2AYNA

Structure of usp14, a proteasome-associated deubiquitinating enzyme
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
383
structure length
337
Chain Sequence
MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 337
sequence length 383
chains with identical sequence B, C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aynA00
2P86A 5CVNB 2G8JA 1CTEA 2G7YA 1QOLA 2PBHA 2R9CA 4FIPA 4CZWA 2NQAA 1PPPA 2GHUA 2FO5A 3IHPA 3MHHA 1POPA 1KFUL 3BWKA 1F29A 2YJCA 3H89A 3NHEA 1NL6A 1YVBA 2Y6EA 2DCCA 3S3RA 2AYNA 3PDFA 4PP1A 1YK8A 3KSEA 4N4ZA 1TLOA 2FQ9A 1U9WA 4YYQA 2JQFR 2R9NA 1YALA 1AU2A 4CDEB 1VJVA 2E00A 4BQVA 2XU3A 1Y08A 2FRAA 1EWOA 4I05A 1BY8A 1PCIA 4XUIA 1CPJA 3N4CA 1PPNA 4X6JA 4BPVA 1EWLA 3IEJA 4HWYA 3P5XA 2PNSA 3CH2X 1GECE 2YJBA 3LXSA 5PADA 2OP3A 2F7DA 1CV8A 3AI8A 1YT7A 1MHWA 4RY2A 1EWMA 3QJ3A 3S3QA 4BS5A 2DC9A 4CDDB 1ITOA 3KW9A 1DF0A 4MSXA 3MTNA 3H8CA 4OELA 3OVXA 2R6NA 3B79A 3H8BA 1NPZA 4QBBA 5K16A 1GCBA 3K9MA 5EGWA 3KFQA 4Q8HA 4N8WA 4XR7A 1EWPA 4YYSA 3H7DA 2PADA 4YYUA 3M99A 5F02A 3BOWA 2FYEA 5CVMA 3IUTA 1F2BA 1U9VA 4YYVA 3RVXA 1ATKA 2XU1A 8PCHA 2FRQA 1CQDA 2E02A 2FUDA 3QT4A 2B1MA 3WXFA 1AYUA 2VHSA 3V6CA 4W5BA 2O6XA 2AYOA 1TL9A 2JQGR 4PI3A 2HHNA 5JA7A 1NB5A 1PADA 1QXPA 5J94A 2YJ2A 1PPOA 3OF9A 1Y4HA 6PADA 2VHFA 3HD3A 3WXEA 2CB5A 1CSBB 3OVZA 1AU0A 2ARYA 4K7CA 5JH3A 1BGOA 1F2AA 2CIOA 4W4UA 4PADA 1DEUA 3USVA 3PNRA 2DJGB 3OISA 3PBHA 3DF0A 1MIRA 4X6HA 1FH0A 2DC8A 3LFYA 2Y5BA 1K3BB 2IPPB 1MEGA 3ERVA 1CB5A 3IMAA 4QH6A 4P6GA 2NQDB 1STFE 3I3TA 3RVWA 2HD5A 3BCNA 3BPMA 3KKUA 1MDWA 3MORA 3CBJA 3K8UA 3H6SA 2HXZA 1AYVA 1CVZA 1X9YA 3P5WA 2OZ2A 2FT2A 5FPWA 5CVOB 1GMYA 2BDZA 1F2CA 3C9EA 3HHIA 5CHTA 1U9QX 1NLJA 3RVVA 4YVAA 2P7UA 1O0EA 2WBFX 3KX1A 1MS6A 3K24A 3HHAA 1PE6A 4YV8A 2R9OA 1JQPA 3V6EA 2AUXA 2F1GA 4CDCB 4BS6A 4FJCA 2GFOA 4MZOA 4I04A 3BC3A 3ZUAA 5EF4A 3N3KA 3E1ZB 1MEMA 1TU6A 2H7JA 1YK7A 2G6DA 4Q8GA 1ME4A 3TNXA 3O0UA 2DCAA 1EF7A 3O1GA 1QDQA 4AXMA 2AVWA 2ACTA 4YYRA 3GCBA 2YJ8A 3F75A 3D6SA 4MZSA 4X6IA 4KLBA 2BDLA 1ZCMA 3WXGA 4AXLA 2DZYA 1PPDA 3P5VA 3N3GA 2AS8A 4P6EA 2R9FA 4ZUXU 3BPFA 3KWBX 1U9XA 3PW3A 1IWDA 