3I06A

Crystal structure of cruzain covalently bound to a purine nitrile
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
214
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Identification and optimization of inhibitors of trypanosomal cysteine proteases: cruzain, rhodesain, and TbCatB.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 71
structure length 214
sequence length 215
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3i06A00
1SP4B 1THEA 3CH3X 2E02A 3NHEA 1CTEA 1CS8A 3O0UA 1TU6A 7PCKA 3H8CA 3QSDA 1XKGA 3BWKA 2HD5A 3M99A 3I3TA 3OVZA 1A6RA 4CDCB 5J94A 3BPMA 3KWBX 2DCCA 2HH5A 2AS8A 1ME4A 5EGWA 3CBKA 1VSNA 2HHNA 2G8EA 2DCAA 3LXSA 3RVVA 1GMYA 1CSBB 4AXLA 1QOLA 3I06A 2FYEA 5JA7A 4ZUXU 2B1MA 4CDDB 2DC7A 2BDZA 2R9MA 1AECA 3PW3A 1GECE 1NB3A 3WXEA 3F75A 4BQVA 4N4ZA 4PI3A 3CBJA 3TNXA 3PDFA 2DCBA 2C0YA 4P6EA 3BPFA 1SNKA 2DJFB 9PAPA 4K7CA 2DZYA 3OISA 3HWNA 1IWDA 1QMYA 1DF0A 2VHSA 2G7YA 2VHFA 1S4VA 2FT2A 2OP3A 3IUTA 2ARYA 2DJGB 2YJBA 1AYWA 4QRGA 2DZZA 3KW9A 2P0RA 2B1NA 1ITOA 5CVNB 1NL6A 1PBHA 3H7DA 5CVOB 3K9MA 4CDFB 4PP2E 2XU1A 3OVXA 2XU3A 1BP4A 1STFE 4I07A 2WBFX 2FRQA 4YV8A 5CHVA 4W5CA 1U9QX 1YT7A 1KHQA 3E1ZB 1MEGA 3MHSA 3AI8A 3OF9A 1U9XA 1KHPA 1PE6A 4QRVA 2BDLA 4N79A 3WXGA 4G54A 3H8BA 4QBBA 1PPNA 2CB5A 3LFYA 2FTDA 4RY2A 4W5BA 3B79A 4DMYA 4FIPA 2H7JA 2AVWA 2F7DA 1CB5A 3F5VA 1F2CA 3IEJA 1EF7A 1Y08A 1Y4HA 3ERVA 2CIOA 3D6SA 3N4CA 3V6EA 2OZ2A 2O6XA 2R9OA 3PNRA 2YJ2A 2AYOA 1DEUA 2AYNA 1EWLA 3PBHA 5EF4A 1MIRA 1CJLA 1MDWA 8PCHA 4Q8GA 1AU2A 3V6CA 3IV2A 2NQGA 5CHTA 1AIMA 1AU0A 1CV8A 5F02A 3OF8A 1MS6A 1AU3A 1YK7A 1ICFA 2NQDB 1JQPA 3CH2X 1YVBA 4N8WA 3DF0A 3RVXA 2IBIA 4W4UA 1F2BA 3H89A 3U8EA 5PADA 3HHIA 4X6JA 1FH0A 2FO5A 3HD3A 3QJ3A 1ATKA 2P86A 4YYRA 4CZWA 5FPWA 2GHUA 4MSXA 3K24A 4MZSA 4OEMA 5A24A 1NB5A 2E00A 3WXFA 1ZCMA 3ZUAA 2R6NA 2E01A 3GCBA 1PPPA 4X6HA 2G6DA 2PADA 1YALA 4YYQA 4YYUA 3O1GA 4OELA 2HXZA 1U5IA 1ME3A 5CVMA 1TL9A 1F2AA 4X6IA 1U9WA 3KWZA 3KKUA 1NLJA 3IOQA 5JH3A 4MZOA 1MEMA 2FQ9A 4BSQA 4PP1A 1PPDA 1Q6KA 2R9CA 1AYVA 4AXMA 4YYVA 3MORA 1QXPA 4BS6A 6PADA 1CPJA 2G8JA 1PPOA 3N3GA 4FJCA 1PADA 3BOWA 2E03A 1GCBA 3BCNA 2DCDA 1NQCA 3QT4A 2Y5BA 1QDQA 1U9VA 1BGOA 4XR7A 3N3KA 2PREA 2XU5A 2OULA 2DC8A 1VJVA 2ACTA 4P6GA 2AUZA 2GFOA 3IMAA 4Q8HA 2JQGR 1ZIVA 2Y6EA 4PADA 4CDEB 1CVZA 1GLOA 2DC6A 4YYSA 3RVWA 4BPVA 3IHPA 1BQIA 2P7UA 3C9EA 2AU1A 2AUXA 2YJCA 3KFQA 1O0EA 3KSEA 2YJ8A 4YVAA 1PIPA 1YK8A 1M6DA 2NQAA 2XU4A 1MHWA 2F1GA 5K16A 1PXVA 2AIMA 2PNSA 4BS5A 4HWYA 1CQDA 1EWOA 1TLOA 1EWMA 3MHHA 3P5UA 3S3RA 3USVA 2R9NA 3H6SA 3P5XA 2PBHA 4XUIA 2JQFR 2FRAA 1KFUL 1K3BB 4FK5A 1NPZA 1X9YA 1PCIA 3P5VA 2YJ9A 4KLBA 2NQIA 2ATOA 1AYUA 3P5WA 3HHAA 4WA6A 2R9FA 1F29A 3KX1A 4I04A 2DC9A 4YYWA 1AU4A 4QRXA 3BC3A 1KFXL 1KXRA 4QH6A 2FUDA 3S3QA 3MTNA 1POPA 1BY8A 4I05A 4DMXA 2IPPB 3K8UA 1EWPA 1HUCB
