRA 2WJZB 2R6FA 3GAFA 3B85A 4U2DA 3V00A 2VK8A 5ALOA 2AJ8A 3OZVA 2X23A 4XQ9A 3QWBA 4XLZA 3ESDA 1PR2A 1ACLA 4QOEA 4D97A 1ZGZA 3NDIA 3ZWKA 3D3NA 2FRVA 1YVDA 3OZFA 2PWBA 4MUMA 3IIKA 1SULA 4KLRA 5JZOA 1AYUA 4OUKX 1KYYA 3FCUB 2DPYA 2OGTA 2W9XA 3OM1A 3R5KA 3A3NA 4I4LA 4RW0A 3SC4A 1T1IA 3VX3A 4NZNA 2RK3A 2VYNA 5FBQB 3GLHE 4CCSA 1YUNA 2OMKA 1R8XA 5A5EA 4N65A 3F6RA 3KXDA 1VBFA 3EQ2A 1XHFA 1FFCA 2IWRA 1T2DA 1DJNA 5K5EA 3D7RA 3PKIA 4KNWA 5L8VA 1E2DA 4AJ1A 1DHRA 4PAWA 1HETA 2FP4B 2HUPA 2QGFA 3CH7A 3M6IA 3UJCA 2DOKA 3GBVA 1H2HA 1RZ3A 2VNJA 3IAM6 5IM5A 2FSSA 4EX7A 1BMQA 2EBFX 3DUFB 1EZ1A 4H4EA 3NAZA 5C1BA 5TGDA 3CXRA 1VSNA 2PYZA 2MYPA 4HYQA 2OD7A 2DPHA 1P44A 1QIMA 3HDTA 3LC2O 4NJEA 4E1VA 3V7NA 4E5SA 4RWZA 5A3QA 5AXCA 1QWSA 2BTQA 2CC2A 2E6KA 3F6EX 3AL3A 5JSKA 2ZSUA 2AKAB 5A7HA 1U99A 3I34X 5JNTA 3ESZA 2GM9A 1SCIA 2J5KA 1VC2A 4B6QA 5HIAA 3M9WA 2ORWA 4OUDA 4DY4A 1Y8ZA 1QDQA 1FP2A 4QASA 3BDAA 1FF9A 1SOMA 4O2BA 3NH6A 4ZI5A 5C8VA 5I3ZA 3AF6A 1SUDA 4RNDB 4LC0A 1HQCA 1XMIA 3TW8B 3G8AA 2HKIA 1IXSB 3V9PA 1BHO1 1DRWA 1E1RA 3ANTA 4EP1A 3QF4B 4Z54A 3HB0A 3O83A 4IUCS 3RSGA 4HDRB 4EM6A 2J0SA 4BO0A 2AK2A 3I39X 3U3ZA 4AT1A 4OAQA 2IYAA 1YJAA 3JQDA 3EZNA 4QSHA 3EY4A 3GUZA 4RTPA 3ZDYB 4EYEA 5JAOA 1TOAA 4LJAA 2PGDA 4CMAA 1DKIA 4CYMA 4EGFA 2GHTA 1SQ5A 1OFUX 5KVQA 3B3FA 2V9CA 1IQUA 1EUDB 2MTBA 3C6QA 3M5DA 1WBJB 2EVWX 2NADA 4O4JF 5M3BA 1YGPA 2G9RA 2PXAA 3BTUA 1OFUA 4DHWA 2XBLA 4AO6A 5LXTB 1NJ5A 1RAHA 4ETWA 4KXNA 5ILGA 3PD0A 2Y1CA 3A3PA 2AG0A 3E9NA 1IBRA 2FGKA 2V6IA 3NANA 4PC3A 4B33A 3Q7RA 4QDUA 5KWIA 4U7WA 4B3TB 5IZCA 2C88A 1B16A 4PG8A 2CVHA 3Q85A 4S35A 1BQ4A 4UE3S 1KZ6A 1RPTA 3CX3A 2NAPA 1SVKA 3UG6A 1Y7IA 2CLOB 1WQ4A 2IXFA 2OP1A 1N2IA 1EE9A 2BKXA 3BWBA 3QPCA 4PNZA 5P21A 1DIBA 3GNLA 4JVOA 1QYWA 3D64A 4JXZA 2AGVA 3DBRA 4JJ8A 2BFBB 2DOSA 2PUDA 3O4FA 3DL7A 3Q6NA 3KQHA 1I6MA 3IBCA 4LNUB 2OHOA 2Z5GA 2YL2A 1QFMA 4CCYA 2C5HA 4RFLA 4MS4B 1PU2A 4EK9A 1OB2A 2H2IA 3GXOA 1LFDB 2PVCA 1NB5A 3KQOA 4MMZB 3RHTA 1ETHA 2PKQP 1THZA 3NU1A 4LHEA 5HKLA 5DEOA 3DNMA 2P9YA 2YXPX 4QO8A 3AUYA 3LIIA 1HBJA 5FBHA 5K0NA 2NLOA 3DXZA 3QXHA 2ZYGA 1G3IA 1T43A 3BBLA 2CNLA 4XEHA 3TLEA 1PWHA 2JI4A 4DIEA 3EYAA 3T8YA 4LOIA 3EGVA 1XNRB 5FA6A 1EWOA 5CVNB 3FW1A 3SZLA 5AUOB 4HRYA 2G0AA 3FSGA 2FPGB 1YDWA 2A5JA 2X2OA 3O1HB 1L7RA 2I91A 2DPGA 3IAS6 4DE5A 1ZH6A 1P73A 5E2BA 3EF1A 3V6LA 1ZQ1A 1YVRA 2H4ZA 4NONA 5E4TA 4JLAA 1FXWA 1R0ZA 4B7UA 1PJ4A 3D4IA 1W0JA 2X2FA 1GADO 2DKFA 2BDEA 4M89A 1RPNA 1Q5PA 3KKZA 5EJ2A 2X0DA 3UEOA 4ADSG 1DV2A 1JJAA 1ODTC 4DIDA 1CR6A 4TWJA 4KSBA 3WYDA 2J0QA 2FPKA 2VHTA 1JSZA 1K1EA 4TXMA 3L06A 1J8QA 3WXMA 3D6UA 3LW8A 1U2GC 2AIMA 1HSZA 4UFOA 5K9ZA 2NV6A 4J07A 1BN7A 5C5EA 1Q44A 1OA0A 1QO9A 4ZV7A 3TNLA 4F46A 3N0TA 2HHCA 2YCBA 2WV9A 5ALWA 5D6NA 5EJEA 3FKJA 4XYGA 2Y4NA 3PFFA 3EMBA 4AN1A 3IHPA 3C5VA 3IX7A 4TMTA 1UWKA 4JUBA 1HT2E 1YR9A 2FFRA 1U7HA 1YDFA 3GB9A 3NZEA 2D5IA 4CEJA 2QRJA 2WVGA 1Q0ZA 2H2DA 3NM6B 4QWWA 2J85A 2EF1A 5FTNA 4UAUA 3RW9A 4RFSB 2P9HA 4YRFA 1VPVA 3PFGA 1BA2A 1X74A 3N8KA 1C7EA 2QJTA 2PX0A 3C3XA 3KT6A 2FDCA 3Q0TA 4EFKA 3JTEA 1CNFA 2JJQA 5HTKA 3RKSA 3SDSA 3B1ZA 1KXJA 5HUQA 3RIGA 5CG1A 2OKCA 3IVCA 1VB3A 4GC5A 4BNYA 2ZWIA 1QU3A 1SB8A 2CHFA 2QLTA 2YBDA 3OD5A 3QMPA 3ZLBA 4CR6A 1A7UA 5KTSA 3OZBA 5CW1A 3ET4A 1Q7CA 4QUAA 4RENA 4G4GA 2YZKA 3Q40A 5JMOA 5EJ9A 2JGFA 1Z2AA 1Y3DE 2HJSA 2JK0A 3MXTA 1DQNA 3TEFA 2GBLA 2ZJ0A 2ZZKA 3HVIA 1WXIA 1D4ZA 2EJVA 2JI8A 3KZXA 2H29A 3NNDA 4KQEA 3NUQA 3THSA 4RANA 3K9FC 4HFRA 2PT5A 2VDNB 4OQQA 5ALKA 1FS6A 1P5FA 1V41E 2C5SA 3BE8A 1H9AA 2PZMA 3RSHA 4FFLA 3UK2A 2EU8A 1MJGA 5K0GA 1Y6FA 2VHSA 1XZNA 2QKYA 2P4HX 4MKXA 1OC4A 1SU6A 5IHXA 3LCMA 3LWNA 5IDXA 1HF3A 2EWWA 4OHWA 4EJ0A 1DBPA 1YKGA 2R65A 4FD2A 1COWA 