chains in the Genus database with same CATH superfamily
1SP4B 1THEA 3CH3X 2E02A 2UZJA 3MP2A 3NHEA 3PHWA 1CTEA 3BBAA 1CS8A 3O0UA 2Z84A 1TU6A 7PCKA 3H8CA 3QSDA 1XKGA 4BOSA 3BWKA 2HD5A 3M99A 3I3TA 3OVZA 1A6RA 4CDCB 5J94A 3BPMA 3KWBX 2DCCA 2HH5A 2AS8A 1ME4A 5EGWA 3CBKA 1VSNA 2HHNA 3B21A 3W30A 2G8EA 2DCAA 3LXSA 3RVVA 1GMYA 1CSBB 4BOQA 4AXLA 1QOLA 3I06A 2FYEA 5JA7A 4ZUXU 2B1MA 4GUAA 4CDDB 2DC7A 2BDZA 2R9MA 1AECA 3PW3A 1GECE 1NB3A 3WXEA 3E9SA 3F75A 4BQVA 4N4ZA 4PI3A 3CBJA 3TNXA 3PDFA 2DCBA 4RKXA 2C0YA 4P6EA 3BPFA 1SNKA 2DJFB 2BTWB 9PAPA 4K7CA 2DZYA 3OISA 3HWNA 1IWDA 4D8EA 1QMYA 1DF0A 2VHSA 2G7YA 2VHFA 2BTWA 1S4VA 2FT2A 2OP3A 3IUTA 2ARYA 2DJGB 2YJBA 1AYWA 4QRGA 2DZZA 3KW9A 2P0RA 2B1NA 1ITOA 5CVNB 1NL6A 1PBHA 3H7DA 5CVOB 3K9MA 4CDFB 4PP2E 2XU1A 3OVXA 4MM3B 2XU3A 1BP4A 1STFE 4I07A 2WBFX 2FRQA 4YV8A 5CHVA 4W5CA 1U9QX 1YT7A 1KHQA 3E1ZB 1MEGA 3MHSA 3AI8A 5JZEA 3OF9A 1U9XA 1KHPA 1PE6A 4QRVA 2BDLA 4N79A 3WXGA 4G54A 2J7QC 3H8BA 4QBBA 1PPNA 2CB5A 5E6JA 2J7QA 3LFYA 2FTDA 4RY2A 2JTCA 4W5BA 3B79A 4DMYA 3MJ5A 3IFUA 4FIPA 2H7JA 2AVWA 2F7DA 1CB5A 2JRIA 3F5VA 1F2CA 3W31A 3IEJA 1EF7A 1Y08A 1Y4HA 3ERVA 4M0WA 2CIOA 4ZTBA 3D6SA 3N4CA 3PT2A 3V6EA 2OZ2A 2O6XA 2R9OA 3TRKA 4RNAA 3PNRA 2YJ2A 2AYOA 2FE8A 1DEUA 2AYNA 1EWLA 3PBHA 5EF4A 1MIRA 1CJLA 1MDWA 4D8BA 8PCHA 4Q8GA 1AU2A 3V6CA 4IUMA 3MTVA 5EZQA 3IV2A 2NQGA 5CHTA 1AIMA 1AU0A 1CV8A 5F02A 3OF8A 1MS6A 1AU3A 1YK7A 1ICFA 3TMPA 2NQDB 1JQPA 3CH2X 1YVBA 4N8WA 3DF0A 3RVXA 2IBIA 3PSEA 4W4UA 1F2BA 1PVJA 3H89A 4MI7A 3U8EA 5PADA 3HHIA 4X6JA 1FH0A 2FO5A 3HD3A 3QJ3A 1ATKA 2P86A 4YYRA 4CZWA 5FPWA 2GHUA 4MSXA 4RF1A 3K24A 4WURA 4MZSA 4OEMA 5A24A 1NB5A 2E00A 3WXFA 1ZCMA 3ZUAA 2R6NA 3PRMA 2E01A 3GCBA 1PPPA 4X6HA 2G6DA 2PADA 1YALA 3PHXA 4YYQA 4YYUA 3O1GA 4OELA 2HXZA 1U5IA 1ME3A 5CVMA 1TL9A 1F2AA 4X6IA 1U9WA 3KWZA 3KKUA 5KO3A 1NLJA 3IOQA 4R3DA 5JH3A 4D8IA 1DKIA 4MZOA 1MEMA 2FQ9A 4BSQA 4PP1A 1PPDA 4PT5A 1Q6KA 2R9CA 1AYVA 3PRPA 4IP3A 4AXMA 4A5UA 4YYVA 3MORA 3C0RA 1QXPA 4BS6A 6PADA 1CPJA 2G8JA 1PPOA 3N3GA 4FJCA 1PADA 3BOWA 2E03A 3ZNHA 1GCBA 3BCNA 2DCDA 1NQCA 1YZBA 2BU3A 3QT4A 2Y5BA 1QDQA 1U9VA 1BGOA 4XR7A 3N3KA 2PREA 1UKFA 2XU5A 4OW0A 2OULA 2DC8A 1VJVA 2ACTA 4P6GA 2AUZA 2GFOA 3IMAA 4Q8HA 2JQGR 1ZIVA 2Y6EA 4PADA 4CDEB 1CVZA 1GLOA 3RNVA 2DC6A 4YYSA 3RVWA 4BPVA 3BB7A 3IHPA 1BQIA 2P7UA 3C9EA 2AU1A 2AUXA 2YJCA 3KFQA 4HXDB 1O0EA 2HWKA 3KSEA 4OVZB 2YJ8A 3OQCA 2DOSA 4REZA 4YVAA 4XZXA 1PIPA 4BOUA 1YK8A 1M6DA 2NQAA 2XU4A 4BOZA 1MHWA 4OVZA 2F1GA 5K16A 4BOPA 1PXVA 2AIMA 2PNSA 4RF0A 4BS5A 4HWYA 1CQDA 1EWOA 1TLOA 1EWMA 3MHHA 3P5UA 3S3RA 3USVA 2R9NA 3H6SA 3P5XA 2PBHA 4XUIA 2JQFR 2FRAA 1KFUL 3O65A 1K3BB 4FK5A 4P16A 5EZSA 1NPZA 1X9YA 1PCIA 3P5VA 2YJ9A 4KLBA 2NQIA 2ATOA 1AYUA 3P5WA 3HHAA 4WA6A 2R9FA 1F29A 3KX1A 4I04A 2DC9A 4YYWA 1AU4A 2AGAA 4QRXA 3BC3A 1KFXL 3BY4A 1KXRA 4QH6A 2FUDA 3S3QA 3MTNA 1POPA 1BY8A 4I05A 4DMXA 2IPPB 3K8UA 1EWPA 1HUCB 3PHUA
chains in the Genus database with same CATH topology
1SP4B 1THEA 3CH3X 2E02A 3NHEA 1CTEA 1CS8A 3O0UA 1TU6A 4GUZA 7PCKA 3H8CA 3QSDA 1XKGA 3BWKA 2HD5A 3M99A 3I3TA 3OVZA 1A6RA 4CDCB 5J94A 3BPMA 3KWBX 2DCCA 2HH5A 2AS8A 1ME4A 5EGWA 3CBKA 1VSNA 2HHNA 2G8EA 2DCAA 3LXSA 3RVVA 1GMYA 1CSBB 4AXLA 1QOLA 3I06A 2FYEA 5JA7A 4ZUXU 2B1MA 4CDDB 2DC7A 2BDZA 2R9MA 1AECA 3PW3A 1GECE 1NB3A 3WXEA 3LTWA 3F75A 4BQVA 4N4ZA 4PI3A 3CBJA 3TNXA 3PDFA 2DCBA 2C0YA 4P6EA 3BPFA 1SNKA 1W6FA 2DJFB 9PAPA 4K7CA 2DZYA 1E2TA 3OISA 3HWNA 1IWDA 1QMYA 1DF0A 2VHSA 2G7YA 2VHFA 1S4VA 2FT2A 2OP3A 3IUTA 2ARYA 2DJGB 2YJBA 1AYWA 4QRGA 2DZZA 3KW9A 2P0RA 2B1NA 1ITOA 5CVNB 1NL6A 1PBHA 3H7DA 5CVOB 3K9MA 4CDFB 4PP2E 2XU1A 3OVXA 2XU3A 1BP4A 1STFE 4I07A 2WBFX 2FRQA 4YV8A 5CHVA 4W5CA 1U9QX 1YT7A 1KHQA 3E1ZB 1MEGA 3MHSA 3AI8A 3OF9A 1U9XA 1KHPA 1PE6A 4QRVA 2BDLA 4BGFA 4N79A 3WXGA 4G54A 3H8BA 4QBBA 1PPNA 2CB5A 3LFYA 2FTDA 4RY2A 4W5BA 3B79A 4DMYA 4FIPA 2H7JA 2AVWA 2F7DA 1CB5A 3F5VA 1F2CA 3IEJA 1EF7A 1Y08A 1Y4HA 3ERVA 2CIOA 3D6SA 3N4CA 3V6EA 2OZ2A 2O6XA 2R9OA 4NV7A 3PNRA 2YJ2A 2AYOA 1DEUA 2AYNA 1EWLA 4C5PA 3PBHA 5EF4A 1MIRA 2VFBA 1CJLA 1MDWA 8PCHA 4Q8GA 1AU2A 3V6CA 3D9WA 4NV8A 3IV2A 2NQGA 5CHTA 1AIMA 1AU0A 1CV8A 5F02A 3OF8A 1MS6A 1AU3A 4B55A 1W5RA 2BSZA 1YK7A 1ICFA 2NQDB 1JQPA 3CH2X 1YVBA 4N8WA 3DF0A 3RVXA 2IBIA 4W4UA 1F2BA 3H89A 3U8EA 1W4TA 5PADA 3HHIA 4X6JA 1FH0A 2FO5A 2VFCA 3HD3A 3QJ3A 1ATKA 2P86A 4YYRA 4CZWA 5FPWA 2GHUA 4MSXA 3K24A 4MZSA 4OEMA 5A24A 1NB5A 2E00A 3WXFA 1ZCMA 3ZUAA 2R6NA 2E01A 3GCBA 1PPPA 4X6HA 2G6DA 2PADA 1YALA 4YYQA 4YYUA 3O1GA 4OELA 2HXZA 1U5IA 1ME3A 5CVMA 1TL9A 1F2AA 4X6IA 1U9WA 3KWZA 3KKUA 1NLJA 3IOQA 5JH3A 4MZOA 1MEMA 2FQ9A 4BSQA 4PP1A 1PPDA 1Q6KA 2R9CA 1AYVA 4AXMA 4YYVA 3MORA 1QXPA 