2FEKA 2XDQA 1GLVA 4PSVA 4CCWA 3FX2A 3H5WA 3Q3JB 1UBEA 3FCOA 5TQJA 2I6QA 4B3RB 2WPDA 4GOMD 3D4OA 1FDWA 4A82A 3IBFA 3HO8A 5ENDA 4CI9A 1PUJA 1Y1TA 2GOYA 5LNK1 1QE5A 1EGHA 3QELB 1RTKA 4K28A 4RSHA 2OGZA 2JAUA 2XTMA 1E2LA 2ETXA 5DI9A 1YFKA 3GLFB 3IHLA 3ETHA 3U5ZB 3LSTA 5K4GA 3ILSA 1JHXA 2NXJA 1D1SA 3ABZA 1O2DA 3IE2A 3N0WA 3PDWA 2C98A 4IQ4A 4RIIA 4DDTA 2IOFK 1WB9A 1Q15A 2VUIB 2HAEA 2R5WA 3C3AA 1ZCFA 4CLHA 1ZAKA 2V8OA 1J5EB 2FZLA 3RIXA 3KT0A 5HRUA 3TG2A 5FBWB 4XYEA 2W8BA 2YS7A 5JCJA 4XGNA 5IVIA 4O59O 1LBSA 1LV7A 3ZVKA 4RK0A 3G8YA 4JBHA 1JR3A 5ERYA 5JXWA 3PDHA 3O65A 2P79A 3DZBA 3HE3A 1PNRA 1FL9A 2JBHA 4W8OA 4GX2A 4UNSA 5GJWC 3FETA 4XD7D 4MW5A 3LRTA 1UMDA 1XQ1A 1ZH0A 2PGOA 3CMCO 2ZG6A 3PNSA 1PVJA 3LBFA 5I7WA 3QNWA 4KXFB 5FFNA 3T9DA 3JALB 4MGHA 4H7IA 4DMFA 5C81A 5YASA 1KEUA 1R8QA 4RWEA 1M5RA 2QUHA 1Q14A 2QRVB 2WSBA 421PA 1XTRA 3DE2X 4DREA 4FC7A 1PQPA 3PGMA 1OFTA 5J47A 1CIPA 4E5MA 3DEYX 1E2KA 3JD2A 4HH1A 4TT3D 4YFVA 1I51A 2GYYA 3ZDEA 4MQ6A 3UYKA 4A92A 4B2LA 4UVEA 4J90A 3I6IA 4FE4A 3VTZA 5DFAA 3SEFA 1EVQA 2CDRA 2FZGA 3GH1A 4Z9FA 3JXEA 4RMJA 4RQAA 2IPPB 5DK6A 3SE7A 4F0JA 4KACA 1G18A 3PXCX 3KUKA 2CB5A 3GT3A 3DLCA 1O8CA 3DBOB 4Y8VA 1IY2A 1KDZA 4CUZA 4MCHA 2C31A 2OD2A 1ZH4A 3VR6A 3ZD6A 3UT5A 3ANYB 3NM5A 4GZMA 4F84A 3HCFA 3CTPA 3A1WA 3FNQA 5CRIA 2PUWA 2BTWA 5KWSA 5L51A 2FZ4A 3IDFA 3FBGA 4OXNA 2JD2A 4KKXB 1EBBA 3M6XA 1NW8A 4YAUA 4X1OA 2IL1A 4ERNA 1YASA 5BQ3A 3IMEA 5B3KA 1RYDA 5CEJA 1V95A 2PWYA 3IVAA 2WU3A 5AHOA 1S96A 5JAPA 1LFAA 7PCKA 4Y2PA 3ZWNA 4H77A 1NC3A 2GYUA 2Z4TA 3IUBA 1NLYA 1BHQ1 1MR3F 1NFQA 4RY2A 1QDUA 1M1YB 1TUBA 3CS3A 3F98A 1KYQA 1Z6XA 1E8NA 4K3UA 4WNAB 2HU8A 3DTVB 4V0KA 1UXJA 2VJYA 1TYCA 3LTEA 4WNYA 1VYHA 4EA7A 4YT2A 1PF7E 2E7ZA 1QHXA 3E2MA 3CCBA 1NNSA 3ED1A 1TW2A 1XXLA 2J9FB 3FYDA 4OMFG 4R3NA 4WV3A 3EC7A 1PJQA 3D5QA 3BULA 1M6NA 3AKYA 3A32A 5DGXA 4O2AB 4BGDA 4DV7B 4IIGA 2ZQZA 3ZUPA 1QGOA 4L7VA 4DQLA 1OLSA 4NE2A 2VDLB 1YS1X 5CYPA 2YZ2A 3IS3A 1D2MA 3MT9A 4ZVNA 1KYIA 3KEFA 4RE5A 1YBHA 2Q28A 1E1CA 1QZXA 3JQEA 4WBXC 2HHLA 1U9WA 1W0CA 3ZBQA 1DG3A 2RGWA 4MYHA 1TADA 1M73E 4AJOA 5ALIA 1L7MA 2VHYA 3ABOB 1QH1B 4UD6A 4NV3A 1GZUA 4D92A 4CU2A 3DMGA 1FFYA 1VCOA 1W34A 3V97A 4AZVA 5LQRA 4O1HA 4I66A 1AYWA 1GT6A 4MWDA 5CVCA 2OWEA 4U7GA 5AD1A 1ZIVA 1E7SA 1RBZA 5TMBA 3DOOA 5JMTA 1ST2A 2BD0A 2D8MA 2GERA 2RARA 3PG5A 5FOQA 5KNBH 1CPJA 3WHKA 5TEVA 2AJBA 5K3FB 5M2QA 2J0UA 1Q1GA 2P4UA 2KHZA 3AF5A 3AI3A 3GGGA 5F7OA 4L6CA 3TE6A 4DMXA 4MVJD 2WU4A 1CQZA 1JG3A 4GBED 4X20A 1OPRA 2AF3C 2VRNA 3GH3A 3KYDB 2X6TA 1GV1A 5SV2A 3A4VA 1GCGA 1Q7RA 3DF7A 2W2PA 3EJWA 4I5FA 3UA3A 2BGNA 2ZWMA 5LQKA 3GRCA 4OGLA 2QD4A 3MTJA 2CYAA 3RDPA 3DGEC 3O4HA 4X1IA 1TE2A 2O2SA 3RS8A 2BJVA 4ZOEA 2ZBFA 4X97A 3T1YB 1YNOA 3GDWA 1USKA 5D3ZA 1JDZA 3H1GA 5CBPB 1G59A 3E3NA 2J32A 4TUYF 4KN8A 3FJ1A 4IJQA 1N5MA 3BREA 4D8UA 4P3KA 2OZLA 1QH8B 3OWXA 3GGSA 4KODA 3CKKA 3GY0A 4NDNE 2FOLA 3FHCB 1UMCA 3W7VA 4R1OA 2AS0A 4BV3A 1OBFO 2V6FA 2DQYA 4ZO6A 3UCEA 3NWJA 2FMHA 3KLPX 3Q5EA 2P9BA 2VCYA 5JCOA 3WIEA 4HDMA 1X7DA 4HP8A 2Q4TA 3HI6A 3B2NA 2YFKA 3G2KA 4INAA 3BIWA 3WYNA 3DV9A 1N8KA 5DNCA 1SC6A 3FR7A 3PD1A 1A1SA 4G2TA 2JHCA 4J9UE 4WZAB 2X86A 3JAKB 2FFAA 1FTYA 1V3UA 4LWPA 1HNXB 2FYTA 1UPTA 4A03A 1U6JA 4GOKA 2I3ZA 4CZ2A 3PPWA 1NT2A 1NONA 5BXQC 1GZSA 2RCYA 4WOPA 2EKQA 5JVDF 3HY3A 4HWGA 5C7IO 2XCOA 3ETJA 3H1AA 4NCXA 5E7IA 3MEQA 3P5WA 1NVUQ 4FDUA 1T1SA 4EHJA 3VH3A 1A9SA 1KY5A 1MNAA 2P4QA 2IZ6A 4ZT6A 2DF8A 3AQ4A 4D25A 3NUGA 4HKTA 1BWSA 1DC7A 4MI3A 3ZN2A 1CG6A 1QPZA 5AQEA 3CH2X 2GM3A 1G7SA 2OBMA 5DX8A 4FDLA 1U1CA 4Q4AA 5JQGB 3KX2A 5C8YA 1WMBA 3LO5A 1H2ZA 4NH4A 3W8DA 1FRFS 1RYFA 3OKPA 4E3ZA 1WKBA 4JB3A 1QXSA 5FIUA 1SCBA 2ZR0A 5EGSA 2Y6VA 3VTFA 4LNHA 4DV4B 