4BS6A 6PADA 1CPJA 2G8JA 1PPOA 3N3GA 4FJCA 1PADA 3BOWA 2E03A 1GCBA 3BCNA 2DCDA 1NQCA 3QT4A 2Y5BA 1QDQA 1U9VA 1BGOA 4XR7A 3N3KA 2PREA 2XU5A 2OULA 2DC8A 1VJVA 2ACTA 4P6GA 2AUZA 2GFOA 3IMAA 4Q8HA 2JQGR 1ZIVA 2Y6EA 4PADA 4CDEB 1CVZA 1GLOA 2DC6A 4YYSA 3RVWA 4BPVA 3IHPA 1BQIA 2P7UA 3C9EA 2AU1A 2AUXA 2YJCA 3KFQA 1O0EA 3KSEA 2YJ8A 4YVAA 1PIPA 1YK8A 1M6DA 2NQAA 2XU4A 1MHWA 2F1GA 5K16A 1PXVA 2AIMA 2PNSA 4BS5A 4HWYA 1CQDA 1EWOA 1TLOA 1EWMA 3MHHA 3P5UA 3S3RA 3USVA 2R9NA 3H6SA 3P5XA 2PBHA 4XUIA 2JQFR 2FRAA 1KFUL 1K3BB 4FK5A 1NPZA 1X9YA 1PCIA 3P5VA 2YJ9A 4KLBA 2NQIA 2ATOA 1AYUA 3P5WA 3HHAA 4WA6A 2R9FA 1F29A 3KX1A 4I04A 2DC9A 4YYWA 1AU4A 4QRXA 3BC3A 1KFXL 1KXRA 4QH6A 2FUDA 1GX3A 3S3QA 3MTNA 1POPA 1BY8A 4I05A 4DMXA 2IPPB 3K8UA 1EWPA 1HUCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SP4 B;  1THE A;  3CH3 X;  2E02 A;  3NHE A;  1CTE A;  1CS8 A;  3O0U A;  1TU6 A;  7PCK A;  3H8C A;  3QSD A;  1XKG A;  3BWK A;  2HD5 A;  3M99 A;  3I3T A;  3OVZ A;  1A6R A;  4CDC B;  5J94 A;  3BPM A;  3KWB X;  2DCC A;  2HH5 A;  2AS8 A;  1ME4 A;  5EGW A;  3CBK A;  1VSN A;  2HHN A;  2G8E A;  2DCA A;  3LXS A;  3RVV A;  1GMY A;  1CSB B;  4AXL A;  1QOL A;  3I06 A;  2FYE A;  5JA7 A;  4ZUX U;  2B1M A;  4CDD B;  2DC7 A;  2BDZ A;  2R9M A;  1AEC A;  3PW3 A;  1GEC E;  1NB3 A;  3WXE A;  3F75 A;  4BQV A;  4N4Z A;  4PI3 A;  3CBJ A;  3TNX A;  3PDF A;  2DCB A;  2C0Y A;  4P6E A;  3BPF A;  1SNK A;  2DJF B;  9PAP A;  4K7C A;  2DZY A;  3OIS A;  3HWN A;  1IWD A;  1QMY A;  1DF0 A;  2VHS A;  2G7Y A;  2VHF A;  1S4V A;  2FT2 A;  2OP3 A;  3IUT A;  2ARY A;  2DJG B;  2YJB A;  1AYW A;  4QRG A;  2DZZ A;  3KW9 A;  2P0R A;  2B1N A;  1ITO A;  5CVN B;  1NL6 A;  1PBH A;  3H7D A;  5CVO B;  3K9M A;  4CDF B;  4PP2 E;  2XU1 A;  3OVX A;  2XU3 A;  1BP4 A;  1STF E;  4I07 A;  2WBF X;  2FRQ A;  4YV8 A;  5CHV A;  4W5C A;  1U9Q X;  1YT7 A;  1KHQ A;  3E1Z B;  1MEG A;  3MHS A;  3AI8 A;  3OF9 A;  1U9X A;  1KHP A;  1PE6 A;  4QRV A;  2BDL A;  4N79 A;  3WXG A;  4G54 A;  3H8B A;  4QBB A;  1PPN A;  2CB5 A;  3LFY A;  2FTD A;  4RY2 A;  4W5B A;  3B79 A;  4DMY A;  4FIP A;  2H7J A;  2AVW A;  2F7D A;  1CB5 A;  3F5V A;  1F2C A;  3IEJ A;  1EF7 A;  1Y08 A;  1Y4H A;  3ERV A;  2CIO A;  3D6S A;  3N4C A;  3V6E A;  2OZ2 A;  2O6X A;  2R9O A;  3PNR A;  2YJ2 A;  2AYO A;  1DEU A;  2AYN A;  1EWL A;  3PBH A;  5EF4 A;  1MIR A;  1CJL A;  1MDW A;  8PCH A;  4Q8G A;  1AU2 A;  3V6C A;  3IV2 A;  2NQG A;  5CHT A;  1AIM A;  1AU0 A;  1CV8 A;  5F02 A;  3OF8 A;  