2R9OA 4KZKA 1NM5A 2QMQA 4V3BA 2AZMA 1I3CA 3S4YA 1JALA 4XB2A 3LLVA 4OX9B 1CZKA 1LLUA 1RJWA 3MTAA 2YDXA 4IJVA 4C0BA 2PD3A 2ST1A 1ULUA 5F9MA 3UJAA 3IERA 1ICFA 2XH8A 1HT0A 2IGBA 4JCOA 5EXTA 1VHJA 1G38A 3EIEA 1ZS9A 4WBSA 2FW7A 2Q49A 2IU0A 2X40A 1YC5A 5EG5A 4NKRA 1HDZA 3B6JA 2ZYAA 3JASB 1T36A 4OHZA 3WRYC 1JDTA 3INRA 1N9GA 1QIHA 4PLCA 3KW9A 5DPMA 3G23A 2HQBA 2R1VA 4IIEA 5GONF 1ONSA 1RI5A 2ODWA 2XA9A 4FYXA 3JQCA 3TZHA 5CYOA 4C4TA 5IASA 1OFVA 1NL3A 1UKAA 4ZMRA 1DU4A 4YCAA 5MFPA 1POXA 1DEUA 4EDHA 2ZQYA 4US2R 4D0SA 5IVKA 2ZBDA 4FLMA 1OI3A 1JFTA 4IX9A 5TJHA 1HDEA 2I8CA 3NRBA 3ADPA 1W36B 4GP6A 3GPCA 1H9CA 2GBGA 4WW0A 4NZZA 1CQIB 2UYGA 3FPBA 3NT4A 4C5BA 3Q4GA 3DHVA 1SBIA 6ABPA 3NT5A 3QU7A 2RKWA 1V47A 2O1SA 4NABA 1MG5A 5DGCA 4BSQA 1ZMXA 2R6GA 5BORA 4MIYA 1ZRNA 2D0DA 2H1SA 1A04A 2JGKA 4IJUA 4O5AA 3TIGA 4FHEA 4BUCA 2XMCA 5B2ZA 3RSSA 4IBOA 1QF7A 3EGDB 2JDID 4IYRA 2D00A 2CF6A 2FWAA 3DDZX 3GFFA 2EEZA 3HSYA 4Y7DA 5KKAA 1L5GB 4YUYA 1OBVA 3A1DA 2AFIB 3QY9A 1Z18A 3IEUA 4OHFA 2BFAA 4MXDA 1KI6B 1RKXA 2XWBF 2Y9MB 4ASUA 2QGNA 3T34A 2PXCA 2YHIA 1JHMA 1WXDA 1ORTA 3SX2A 1GGNA 2J07A 5REQB 1X15A 4AWXA 4DA4A 3SQLA 1KFKB 5HF6A 1W6UA 1KY4A 4XSHA 4CMKA 2FLKA 1E3WA 4BN0A 2RH9B 1XWIA 2P5UA 1S9HA 1YCDA 4HLNA 1B73A 3CLUC 4EABA 1M2WA 1QF9A 1P0FA 5DTIA 2XAAA 2O8CB 4BX0A 1DELA 1QVAA 4HQRA 4MPTA 1L5YA 5EKTA 1N6IA 5ALHA 4B45A 3HM9A 3FF4A 1R4MB 4FJCA 4JX8A 1P7CA 3OTHA 5J59A 4E88A 5KYXB 4MI7A 1ZC3A 4YMSA 5GMOA 1RYZA 4RE6A 2CD7A 4RKYA 4WJKB 4WL0A 4XQEA 4ZVPA 2VS1A 3UM9A 2C8KA 4L3OA 5D01A 2N9UA 3A6LA 2Q3EA 1E8MA 5F3WB 3UAWA 1ZKDA 3FZQA 1PBHA 1E92A 4XVCA 1X7YB 4Y6RA 4TYMA 3VHQA 1EX1A 3KX1A 1Q77A 1A9ZA 1BZYA 2IDMA 3GRUA 4D4JA 4GRDA 3L6DA 3MUOA 4F4IA 5KPDA 1V8DA 1MV5A 5SZHB 4LWQA 4RM3A 5EZ5A 2WJWA 3CIFA 1T6ZA 4MV5A 2IH5A 3JQPA 1E58A 1V37A 1QGUB 2XCSB 3G9XA 3KWZA 3RU9A 4EHKA 2P4EA 1ECBA 3FNEA 4UHKA 2FP4A 2JJMA 2IZ7A 4BB0A 4E2FA 3LPCA 1YD7A 3OBIA 1UJ4A 4ETIA 1CUWA 9LDBA 3DEKA 3DUFA 3ZPXA 1FLNA 1T5DX 1GU7A 3RJ9A 2JS7A 2IXTA 3EG9B 1DCTA 4EI2A 2IHTA 3G0CA 5JYBA 2DQKA 3D6AA 4GPD1 5LBTA 3PUWA 4Q39A 1EYZA 4G4IA 4DDKA 4CT5A 4KOAA 5JI2E 1XYVA 3MHPA 2DTXA 1C3OB 4HNAB 4L4RA 4Z53A 1OZGA 3GZNB 1MF7A 1Y1SA 1U9QX 3DO5A 4MTLA 1JHUA 4WOJA 1OD6A 4B46A 3F47A 1JG1A 2Y0BA 4GL2A 2YV5A 4CLOB 3JW8A 4DMRA 1GGMA 4FFSA 3DR5A 1AMUA 5H9VA 2FR8C 4OXXA 2PRKA 3P2KA 1V8ZA 5BYAA 4F4JA 4TQGA 1PJZA 4DDMA 3Q8KA 3UA4A 5JALA 3MJRA 3TW8A 1D04A 1F9AA 3LECA 1J0AA 2VHQA 4A0FA 4OI1A 3AHCA 2UVDA 5FAXA 4B4UA 3H75A 3SS7X 1ECJA 4ER6A 4Z7OB 4NU8X 5EJFA 3WICA 1GZ7A 4HDRA 4DEVA 2HBRA 1N8TA 4MCIA 3SICE 3F75A 1FJXA 3HKDB 3QA9A 3N5CA 3R2JA 3HWNA 4K9LA 3KE8A 3RTCA 1MXFA 4C0QC 4NULA 2EP7A 2P3QA 3OISA 1HH4A 3WLTA 2O8VA 4TV9F 1ORIA 3RTBA 3P5SA 1W19A 2YVUA 5DBOA 2MJLA 4N7RA 2W2LA 1AQUA 1SQFA 1ONBA 5FNVB 3WKEA 5LSAA 4W5HA 3OH8A 5HFAA 4WECA 3TKAA 1Z0SA 2BRUA 2Q3MA 2DR2A 1NQCA 2Z30A 1FU8A 5LXTA 1EWTA 3P2YA 5B2EA 4Z7QB 1JR3E 4XYMA 4EKNB 3HDJA 2BFWA 2YFQA 4XI9A 1YDGA 5JQWA 3MJ5A 4Q12A 1ZCMA 1OFGA 1MTOA 5IRCD 3WMGA 4Z8YA 5I7UA 3KZVA 2B5VA 3QSYA 2XCIA 3AXTA 4DLWA 3F5MA 3U1BA 3BY4A 1THTA 2NVBA 3JQ6A 1C1DB 1QLWA 3ZZUA 1AKQA 2X15A 3CRMA 1ESZA 1DJLA 1L5OA 2BMEA 3KR1A 1BDJA 5G0TA 1YZUA 3ITKA 3SE0A 5F9FA 2P9CA 5FA8A 1OBHA 2BFBA 1KZ4A 2I2DA 4GMXA 4DZZA 1R0XA 4LNUA 2Q8QA 1IY1A 1E1QD 3C98A 2PYIA 3TBHA 4YROA 1NVBA 2QJRA 2VTVA 1G4AE 2WJGA 3CRRA 3LUPA 4LYAA 5AKGA 3FTEA 2PQMA 2WYVA 4HSGA 3KVRA 4FE3A 4DUZB 4CQNA 2AXQA 3SJBA 3U5TA 1PR3A 2VPWA 2HYDA 3EGIA 2Z4SA 5F1OA 4QXOA 2GHUA 1UT8A 3AP1A 3AKDA 5BSKA 1MHTA 2YOHA 3A9CA 3H2BA 3T4EA 4R0MA 1QQ6A 1OAOA 5KS2A 4TTJA 1G8SA 2B2NA 4ZOLB 2FPGA 2NSJA 3AF2A 4NZMA 5JAUA 3GMDA 3HXMA 1AUVA 1UMBB 3R3HA 4UPEA 1EGQA 2X22A 1FLAA 4UEJA 5J58A 3GQVA 5LNK6 4KW7A 3V8BA 3HH8A 4YT5A 1ISFA 5TMDA 2HRDA 3WDMA 3WWZA 4AF6A 3RS2A 4OP1A 3VVBA 2DBQA 4TTRA 1JEQB 3KSUA 3M4XA 1JDSA 2YNMD 3L0OA 4HATA 3G82C 4OQNA 4EFNA 4EDFA 5JJCA 3I9NA 1ZMRA 5JZ9A 4RD2A 3C1TA 3QT4A 3H89A 4IEIA 3P71T 4G9EA 4QQRA 5CFZA 4X6LA 2D2XA 4J1TA 4U2FA 4PPNA 3WIVA 4HNTA 3LS2A 2IA5A 2ZIGA 3GWZA 1YMUA 3OQIB 4B3IA 5FBZA 3W79A 1U8CB 1E2PA 5B1YA 3DDCA 3CVJA 2R87A 2JFHA 2PUGA 1CD5A 1JJ7A 1I3KA 3Q11A 1PL0A 2GKSA 3F8WA 1OX6A 3QX9A 3CV3A 2QX9A 3FDJA 3JQAB 1IHPA 4KWEA 1Z28A 1W29A 2DX7A 4QRDA 3SYNA 2GSWA 2OWDA 1YKSA 3D8RA 3PRMA 3H9QA 3USCS 4TS9A 1CTQA 2M1ZA 5B3AA 3ROFA 3IALA 5FLYA 2C2MA 2WFAA 3O7WA 1IBCA 4HAOA 1UPBA 3OHSX 1TGVA 2FW9A 4RAOA 4GUAA 1FW6A 3IUTA 5EZ6B 2ONJA 4PZPA 3HUTA 4YAOA 3BWDD 2VT7A 1AKMA 4Y6PA 3PHIA 1EFTA 3H3FA 3KB2A 5GV8A 2BYTA 5KYNA 3AY6A 3MUEA 4BQQA 4RZSA 1SKUA 1RWQA 3K1YA 3S29A 821PA 5J23A 1P0MA 3IC5A 1Z7GA 4FYHA 1JT9A 4E4RA 1JSRA 3RYTC 1Z0KA 4DWJA 4EEXA 4J2HA 2WHXA 1FFDA 3NP7A 4LDRA 4DNXA 3K9BA 3GGPA 2WBFX 1MU0A 3PYMA 4I5IA 4EF5A 2H5JA 5ES4B 1I14A 1FDVA 2EWVA 5IULC 4M8KA 1Q1EA 3BMQB 4TZTA 2FR8A 5THKA 5J9FA 3FDIA 1V39A 1UPUA 2FUEA 3NH9A 4GWKA 1LW7A 1T3LA 2Y1WA 3KCNA 3D59A 3T3PB 2JFVA 4LF5B 1K7XB 2FFQA 2VZLA 3I9V1 1A9YA 1JNXX 1TM7E 2PH7A 4MB6A 4WX2B 5DNDA 5KQMA 3KJGA 1JZSA 1FSPA 3L49A 4JDPA 1MW8X 2WWXA 4P92A 4QOJA 1IHUA 3I5MA 2PT6A 4E1BA 4EA6A 1GNQA 1W94A 5I7SA 2Q1SA 4XQ0A 4R9NA 4YGYA 1PVVA 1LDYA 5H82A 5NULA 3O8OB 4CG3A 4BLRA 1O4VA 8AT1A 2Y1GA 3H2JA 4ZQBA 1AQJA 4W5QA 2FRAA 3H83A 4ATNA 3C8UA 1TJNA 1G8PA 5FO0A 1P5JA 2C95A 2EX1A 3NDPA 3QV2A 4JBNA 4GUDA 4KXLA 4M83A 3QELA 5ALJA 2KI5A 5K05A 3NR2A 1Q7TA 3IT3A 3LYUA 5TIIA 2QUJA 4EKIA 2JGEA 3HXPA 4KK4A 4UEWA 5AUQA 3GLFA 5JECA 5G0SA 3D31A 2HBYA 1ZOPA 1FFHA 1OJLA 1IWPB 4ZALA 2DZDA 1M0SA 4IDQA 4C21A 3STUA 5AJHA 2RGEA 1Y8RB 2BFEB 5HJ2A 1VSQA 5CIQA 3SXUB 3TOSA 5J94A 1WTAA 1U7PA 1MABB 3QLVC 3U3XA 3KZOA 2I4RA 1ZESA 3DH0A 3I76A 1S4MA 3R0IA 4OATA 1PWEA 4RHUA 3E3LA 4GMKA 4L9SA 1L5RA 1HLPA 4ZEOA 5A7GA 2FHPA 2W6JD 5KDDA 1V0JA 2YZMA 1LQ2A 2ZKLA 3AUUA 1P2SA 3EVGA 2HOQA 4NBTA 1UF9A 3KELA 3ACCA 5AXBA 3GYGA 3V7FA 3UV7A 1M8JA 3KKOA 2XOKD 5DLPA 1J0EA 1PGJA 3LUHA 1Z7EA 2QNRA 2QI9C 4HDQB 4OIMA 4Q3DA 3RG2A 3M9LA 3S2YA 1QHHB 2AR0A 2CLHB 4OA5A 5DCYA 1UBRS 3EASA 4OJQA 1JB1A 1RM5A 2C9ZA 2QQ0A 4D3DA 1E5LA 3UNXA 1QNFA 2IBMA 4I50B 4LEIA 2BUAA 1NQAO 5IAGA 1NF8A 1L5SA 4QJ4A 4AW9A 4IILA 4QUEA 4OL9A 2C4MA 1G0OA 2N1MA 4MHTA 1I3MA 2QL6A 1ZMBA 3K2BA 4WZ6A 3CURA 2PWPA 3C5WP 4M99A 4MJXA 3SIPA 5T3UA 2PQ6A 1OXKB 2FTDA 1RM3A 1UWCA 5LMNB 3GJYA 1SXIA 4S0XA 4TROA 4WLVA 4E5VA 2QT0A 3EZFA 3IBYA 3JQ9C 1L6RA 1QPBA 4KE7A 2VPTA 2ABWA 4AAYA 4MSXA 3T1HB 4JLOA 5H3CA 2AXNA 2RHMA 4QNNA 3E7FA 4QGGA 4D57A 1J8DA 1Z4MA 4MWGA 4XJSA 2I6UA 1ZHOA 5GPBA 1V7QA 4ESVA 2HTFA 2IP1A 3P96A 4HLUA 4G3XA 1R18A 4KQJA 3PXGA 5CFPA 1YU6A 1S0UA 4Y9SA 1PE0A 4HN2A 4LW8A 1U8YA 1UDRA 2WOOA 3B2QA 2OZKA 3G9ZA 3H9EO 2BEJA 4MPJA 4YB8A 3ID6C 7ADHA 1EVKA 3WK9A 4INPA 5DZSA 1T35A 1Y33E 1II8A 1N32B 1VFPA 3RVJA 2EBHX 4ZVUA 1M1YA 4Y9DA 1RYMA 1ONNA 5TVKA 4IOJA 3IEJA 3LDFA 4KMSA 4WNAA 2V98A 1GTJ1 1X14A 4E7OA 3DTVA 1H94A 2MDTA 1JA0A 5FBVB 1U65A 1W36C 5EVJA 1QVRA 3BF7A 1XZMA 2J9FA 1KEVA 1LBIA 5HXAA 1RAGA 2QR2A 1PZFA 2R6CA 3PI6A 3SDBA 5HUHA 1RC1A 2Q8NA 2ZB8A 3KVOA 4JR2A 1YS6A 3KYCB 1OWNA 4FQ8A 4N6GA 4TSRA 4O2AA 5I7RA 5CD1A 3CO0S 3JWJA 2JHAA 4G0XA 1PTJA 2XU5A 2E01A 1A88A 3EGCA 4CL8A 5IK2D 1JKXA 4O63O 5KUTA 2IVFA 3NTRA 1F2AA 3EW9A 4QXQA 1H85A 2QYOA 1P6QA 2Y9PB 4HZUB 4MR9B 3RKRA 3W5VA 1PBNA 2VPQA 4I08A 4JQCA 4C0SA 1X1AA 4F2GA 2C9BA 5IJZA 4HH4A 5BSMA 5AW0A 4IMRA 4Z8XA 3ODPA 4OMUA 1KKUA 3FTQA 3RAJA 4ZICA 3DE6X 1OMOA 2Q07A 3M1AA 4RULA 1ZN7A 2VSNA 3HSKA 2IW1A 1LQUA 1L4HA 2VJCA 3DKRA 5AJVB 2ZJZA 2V0NA 1TGYA 1L8AA 