1MS6 A;  1AU3 A;  1YK7 A;  1ICF A;  2NQD B;  1JQP A;  3CH2 X;  1YVB A;  4N8W A;  3DF0 A;  3RVX A;  2IBI A;  4W4U A;  1F2B A;  3H89 A;  3U8E A;  5PAD A;  3HHI A;  4X6J A;  1FH0 A;  2FO5 A;  3HD3 A;  3QJ3 A;  1ATK A;  2P86 A;  4YYR A;  4CZW A;  5FPW A;  2GHU A;  4MSX A;  3K24 A;  4MZS A;  4OEM A;  5A24 A;  1NB5 A;  2E00 A;  3WXF A;  1ZCM A;  3ZUA A;  2R6N A;  2E01 A;  3GCB A;  1PPP A;  4X6H A;  2G6D A;  2PAD A;  1YAL A;  4YYQ A;  4YYU A;  3O1G A;  4OEL A;  2HXZ A;  1U5I A;  1ME3 A;  5CVM A;  1TL9 A;  1F2A A;  4X6I A;  1U9W A;  3KWZ A;  3KKU A;  1NLJ A;  3IOQ A;  5JH3 A;  4MZO A;  1MEM A;  2FQ9 A;  4BSQ A;  4PP1 A;  1PPD A;  1Q6K A;  2R9C A;  1AYV A;  4AXM A;  4YYV A;  3MOR A;  1QXP A;  4BS6 A;  6PAD A;  1CPJ A;  2G8J A;  1PPO A;  3N3G A;  4FJC A;  1PAD A;  3BOW A;  2E03 A;  1GCB A;  3BCN A;  2DCD A;  1NQC A;  3QT4 A;  2Y5B A;  1QDQ A;  1U9V A;  1BGO A;  4XR7 A;  3N3K A;  2PRE A;  2XU5 A;  2OUL A;  2DC8 A;  1VJV A;  2ACT A;  4P6G A;  2AUZ A;  2GFO A;  3IMA A;  4Q8H A;  2JQG R;  1ZIV A;  2Y6E A;  4PAD A;  4CDE B;  1CVZ A;  1GLO A;  2DC6 A;  4YYS A;  3RVW A;  4BPV A;  3IHP A;  1BQI A;  2P7U A;  3C9E A;  2AU1 A;  2AUX A;  2YJC A;  3KFQ A;  1O0E A;  3KSE A;  2YJ8 A;  4YVA A;  1PIP A;  1YK8 A;  1M6D A;  2NQA A;  2XU4 A;  1MHW A;  2F1G A;  5K16 A;  1PXV A;  2AIM A;  2PNS A;  4BS5 A;  4HWY A;  1CQD A;  1EWO A;  1TLO A;  1EWM A;  3MHH A;  3P5U A;  3S3R A;  3USV A;  2R9N A;  3H6S A;  3P5X A;  2PBH A;  4XUI A;  2JQF R;  2FRA A;  1KFU L;  1K3B B;  4FK5 A;  1NPZ A;  1X9Y A;  1PCI A;  3P5V A;  2YJ9 A;  4KLB A;  2NQI A;  2ATO A;  1AYU A;  3P5W A;  3HHA A;  4WA6 A;  2R9F A;  1F29 A;  3KX1 A;  4I04 A;  2DC9 A;  4YYW A;  1AU4 A;  4QRX A;  3BC3 A;  1KFX L;  1KXR A;  4QH6 A;  2FUD A;  3S3Q A;  3MTN A;  1POP A;  1BY8 A;  4I05 A;  4DMX A;  2IPP B;  3K8U A;  1EWP A;  1HUC B; 
#chains in the Genus database with same CATH topology
 1SP4 B;  1THE A;  3CH3 X;  2E02 A;  2UZJ A;  3MP2 A;  3NHE A;  3PHW A;  1CTE A;  3BBA A;  1CS8 A;  3O0U A;  2Z84 A;  1TU6 A;  7PCK A;  3H8C A;  3QSD A;  1XKG A;  4BOS A;  3BWK A;  2HD5 A;  3M99 A;  3I3T A;  3OVZ A;  1A6R A;  4CDC B;  5J94 A;  3BPM A;  3KWB X;  2DCC A;  2HH5 A;  2AS8 A;  1ME4 A;  5EGW A;  3CBK A;  1VSN A;  2HHN A;  3B21 A;  3W30 A;  2G8E A;  2DCA A;  3LXS A;  3RVV A;  1GMY A;  1CSB B;  4BOQ A;  4AXL A;  1QOL A;  3I06 A;  2FYE A;  5JA7 A;  4ZUX U;  2B1M A;  4GUA A;  4CDD B;  2DC7 A;  2BDZ A;  2R9M A;  1AEC A;  3PW3 A;  1GEC E;  1NB3 