1NMZA 3A1NA 1ZUD1 3IXMA 1DMSA 3P97A 4FW8A 3BZBA 4W8GA 3RBVA 2ZE8A 4CIYA 3FSJX 2XOEA 4DQUA 1RWOA 3GAAA 5K3FA 5J4KA 2E6UX 3ANXA 5HF8A 3ZV3A 1AIMA 4QH6A 1LLCA 1WL8A 4JT9A 1SUCA 2W42A 2H1WA 4F3KA 1ZD5A 3E9SA 1M10A 4UBLA 1J90A 3KYDA 4QJ5A 1I30A 2ZT5A 4LVNA 1A8UA 4TTSA 1LDBA 1TO1E 4WFQA 4FDTA 3EIOA 3LQ1A 1T6XA 1DS6A 2FRDC 2J5BA 1PR4A 1GZDA 5L3VA 1SXQA 1LJUA 2ZTMA 4LXIA 3GCZA 1M8GA 5JWHA 1D9XA 2F3UA 3AV0B 4ZVOA 2IW3A 3F2VA 4EF6A 4UEOA 3WV5A 1X8JA 4AXLA 3ZWPA 4A2CA 2Z8XA 3EODA 3U17A 1K4MA 1RAFA 4AUMA 5CBPA 1KTIA 4O4IF 3GW8A 4J8PA 1M5UA 1INLA 1JMVA 2HMTA 1VIDA 3OE7A 5AM4A 1KI2A 1E96A 2HCRA 2G9QA 3OT4A 3F3KA 3DLTA 3OM9A 2YXBA 5ECYA 1WXWA 2J6HA 1HK7A 5BRNA 1RP1A 3LXXA 2PKYX 4CIBA 2RHRA 4HAYA 1SCUB 1HV8A 4D3ZA 3M81A 2FZ5A 2B6HA 3EDCA 1K86A 3GEDA 4FCVA 3S55A 3WLFA 1VIVA 4AMZA 1J2UA 1GHTA 1EX6A 5ANRB 2WW8A 3GG9A 3F0TA 4ZJYA 2QUAA 1E9AA 1PHRA 4J16A 4F6RA 1LRLA 1VRWA 1GA6A 4X1YA 4D4IA 2I2AA 5GOZA 3HJHA 3ZDQA 4L5IA 4WZAA 2AWNA 4DCJA 3JAKA 3HFGA 2KLHA 3QPAA 5EJ5A 3TEMA 1Q7EA 3EUEA 3GHYA 3GG2A 4DKJA 3OU6A 2YC2C 2JFZA 5BWNA 2WUFA 3H3JA 4TYWA 1H8HD 2ZB4A 2Y0PA 3EDMA 5HS6A 3RRJA 1VDMA 3EUFA 2OECA 4QJBA 1GAEO 5EXXA 1YRWA 3FMVA 2DFPA 1L1RA 3OUUA 1E79A 3D3QA 3QUCA 4H4CA 4TLLB 3W5JA 1F5SA 3HXLA 1YXMA 4WVLA 2MYTA 1WMAA 2ZAOA 4YQEA 1GPDG 4AY5A 3AI1A 2JJ8A 1N33B 1E6LA 1OSNA 1NXTA 1CJUC 1PSWA 1IZ7A 1F17A 2ASEA 2GFQA 4OLHA 4PIPA 5ARDA 3LXRA 4ZKDA 5JQGA 1ILEA 2ZM6B 2ZZNA 1NU8A 1CUIA 3F7MA 1OFHA 5TT1A 2PU7A 1PT9A 1WP4A 2VK4A 1ZGHA 4GGPA 2QN3A 5J5CA 3VRHA 3WNBA 4BZQA 1XTSA 4D8VA 5J4LA 3G9QA 4KFTA 5EJAA 4JGIA 3HB5X 3LJKA 1R5BA 4HYTA 3UW1A 4JOSA 3OM0A 1XZEA 4WFJA 1SGWA 1R5JA 3SLRA 4B3BA 3LI2A 2DLCX 2PQ0A 3Q15C 1A6RA 2ZETA 4B3JA 4KAFA 1T9DA 1UPXA 1UBUS 4JB2A 2R6JA 3MAAC 1E32A 3FVWA 4CN8A 3VR3D 1YT7A 3JASA 3JRNA 2YY5A 3OEYA 3ZNHA 5G41A 1IL0A 4MWCA 2KMLA 3LYLA 5DYYA 4QGHA 4A6DA 4CI0B 2PT7A 3R7NA 1H66A 1KA9H 3F8TA 1PLJA 4F7DA 4Y7CA 4TV8F 5I4BA 4WH0A 3R23A 2WYIA 4LC1A 3H19A 1CY6A 3PFNA 4U0JA 3PQDA 4BTLA 3C3CA 4IV8A 3S1AB 2YOFA 2XGGA 3KB8A 3QX8A 4YYQA 1UP6A 1X1QA 4Q3LA 4B80A 1A76A 1DARA 4LZAA 1CVLA 1KEEB 4X3CA 1L4NA 5AMXA 4L3VA 1STOA 3ORFA 4E5NA 3IUPA 1MIHA 2IE8A 4EUKA 3THYB 1GKYA 5DHFA 2YHAA 3SR0A 1KJWA 4LDQA 1Y5IA 2F3PA 3IBGA 4NK4A 4TSFA 5FL3A 5KTNA 2BHSA 3ELUA 3X1WA 4F2DA 1OWPA 1Z6AA 4OQDA 4WBNF 1XP8A 3SFTA 3M5PA 3HDHA 1KTVA 2D1RA 5KNBD 3EGDA 2AE1A 5E9AA 1FA9A 4YBRA 1XPRA 2XU3A 2FSVC 4O1IA 3AR8A 1XRSB 2AFIA 2VF5X 1GUBA 2FX2A 3BX1A 3JZMA 4B2PA 3L0DA 4HWPA 3F5VA 1KI6A 2PZ8A 2R0QC 5JEEA 2MYUA 4OVZB 4PYRA 3E4DA 4AXMA 4JJEA 1JFSA 1NYRA 3G89A 4UTXA 1M6EX 2HA6A 2CK3A 2RKBA 3GUVA 4MLZA 2W0MA 4KX3A 5REQA 4NS1A 1QRRA 3OCXA 3MORA 4YK7A 1UKYA 3PICA 3WXGA 4NJMB 5G0WA 3L8GA 2GEDA 3UJ9A 1K7FB 1WVIA 2VJQA 3LDAA 3L7BA 3LCRA 1TYZA 2C9YA 3PRKE 1HTWA 2F1HA 5CXXA 1WDTA 2O8CA 1U8FO 1Z5NA 1V9SA 3T95A 1KVRA 1E6MA 3KU1A 3QFRA 4D0NA 1Z0AA 1R4MA 2PGLA 1QSGA 2FDRA 3GP5A 3KC2A 4N54A 5KYXA 1H3EA 1QLJA 3FY4A 3EWAA 4D26A 1PVOA 1QKIA 1NMSA 2VJKA 1TK3A 3EXG2 1NP6A 2A33A 1JZTA 4OQPA 1V2GA 2WFMA 2F8TA 3DF0A 4CQLA 1X7YA 4DNOA 4TWZA 3NMUF 1JAYA 4POOA 5B1EA 2EKZA 2BM9A 2OB1A 2I6TA 3FI0A 3MJTA 4H7JA 2ZRLA 4LI3X 4OOEA 3C14C 4RL6A 4DG9A 2P7IA 2O50A 2QIOA 1DDOA 3LF1A 4O0MA 4IDGA 3OICA 2VK2A 2NOAA 1QGUA 5EZYB 1JQJC 4FFDA 5BQ5A 2P0AA 3JVUA 4TMFA 3AJ9A 1RHMA 4M7PA 3IUQA 1FYEA 4HN4B 1E1LA 4KRYA 1C9EA 2C7QA 1CZNA 1W93A 2VOJA 3ANMA 1WD5A 1UAAA 3FAZA 3UPUA 2XGMA 1DKUA 4U2CA 1E4VA 1NF3A 3RASA 3O38A 3VV3A 3ZQUA 5BNIA 5H83A 5AW6A 4ARCA 3HBJA 3H5RA 3IDQA 3WNZA 2C3UA 3O8QB 2D62A 5EJ4A 4ZAYA 4I81A 3C4JA 4YALA 2IEAA 3RS5A 4MKRA 3SKYA 3O94A 1ZOSA 2JGRA 4KWHA 4UNIA 3UMRA 2FG6C 4BPRA 1C3OA 4HNAA 3DE4X 3GZNA 4FKMA 4A16A 2BFFB 2BR4A 5JR3A 1Z6ZA 4M38A 5KWJA 3JY6A 3MINB 2Z98A 2P2NA 1XJ5A 4BU1A 5A1JA 4CLOA 4LX8A 5FLKA 4CLEA 4BMYA 1LZLA 4EPRA 2GVNA 4RX1A 3I5UA 2W2XA 2D5LA 5FOTA 3BAZA 2O1XA 2G7MC 3ZE7A 5L3QA 3P27A 1QOPB 3K15A 3H5NA 3HMKA 1E4OA 1S7CA 3FN4A 5JYCA 4IQGA 1OR8A 1OTYA 1VI5A 2AX3A 2IYPA 4NOKA 1R3DA 1XDGA 5B1HA 4D5GA 3NOXA 3NCHA 3OC0A 3WY9A 3GLFE 1A3CA 5CP8A 5DSZA 2IS1A 1QGAA 3DE3X 5BT8A 5B4UA 1JQDA 4R81A 3BTSA 4AF8A 4XYBA 1AXEA 2C3YA 2FX5A 2Z4RA 2O06A 3HU2A 1QFYA 2LGJA 3HDYA 3QTTA 4JUDX 1HG1A 1RQNA 1SKQA 3OQPA 5FO1A 5KSWB 5LUBA 3IJPA 2PAFA 3SBEA 3EPJA 3OVXA 4BDSA 1SOWA 3TGPA 1SBZA 1PPDA 2HV8A 3FNBA 2DCDA 4Z0PA 1CE8B 1U9CA 1IRIA 1ADCA 3A27A 2QU8A 2AQHA 3OF2A 1C8BA 2VA8A 3AKCA 1HFJA 3ETLA 1XZ8A 1XRPA 3HB4X 3LUBA 4J75A 4NCBA 3TSCA 2IY7A 1PTKA 3OBBA 2O2CA 4NBRA 1GPBA 1KC3A 1V5GA 2EX4A 1ZOLA 2K4MA 1A4RA 2OG2A 1QVWA 3E3OA 4QUIA 4XFDA 5U4QA 3SGLA 4X64B 1RXCA 2E4AA 4JA0A 4WOBA 2B36A 2AMYA 1L7EA 2YIVX 1UT5A 2EZ4A 2WHEA 2WHPB 4GEKA 2NIPA 3NBUA 9ATCA 2QAGB 1XAGA 2FF7A 2GT1A 3E5MA 3AR4A 4E32A 5CEEA 1HX7A 4AJEA 2C1EA 3KSAC 2CBXA 3N58A 3FTFA 4JMLA 3PVZA 4ESHA 3BPFA 3NHMA 3JWEA 1E3JA 2WRZA 2IHKA 4JHXA 1CDEA 1EP9A 3I9V6 5FQOA 3ZHUA 5DNYB 3CBQA 3EYWA 1P45A 3ZY2A 3V1LA 3L8HA 1G5TA 3KKUA 3GK3A 1V3VA 4NRDA 3A9TA 1AKNA 2OOSA 1C41A 1IY0A 2XIQA 1JFRA 3DDNA 3LU1A 1G3RA 4Q05A 3MCWA 5CUQA 3LCCA 2XGOA 1TW3A 2YWFA 4OAPA 4DSZA 1TTHA 4UM8B 5KSZA 4ZOLA 3BORA 1XNHA 3B7WA 1ZZEA 1SUBA 2Z8ZA 3DEFA 1UMBA 4NPAA 4YCBA 3Q12A 2VJAA 2XB4A 1ZW1A 4KNVA 2PMWB 2ZUSA 2OHGA 2NNLD 5EUQB 1BJRE 5EKSA 3N74A 3OPYB 3DB1A 2VT2A 4OHVA 1MHWA 1JEQA 2QV0A 5LYJA 1P4RA 4LKOA 4HVAA 5I9MA 3WYEA 5DNAA 3E4CA 3AUTA 3JR3A 3LFUA 5HK8A 4K8OA 2CMGA 4OHBA 4QX6A 4G63A 5E6JA 1V5EA 4MZSA 1XIVA 4C4RA 2X0RA 4ISCA 4Q4HB 1A7AA 1MDFA 1M1YE 3OQIA 5EIAA 3MLEA 1W9HA 2JJ1D 2BFMA 2ID9A 2LPMA 2J4DA 1TAGA 5JT1A 2YWEA 3LIPA 3KHTA 1Q7BA 4BEJA 4UEKA 4AG3A 3NJ8A 3SOPA 4IG4A 5IXYA 1BXKA 3PTLA 1QP7A 2Q1WA 1IEVA 3PJEA 1NB3A 1SPBS 1YZNA 1Y9EA 4DCSA 4P84A 4NYIQ 4OU5A 1D7OA 3KJQA 4BVLA 2AQ8A 4FOTA 1X9HA 3HGTA 3UGJA 1E9DA 1FRNA 1WXQA 4KFUA 3W1WA 5A5GA 1C0IA 4R0VA 4A2WA 3SC6A 4D3XA 5K0JA 1JDBB 1P1JA 3KL2A 3MRXA 1GVNB 5AYVA 2DPLA 2I5PO 3HWSA 3KSBC 1EVLA 1QBGA 3GUUA 2GHIA 4AXBA 1KSHA 1XBTA 1N6LA 2EW8A 1SXHA 5FV4A 3OIGA 4MV1A 1QOZA 4EO7A 3DG9A 4GBMA 3MQ4A 3GCWA 4PY2A 4REOA 1G64A 1LS1A 1NAIA 1B41A 4BLPA 5KNDD 2O1EA 4JB8A 4PZDA 4MQUA 3SYLA 3WK5A 1Y6QA 4GKKB 4ZDJA 1Y6ZA 4BOQA 2ADOA 1Z06A 2WYHA 3CLTD 4X7BA 5KQLA 4BPBA 3B60A 4UHHA 1QE3A 1D3AA 3CRQA 1M54A 5DTJA 1BKYA 4BB6A 3AVUA 1ECGA 1MAAA 2N0SA 2OGWA 4RJLA 1SG0A 1TF7A 1MENA 3LVBA 4BNJA 4DBLE 2ZROA 3BFKA 3BMQA 4JN6B 4RNCA 5EXPA 1U6KA 3GBPA 5ER6A 1MH1A 2L17A 2ZVPX 3CNBA 4HFMA 4EATA 5K0SA 3KTOA 4Z3DA 4F5YA 5JAMA 4Y98A 3VSDA 3DFMA 1XF1A 2I7XA 4MQLA 2C0QA 3MTVA 4J1SA 4J4TA 1WAMA 3H97A 4NQRA 3MMZA 4C4AA 4M54A 2C4TA 3KM0A 4FX2A 2VZEA 1Z5GA 4II3A 3ZDAA 3ZDXB 1O87A 5KOIA 1S1MA 3O8OA 4L16A 1ZSYA 5DW0A 4P6EA 2BZ1A 3COZA 3K4PA 4BRZA 2NPOA 3FNRA 2K87A 4P4NA 1FVFA 3SU8A 3H2IA 2JGIA 5T8KA 2YXDA 1OH5A 5L4LA 1JHVA 5JYEA 3NVMB 4FNAA 4MRRA 1A9PA 3HDQA 1N57A 2AYZA 3N3BC 3TH5A 3UKOA 1KWKA 4FI3F 3TSOA 1LPPA 4ER0A 1YVEI 3O03A 3Q7TA 4CMBA 5ARCA 4Z9YA 2IOHA 3IP1A 1I3NA 4A23A 3FTDA 1N92A 4ZT3A 3I5YA 1XZQA 4UHBA 4E2YA 3UCFA 2ZUVA 3D81A 2SBTA 1WUHS 1Z2CA 1Y8RA 2BFEA 1UBKS 3E53A 3SXUA 2Z6AA 4WZAE 4C2AA 4FZ3A 1MABA 4UPDA 1P0CA 4BO8A 3FGPA 3N6VA 1GPNA 2DETA 5GVRA 4G56A 4DSTA 4QLBA 1ZU5A 4YV2A 1L9KA 3EA0A 2WTMA 4BZZA 2QJFA 2IIPA 1BWQA 1C7ZA 1H6AA 1LBEA 4M7RA 3MRVA 2J48A 5DH9A 3VBEA 5HM6A 2FFHA 1RWXA 4R68A 2YJ6A 4G36A 3NATA 2FSFA 1K7CA 1X8XA 2O7QA 1U5AA 3ZZ1A 5KKCA 4BMVA 3MOGA 2HHJA 2XD9A 1SCNE 4KAXA 1W87A 1QHHA 3VMMA 1RLMA 2GDJA 5K3BA 4BBAA 1GMYA 4P54A 2ZWAA 1YACA 1R6XA 4NNJA 5GOTA 1S02A 4I50A 2BSAA 2W6MA 2R7MA 2WJJA 1HFKA 1G98A 3G0BA 3ZD8A 4AJLA 2P2ZA 1S5PA 1E3SA 1CDDA 1RM4A 2QAJA 4B81A 4L27A 4HI0E 1U7TA 4UDXX 2X58A 3FLEA 1F6WA 2O5VA 4MW2A 2PADA 1QIEA 3TLKA 3MHHA 2IPNA 4WD3A 3Q6MA 3HJAA 1G1MA 1ULSA 4IZOA 5F2KA 2ZRCA 3F3YA 5FPPA 5THQA 3AI2A 3M8KA 4ICIA 3WLSA 1EUQA 1AGPA 4YRTA 4JK3A 2QZJA 1Z3IX 5ENVA 1N75A 1W76A 2GEUA 4DGSA 2OV8A 2C7PA 2MSLA 3PF9A 2PWZA 2R2AA 3SG0A 1I6KA 4BMCA 4BKQA 3IJRA 3L0IB 1BEEA 4Q4LA 3Q41A 3LX5A 3REFA 1Z8DA 4XWWA 2WFLB 1O9HA 1A4XA 2WV7A 3OCJA 4B3CA 1Q22A 4DMUB 2QPTA 1JQEA 2OGUA 3UB4A 1MIOB 3UC9A 1MX9A 1ODFA 2A9PA 3OOYA 1FJ2A 2BKUA 4N39A 2UVPB 3DMTA 2VYND 3QUBA 2A92A 2WKPA 4OLJA 1POPA 3PDIA 3AVTA 1YR3A 1GLNA 1H0KA 1TJPB 5GAJA 2EJTA 1TECE 1W88B 2SECE 3HN6A 1SELA 5IM4A 4RD6A 5CDUA 2OUKA 3CKLA 3RM3A 4TWIA 4OK3A 3WKCA 2NT4A 4EIWA 4B85A 4GIBA 3X44A 3G7UA 4QOIA 4RKRA 4QHSA 4XVQA 1U7ZA 4O8CA 3PKJA 3ZY5A 2OM6A 3PLRA 1P0QA 4PEVA 1PUXA 1XZKA 2FZWA 4H0NA 4K8RB 2OA0A 4E4YA 3EXHB 4DV3B 1R12A 2AFIE 2ZAIA 3KYCA 1HYQA 4V02A 1OXXK 3WLEA 4K9QA 2ODEA 5AK5A 4Z3OA 1VPWA 1A50B 2IELA 3T0GA 3A3KA 4OHCA 4YRCA 2W11A 2OVBA 4WXMA 1Y1QA 5IAEA 1G9SA 1YZKA 4HZUA 4MR9A 3NDJA 3GVHA 4JWKA 2VC2B 4PPQA 3L7YA 4QATA 3U4DA 3T4XA 4Q7KA 1OFIA 1MO2A 1TCAA 3FMFA 4M8SA 4RUKA 1Z82A 1RT9A 1B93A 3TE7A 4N9WA 2PZBA 3TTTA 4IG9A 1RW4A 3KK0A 3PRPA 2V54A 3PUZA 1P7VA 4DDHA 2AUNA 2WKRA 3TS1A 4ZT7A 3W9YA 3K9HA 5ICSA 1B3BA 2WIBA 1RQXA 3QFTA 3HDGA 1W49A 1VM6A 1XAHA 2FA9A 2PXHA 3CX6A 1MG0A 3CUTA 3QE4A 4LJYA 2JCYA 4B3DA 2XGJA 4REZA 2ZRDA 1H2YA 2Y2VA 4EG1A 1B6GA 3DYBA 4MV3A 5HKKA 5IG2A 1GPYA 4ZUXU 4P80A 5BWMA 4N0MA 1QVZA 3WWEA 2JAHA 4IIBA 2B2XA 2Q5QA 4D4MA 3V2HA 4JI8B 5KSOA 2IPMA 4WXEA 1P7WA 3H8VA 4RDHA 5IN4A 3DXFA 4ALKA 2LKDA 4ALIA 4CG2A 3WO1A 1VB5A 1W4AA 4CKCA 5KREA 3Q9NA 2UV8A 5EWLB 3TZ6A 2JI6A 4HBZA 3DBHB 4BFSA 2DKNA 3L05A 4M1TA 3SHWA 1A5AB 1LD3A 2HRZA 4N8SA 1CEXA 4KQ9A 5B6IA 1EP2B 2FPSA 4Q7QA 3M70A 1IRXA 3EMKA 3S8MA 1XP5A 1ZFNA 1NJSA 2LP4Y 4QXAA 4KB5A 3L6CA 2A94A 3T9BA 2V6MA 4U1RA 1KMQA 4W7HA 4G1FA 4PNEA 1RWKA 1UEXC 2PBRA 4WLFA 221PA 4FMDB 3ZZMA 3DBIA 5CH5A 2YV4A 1F3LA 4ER3A 4NC9A 2NACA 2PKXA 2WI8A 1BEZA 2XRMA 5I7AA 3O3MB 1SCUA 4I9NA 2EQ5A 3WSVA 4DQKA 2CXOA 2PX2A 2OZPA 2PH1A 3MCTA 5LIPA 2H4JA 2RI6A 1Q1NA 4E13A 5HWSA 2AXEA 3JYHA 4PGFA 4ER7A 4PCVA 1ESDA 4E6PA 3IESA 2IPLA 1GSHA 5CM9C 3B9PA 1EWLA 2XDYA 3AIKA 3X1JA 3ETDA 1YS9A 2VH2A 2QZSA 3WGQA 4U3JB 3INTA 2IY8A 5EXDA 4LYFA 4N5HX 4B0PA 2RDMA 3V8NA 4YCSA 3V7UA 2Q0SA 2OFFA 3FSGD 2ZJ4A 2SHKA 2H1OA 1EDBA 1DUVG 2O19A 4Y2RA 2PG3A 3QPDA 1TIPA 1J24A 4R2MA 1E98A 1RQGA 4JMPA 4ALNA 3PS9A 3QP9A 3BRQA 1XMPA 4XM0A 3OPQA 3OX1A 5HDQA 3NEYA 3PUIA 3RS4A 3SVLA 4TZ6A 1X8LA 2EYUA 3USVA 3BT7A 1W0JD 3AW8A 1U0TA 2XVZA 4NAHA 4B2IA 1U9ZA 1EXWA 1KAQA 3TWOA 2JZOA 4D4LA 5JZVA 1E2FA 1V1MA 2CHVA 1AIPA 4HGNA 2G72A 1Z3CA 2JIQA 2WA1A 3TW4A 1PNTA 3RC1A 1Y89A 1DDIA 1GFZA 2VYCA 4H1HA 1LLQA 2X6QA 4MRSA 2F2TA 5LDGA 3M89A 5KC8A 4L8LA 3URKA 4MVJF 3HEAA 4LFBB 2PZGA 4NV1A 2IUFA 3AILA 4B4DA 4DR4B 5L7YA 1UZUA 1T0PA 4A0RA 2HM7A 3DUWA 2GFOA 5C32A 1PEDA 3RHFA 1AHPA 1TQ8A 4PINA 3A3OA 1N6NA 4HXGA 1WSBA 4HUJA 3VYRB 4R84A 1P1IA 1BC5A 2BGMA 1IN5A 3KZKA 1L7BA 2JFGA 3UBTA 2GCOB 3TQSA 5JJIA 2AU1A 2ZBVA 1UOEA 1DBQA 5TQ2B 5BO5A 4GDMA 1KKMA 4MB2A 4DCUA 4NXNB 2NXWA 3UAOA 4MUNA 4E46A 2DSTA 3NO4A 4MDFA 1G291 3S1AA 3WGVA 3I1FA 4X8OA 4IYJA 3TDKA 5JYDA 1YI0A 2K2QB 1KEEA 3AVWA 3LA6A 4LDJA 4YWHA 1MDWA 4H7PA 2F1GA 3F6YA 1FMTA 1FPMA 2R7AA 2O9JA 4Q9NA 1Q74A 2L2QA 5DNUA 2IT1A 5BQPA 3THYA 4BL5A 4GNRA 4IDNA 2VKTA 2XNSA 2P2GA 4G0PA 3H2YA 3HJTA 3K1ZA 4M8IA 4X24A 2ZB2A 3VO8A 1IAQA 3VR2D 4C3VA 4P33A 2P3SA 4TTIA 4CM9A 4CTNA 3C0KA 3E2IA 4LX0A 4I99A 4L50A 3ZWXA 1W25A 4QA9A 5GJVC 4KIFA 1ORWA 3AH8A 2C84A 4HEA1 