A;  3WXE A;  3E9S A;  3F75 A;  4BQV A;  4N4Z A;  4PI3 A;  3CBJ A;  3TNX A;  3PDF A;  2DCB A;  4RKX A;  2C0Y A;  4P6E A;  3BPF A;  1SNK A;  2DJF B;  2BTW B;  9PAP A;  4K7C A;  2DZY A;  3OIS A;  3HWN A;  1IWD A;  4D8E A;  1QMY A;  1DF0 A;  2VHS A;  2G7Y A;  2VHF A;  2BTW A;  1S4V A;  2FT2 A;  2OP3 A;  3IUT A;  2ARY A;  2DJG B;  2YJB A;  1AYW A;  4QRG A;  2DZZ A;  3KW9 A;  2P0R A;  2B1N A;  1ITO A;  5CVN B;  1NL6 A;  1PBH A;  3H7D A;  5CVO B;  3K9M A;  4CDF B;  4PP2 E;  2XU1 A;  3OVX A;  4MM3 B;  2XU3 A;  1BP4 A;  1STF E;  4I07 A;  2WBF X;  2FRQ A;  4YV8 A;  5CHV A;  4W5C A;  1U9Q X;  1YT7 A;  1KHQ A;  3E1Z B;  1MEG A;  3MHS A;  3AI8 A;  5JZE A;  3OF9 A;  1U9X A;  1KHP A;  1PE6 A;  4QRV A;  2BDL A;  4N79 A;  3WXG A;  4G54 A;  2J7Q C;  3H8B A;  4QBB A;  1PPN A;  2CB5 A;  5E6J A;  2J7Q A;  3LFY A;  2FTD A;  4RY2 A;  2JTC A;  4W5B A;  3B79 A;  4DMY A;  3MJ5 A;  3IFU A;  4FIP A;  2H7J A;  2AVW A;  2F7D A;  1CB5 A;  2JRI A;  3F5V A;  1F2C A;  3W31 A;  3IEJ A;  1EF7 A;  1Y08 A;  1Y4H A;  3ERV A;  4M0W A;  2CIO A;  4ZTB A;  3D6S A;  3N4C A;  3PT2 A;  3V6E A;  2OZ2 A;  2O6X A;  2R9O A;  3TRK A;  4RNA A;  3PNR A;  2YJ2 A;  2AYO A;  2FE8 A;  1DEU A;  2AYN A;  1EWL A;  3PBH A;  5EF4 A;  1MIR A;  1CJL A;  1MDW A;  4D8B A;  8PCH A;  4Q8G A;  1AU2 A;  3V6C A;  4IUM A;  3MTV A;  5EZQ A;  3IV2 A;  2NQG A;  5CHT A;  1AIM A;  1AU0 A;  1CV8 A;  5F02 A;  3OF8 A;  1MS6 A;  1AU3 A;  1YK7 A;  1ICF A;  3TMP A;  2NQD B;  1JQP A;  3CH2 X;  1YVB A;  4N8W A;  3DF0 A;  3RVX A;  2IBI A;  3PSE A;  4W4U A;  1F2B A;  1PVJ A;  3H89 A;  4MI7 A;  3U8E A;  5PAD A;  3HHI A;  4X6J A;  1FH0 A;  2FO5 A;  3HD3 A;  3QJ3 A;  1ATK A;  2P86 A;  4YYR A;  4CZW A;  5FPW A;  2GHU A;  4MSX A;  4RF1 A;  3K24 A;  4WUR A;  4MZS A;  4OEM A;  5A24 A;  1NB5 A;  2E00 A;  3WXF A;  1ZCM A;  3ZUA A;  2R6N A;  3PRM A;  2E01 A;  3GCB A;  1PPP A;  4X6H A;  2G6D A;  2PAD A;  1YAL A;  3PHX A;  4YYQ A;  4YYU A;  3O1G A;  4OEL A;  2HXZ A;  1U5I A;  1ME3 A;  5CVM A;  1TL9 A;  1F2A A;  4X6I A;  1U9W A;  3KWZ A;  3KKU A;  5KO3 A;  1NLJ A;  3IOQ A;  4R3D A;  5JH3 A;  4D8I A;  1DKI A;  4MZO A;  1MEM A;  2FQ9 A;  4BSQ A;  4PP1 A;  1PPD A;  4PT5 A;  1Q6K A;  2R9C A;  1AYV A;  3PRP A;  4IP3 A;  4AXM A;  4A5U A;  4YYV A;  3MOR A;  3C0R A;  1QXP A;  4BS6 A;  6PAD A;  1CPJ A;  2G8J A;  1PPO A;  3N3G A;  4FJC A;  1PAD A;  3BOW A;  2E03 A;  3ZNH A;  1GCB A;  3BCN A;  2DCD A;  1NQC A;  1YZB A;  2BU3 A;  3QT4 A;  2Y5B A;  1QDQ A;  1U9V A;  1BGO A;  4XR7 A;  3N3K A;  2PRE A;  1UKF A;  2XU5 A;  4OW0 A;  2OUL A;  2DC8 A;  1VJV A;  2ACT A;  4P6G A;  2AUZ A;  2GFO A;  3IMA A;  4Q8H A;  2JQG R;  1ZIV A;  2Y6E A;  4PAD A;  4CDE B;  1CVZ A;  1GLO A;  3RNV A;  2DC6 A;  4YYS A;  3RVW A;  4BPV A;  3BB7 A;  3IHP A;  1BQI A;  2P7U A;  3C9E A;  2AU1 A;  2AUX A;  2YJC A;  3KFQ A;  4HXD B;  1O0E A;  2HWK A;  3KSE A;  4OVZ B;  2YJ8 A;  3OQC A;  2DOS A;  4REZ A;  4YVA A;  4XZX A;  1PIP A;  4BOU A;  1YK8 A;  1M6D A;  2NQA A;  2XU4 A;  4BOZ A;  1MHW A;  4OVZ A;  2F1G A;  5K16 A;  4BOP A;  1PXV A;  2AIM A;  2PNS A;  4RF0 A;  4BS5 A;  4HWY A;  1CQD A;  1EWO A;  1TLO A;  1EWM A;  3MHH A;  3P5U A;  3S3R A;  3USV A;  2R9N A;  3H6S A;  3P5X A;  2PBH A;  4XUI A;  2JQF R;  2FRA A;  1KFU L;  3O65 A;  1K3B B;  4FK5 A;  4P16 A;  5EZS A;  1NPZ A;  1X9Y A;  1PCI A;  3P5V A;  2YJ9 A;  4KLB A;  2NQI A;  2ATO A;  1AYU A;  3P5W A;  3HHA A;  4WA6 A;  2R9F A;  1F29 A;  3KX1 A;  4I04 A;  2DC9 A;  4YYW A;  1AU4 A;  2AGA A;  4QRX A;  3BC3 A;  1KFX L;  3BY4 A;  1KXR A;  4QH6 A;  2FUD A;  3S3Q A;  3MTN A;  1POP A;  1BY8 A;  4I05 A;  4DMX A;  2IPP B;  3K8U A;  1EWP A;  1HUC B;  3PHU A; 
#chains in the Genus database with same CATH homology
 1SP4 B;  1THE A;  3CH3 X;  2E02 A;  3NHE A;  1CTE A;  1CS8 A;  3O0U A;  1TU6 A;  4GUZ A;  7PCK A;  3H8C A;  3QSD A;  1XKG A;  3BWK A;  2HD5 A;  3M99 A;  3I3T A;  3OVZ A;  1A6R A;  4CDC B;  5J94 A;  3BPM A;  3KWB X;  2DCC A;  2HH5 A;  2AS8 A;  1ME4 A;  5EGW A;  3CBK A;  1VSN A;  2HHN A;  2G8E A;  2DCA A;  3LXS A;  3RVV A;  1GMY A;  1CSB B;  4AXL A;  1QOL A;  3I06 A;  2FYE A;  5JA7 A;  4ZUX U;  2B1M A;  4CDD B;  2DC7 A;  2BDZ A;  2R9M A;  1AEC A;  3PW3 A;  1GEC E;  1NB3 A;  3WXE A;  3LTW A;  3F75 A;  4BQV A;  4N4Z A;  4PI3 A;  3CBJ A;  3TNX A;  3PDF A;  2DCB A;  2C0Y A;  4P6E A;  3BPF A;  1SNK A;  1W6F A;  2DJF B;  9PAP A;  4K7C A;  2DZY A;  1E2T A;  3OIS A;  3HWN A;  1IWD A;  1QMY A;  1DF0 A;  2VHS A;  2G7Y A;  2VHF A;  1S4V A;  2FT2 A;  2OP3 A;  3IUT A;  2ARY A;  2DJG B;  2YJB A;  1AYW A;  4QRG A;  2DZZ A;  3KW9 A;  2P0R A;  2B1N A;  1ITO A;  5CVN B;  1NL6 A;  1PBH A;  3H7D A;  5CVO B;  3K9M A;  4CDF B;  4PP2 E;  2XU1 A;  3OVX A;  2XU3 A;  1BP4 A;  1STF E;  4I07 A;  2WBF X;  2FRQ A;  4YV8 A;  5CHV A;  4W5C A;  1U9Q X;  1YT7 A;  1KHQ A;  3E1Z B;  1MEG A;  3MHS A;  3AI8 A;  3OF9 A;  1U9X A;  1KHP A;  1PE6 A;  4QRV A;  2BDL A;  4BGF A;  4N79 A;  3WXG A;  4G54 A;  3H8B A;  4QBB