1Y4HA 4RV5A 2RG7A 1DAKA 1YALA 4Q1FA 2R1UA 4OVZA 1Z5OA 5D5HA 4RGBA 3U6BA 2JLSA 3BTOA 5TMPA 1P3JA 2WWYA 2N46A 5E0OA 2ZPAA 1MUUA 1GQ2A 2O8FB 3AUAA 2IPAB 2SNIE 2X9GA 4G1BA 4IV5A 3G8BA 4NJMA 1RJFA 1LVUA 3OZRA 4ZAGA 1JGTA 1WWKA 2FEMA 4BLOA 5LLDA 2ZYSA 4OGKA 3PFBA 1COWD 3CRVA 5E4FA 3SQOA 4XIGS 3A58B 4YMIA 2QRMA 3ZZTA 2WPDD 3PNLA 5BSGA 3KZNA 4KX5A 3R1IA 2PCLA 3R20A 2DPMA 3O2SB 1RZUA 9LDTA 3BOSA 4KIGA 4JUIA 3SEQA 3T35A 2R6DA 2B3DA 4DV2B 3IPCA 1E7YA 1TKCA 1ADGA 1GYRA 3EQ6A 4UNRA 3WOHA 1N6RA 3I2KA 2B78A 1UBCA 3K0AB 3QFCA 5GGYA 4AF7A 3PQCA 1AUXA 3TB6A 5IVDA 1G63A 1O0CA 1NSFA 1QX3A 2PMKA 2WG2A 5J1TB 1H4SA 4ZEVA 1A95A 3U4MA 1QTIA 2YR0A 4ZCQA 4YP5A 2N47A 5THXA 2WJ3A 4CV2A 3OSZA 3EIQA 5EZYA 4HOYA 2BTEA 2YZNA 5B6PA 3LG2A 2F64A 4HH0A 4BNWA 3CE6A 4BZWA 4MW0A 5JCJD 3HZRA 4Q3BA 3OQCA 1JDBC 4JLUA 1JR3D 3OG9A 5AHWA 2O0JA 2ZUDA 5J5AA 4YUWA 4YEDA 2CDBA 2J3EA 1TCUA 2DT8A 3A6KA 3C6XA 4QZVA 2E1RA 1AZLA 3OOHA 1HLFA 4U2EA 3R77A 4GGOA 1YC2A 1U94A 3EWNA 3O8QA 1VCNA 4GKAA 4L0CA 3C6MA 1K3FA 4DLAA 4EGQA 4YV7A 1YR8A 4XPIB 2ANBA 2DKOA 2O2IA 2QTGA 1CB5A 4ZREA 3ZS9A 5D3QA 1P2FA 4YJ2F 1ZK0A 2Q2VA 5DTRA 1QVVA 1PW5A 2ET6A 4PC7A 3S8EA 5TARA 1OIWA 2WG1A 2BFFA 1G1AA 3I9MA 4N0EA 4U7HA 4DMHA 4N3CA 1VL8A 4JS0A 3MINA 5F52A 4UU1A 4ZVVA 4BUJA 2CFSA 4FFRA 4GWGA 1NUSA 1IJKA 1KQGA 2EW2A 3OPYI 2AEFA 3JYNA 2CUTA 3ZS8A 5B7GA 4KBFA 1F0NA 3VR5H 1QCYA 3GLSA 4PGHA 2BJWA 2GA8A 2ZRPA 1Y4AE 4J91A 4UOQA 1D2NA 4WOKA 2XMPA 5A4JA 1U9IC 3UMSA 2AOVA 2G80A 5CFQA 1SR8A 3OETA 4ITUA 2DC9A 4MAFA 4TTTS 3BXFA 5E3JA 3VR6D 1KVSA 3IL2A 2Z2KA 2X8LA 4UZSA 5B4TA 3NPAA 1VYTA 4BKOA 3GUCA 3BYZA 1KWGA 1GPMA 3BCUA 3H05A 2UYHA 2DUMA 5LD2B 3VNUA 4EW2A 3QX7A 1CR1A 4P5PA 3WXBA 3EC2A 5B3LA 1GQSA 2VUSA 5DIFA 1GPJA 1W5EA 4RHXA 1FDUA 1QK5A 2PLNA 5GM1A 5AXAA 1PG5A 4EL0A 3EZ7A 2PRZA 1XTPA 5FHRA 1A8SA 2Y1FA 3F6SA 2WD8A 1MFZA 1YZFA 1CE8A 1GGJA 4Y6LA 2A57A 2IDJA 2FSGA 5SYMA 3OZXA 4NFYA 3REQB 4MI1A 1YK8A 2M32A 1Z0ZA 3G59A 3NX4A 3QW4B 4LGMA 4O0LA 1RBMA 3V6MA 4BV2A 3M6AA 3AYZB 6PFKA 1C5KA 1EB8A 1IXKA 2P6UA 4MW4A 1QFXA 3MRSA 3X2FA 1TZJA 1WMFA 3TTSA 3WBKA 1ADFA 1EVEA 2NO9A 2Q9AA 2QN7A 2YRFA 4B6JA 3QU2A 2WHPA 4KU4A 1MHPA 3UGQA 2GFHA 2QAGA 3P9NA 5AM2A 2QSJA 3P7MA 1CVIA 1RNLA 3E9RA 1N6OA 1JIQA 2HQSA 5AWFC 1ZITA 1F2CA 3L8CA 1VSTA 1ML4A 2L42A 2O6LA 3H8SA 4GPTA 4JD5A 4QQ8A 3SYRA 5KYKA 4Y0NA 2CDAA 4MA4A 1XWFA 1KZGB 3AESA 4N3GA 4XR7A 4KO3S 4N0PA 4YYEA 4CEIB 1DBIA 4K87A 4PN7A 3ZGYA 2R4QA 1Z74A 3A4NA 3H8JA 4LV6A 2ZSIA 1BVRA 1JU4A 4OHOA 3M2PA 4BVJA 1SBHA 4PQEA 1I6WA 2WWHA 3FVQA 4X85A 4DYHA 2IEBA 5LKAA 3QSGA 2IV7A 1QX4A 4HEJA 4XIYA 4LJ7A 2B34A 2DP4E 5TGZA 3LKZA 1LPMA 5TC4A 1RLOA 4MV9A 1UT6A 1T5BA 3IIEA 4R01A 1IDN1 1KBOA 1RKVA 2FQXA 2R6HA 2V4ZA 3AR7A 2JG3A 2CEAA 5FEMA 4L7QA 4ND6A 1ZLYA 4E15A 5EA2A 4LOHA 1H5NA 4EI8A 5AJYA 2C1ZA 5DXFA 1NLUA 3OPYA 5IBRA 3E48A 1JLHA 1ZNXA 4A10A 2GPNA 3COPA 3WAGA 4EB8A 4MKZA 1Y1PA 2B7CA 3KQWA 1PFYA 2JCSA 1VIYA 3F5FA 4Z7NB 1G9XA 1JYEA 4DR1B 4HMPA 4ZZ2A 4Q4HA 4M0UA 4MJLA 2H4YA 1QG2A 2OR3A 1KH2A 2PJDA 3ECSA 2HA3A 1YJQA 2GPBA 2D54A 4M0LA 1JAHA 2CGEA 2FMFA 1FFBA 1NTRA 2TS1A 3AO0B 4KP7A 4FTWA 3WYBA 1ZUWA 4NCJA 2RBGA 3NWEA 2ZSEA 4QU5A 4FHFA 4WSOA 3KEQA 3BWXA 3CR8A 2WUEA 1CSBB 3FWKA 1KDOA 1TEXA 5H80A 3P20A 3AR5A 1NE7A 1EJ6A 2EJBA 1ZIOA 4JROA 2ZSDA 4UU0A 2XR1A 4WA8A 3ETNA 3WMFA 1IDOA 1CR4A 1T0BA 1X2BA 2WKWA 2XUFA 4U5QA 5DJ5A 5IT9A 4Q9JA 1P7YA 1CFZA 2XIJA 3ISJA 5ICGA 4ALLA 2B1IA 4UDOA 1F38A 1NVMB 4A8JB 4AC9A 1DO0A 4JI6B 1G8FA 2OO3A 1QG4A 4R9SA 8PCHA 5BNWA 4IKEA 4PZ9A 4GOLD 4CGYA 5IS2A 4QG3A 2Y92A 4RCZA 2ID4A 3BL6A 3LY8A 3N2LA 1O57A 2J5XA 3K96A 3FROA 4JLKA 4E5UA 3IUJA 4Y6QA 3WHIA 4BQOA 1MO4A 1UBNA 1YBFA 4B83A 2H51A 4JQOA 3X1ZA 4Y0AA 1LF0A 1M1XB 3UJHA 1FE8A