A;  1PPN A;  2CB5 A;  3LFY A;  2FTD A;  4RY2 A;  4W5B A;  3B79 A;  4DMY A;  4FIP A;  2H7J A;  2AVW A;  2F7D A;  1CB5 A;  3F5V A;  1F2C A;  3IEJ A;  1EF7 A;  1Y08 A;  1Y4H A;  3ERV A;  2CIO A;  3D6S A;  3N4C A;  3V6E A;  2OZ2 A;  2O6X A;  2R9O A;  4NV7 A;  3PNR A;  2YJ2 A;  2AYO A;  1DEU A;  2AYN A;  1EWL A;  4C5P A;  3PBH A;  5EF4 A;  1MIR A;  2VFB A;  1CJL A;  1MDW A;  8PCH A;  4Q8G A;  1AU2 A;  3V6C A;  3D9W A;  4NV8 A;  3IV2 A;  2NQG A;  5CHT A;  1AIM A;  1AU0 A;  1CV8 A;  5F02 A;  3OF8 A;  1MS6 A;  1AU3 A;  4B55 A;  1W5R A;  2BSZ A;  1YK7 A;  1ICF A;  2NQD B;  1JQP A;  3CH2 X;  1YVB A;  4N8W A;  3DF0 A;  3RVX A;  2IBI A;  4W4U A;  1F2B A;  3H89 A;  3U8E A;  1W4T A;  5PAD A;  3HHI A;  4X6J A;  1FH0 A;  2FO5 A;  2VFC A;  3HD3 A;  3QJ3 A;  1ATK A;  2P86 A;  4YYR A;  4CZW A;  5FPW A;  2GHU A;  4MSX A;  3K24 A;  4MZS A;  4OEM A;  5A24 A;  1NB5 A;  2E00 A;  3WXF A;  1ZCM A;  3ZUA A;  2R6N A;  2E01 A;  3GCB A;  1PPP A;  4X6H A;  2G6D A;  2PAD A;  1YAL A;  4YYQ A;  4YYU A;  3O1G A;  4OEL A;  2HXZ A;  1U5I A;  1ME3 A;  5CVM A;  1TL9 A;  1F2A A;  4X6I A;  1U9W A;  3KWZ A;  3KKU A;  1NLJ A;  3IOQ A;  5JH3 A;  4MZO A;  1MEM A;  2FQ9 A;  4BSQ A;  4PP1 A;  1PPD A;  1Q6K A;  2R9C A;  1AYV A;  4AXM A;  4YYV A;  3MOR A;  1QXP A;  4BS6 A;  6PAD A;  1CPJ A;  2G8J A;  1PPO A;  3N3G A;  4FJC A;  1PAD A;  3BOW A;  2E03 A;  1GCB A;  3BCN A;  2DCD A;  1NQC A;  3QT4 A;  2Y5B A;  1QDQ A;  1U9V A;  1BGO A;  4XR7 A;  3N3K A;  2PRE A;  2XU5 A;  2OUL A;  2DC8 A;  1VJV A;  2ACT A;  4P6G A;  2AUZ A;  2GFO A;  3IMA A;  4Q8H A;  2JQG R;  1ZIV A;  2Y6E A;  4PAD A;  4CDE B;  1CVZ A;  1GLO A;  2DC6 A;  4YYS A;  3RVW A;  4BPV A;  3IHP A;  1BQI A;  2P7U A;  3C9E A;  2AU1 A;  2AUX A;  2YJC A;  3KFQ A;  1O0E A;  3KSE A;  2YJ8 A;  4YVA A;  1PIP A;  1YK8 A;  1M6D A;  2NQA A;  2XU4 A;  1MHW A;  2F1G A;  5K16 A;  1PXV A;  2AIM A;  2PNS A;  4BS5 A;  4HWY A;  1CQD A;  1EWO A;  1TLO A;  1EWM A;  3MHH A;  3P5U A;  3S3R A;  3USV A;  2R9N A;  3H6S A;  3P5X A;  2PBH A;  4XUI A;  2JQF R;  2FRA A;  1KFU L;  1K3B B;  4FK5 A;  1NPZ A;  1X9Y A;  1PCI A;  3P5V A;  2YJ9 A;  4KLB A;  2NQI A;  2ATO A;  1AYU A;  3P5W A;  3HHA A;  4WA6 A;  2R9F A;  1F29 A;  3KX1 A;  4I04 A;  2DC9 A;  4YYW A;  1AU4 A;  4QRX A;  3BC3 A;  1KFX L;  1KXR A;  4QH6 A;  2FUD A;  1GX3 A;  3S3Q A;  3MTN A;  1POP A;  1BY8 A;  4I05 A;  4DMX A;  2IPP B;  3K8U A;  1EWP A;  1HUC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...