2ATOA 3U8EA 4QRXA 1HUCB 2C0YA 3CBKA 4CDFB 4W5CA 3I06A 2DCBA 1CS8A 1M6DA 4BSQA 2G8EA 1AU3A 3QSDA 3CH3X 2E01A 1ME3A 1SP4B 1A6RA 2XU5A 1NB3A 1Q6KA 1PBHA 1KFXL 1QMYA 1S4VA 4PP2E 2B1NA 3P5UA 4WA6A 2NQIA 2DC7A 2E03A 1XKGA 2DC6A 3MHSA 1PXVA 2AUZA 2R9MA 1THEA 2AIMA 3HWNA 4I07A 4QRGA 2YJ9A 3IV2A 2DJFB 9PAPA 2HH5A 7PCKA 1PIPA 5CHVA 1U5IA 1ZIVA 2PREA 3F5VA 3OF8A 1VSNA 4DMYA 2IBIA 2FTDA 5A24A 1AIMA 4FK5A 1BP4A 1SNKA 2DCDA 2NQGA 2DZZA 4DMXA 4N79A 1GLOA 1KHQA 4OEMA 2OULA 4G54A 1NQCA 2AU1A 1ICFA 1AU4A 3IOQA 2P0RA 1AYWA 1KHPA 1CJLA 2XU4A 1AECA 3KWZA 1BQIA 4QRVA 1KXRA 4YYWA
chains in the Genus database with same CATH superfamily
1PVJA 2P86A 4RF0A 5CVNB 2G8JA 1CTEA 2G7YA 4MM3B 1QOLA 2PBHA 2R9CA 4FIPA 4CZWA 2NQAA 1PPPA 2GHUA 2FO5A 3IHPA 3MHHA 4R3DA 1POPA 4WURA 1KFUL 3MJ5A 3BWKA 4BOUA 1F29A 2YJCA 3H89A 3NHEA 1NL6A 1YVBA 2Y6EA 2DCCA 3S3RA 2AYNA 3PDFA 4PP1A 1YK8A 3KSEA 4N4ZA 1TLOA 2FQ9A 3W31A 1U9WA 4YYQA 2JQFR 2R9NA 1YALA 1AU2A 4CDEB 3W30A 1VJVA 2E00A 4IP3A 2BTWA 4BQVA 2XU3A 1Y08A 2FRAA 3RNVA 1EWOA 4I05A 1BY8A 1PCIA 2J7QC 4XUIA 1CPJA 3N4CA 1PPNA 4X6JA 4BPVA 1EWLA 3IEJA 4HWYA 3ZNHA 3P5XA 2PNSA 3CH2X 1GECE 2YJBA 3LXSA 5PADA 5KO3A 2OP3A 4BOSA 2F7DA 4RKXA 1CV8A 3AI8A 1YT7A 1MHWA 4RY2A 1EWMA 3QJ3A 3S3QA 4BS5A 2DC9A 4CDDB 1ITOA 3KW9A 1DF0A 4MSXA 3MTNA 3H8CA 4GUAA 4OELA 4D8IA 3OVXA 2R6NA 3B79A 3H8BA 1NPZA 4QBBA 5K16A 1GCBA 3K9MA 5EGWA 3KFQA 4Q8HA 4N8WA 4XR7A 1EWPA 4YYSA 3H7DA 2PADA 4YYUA 3M99A 5F02A 3BOWA 2FYEA 2HWKA 5CVMA 3IUTA 2J7QA 3BB7A 1F2BA 1U9VA 4YYVA 4D8EA 2BTWB 3RVXA 1ATKA 2XU1A 8PCHA 2FRQA 1CQDA 2E02A 2FUDA 3QT4A 2B1MA 3PHUA 3MP2A 3WXFA 1AYUA 2VHSA 3V6CA 4XZXA 4W5BA 2O6XA 2AYOA 1TL9A 2JQGR 4PI3A 2HHNA 5JA7A 1NB5A 1PADA 1QXPA 5J94A 2YJ2A 1PPOA 3OF9A 1Y4HA 6PADA 2VHFA 3HD3A 3WXEA 2CB5A 1CSBB 3OVZA 1AU0A 2ARYA 4K7CA 5JH3A 1BGOA 1F2AA 2CIOA 4W4UA 4PADA 1DEUA 3USVA 3PRMA 3PNRA 3MTVA 2DJGB 3OISA 3IFUA 3DF0A 3PBHA 3PRPA 1MIRA 4X6HA 1FH0A 2DC8A 3LFYA 2Y5BA 3O65A 1K3BB 2IPPB 1MEGA 3ERVA 1CB5A 3IMAA 4QH6A 4P6GA 2NQDB 1STFE 3I3TA 3RVWA 3PHXA 2HD5A 3BCNA 3BPMA 3KKUA 1MDWA 3MORA 3CBJA 4A5UA 3K8UA 3H6SA 2HXZA 1AYVA 1YZBA 1CVZA 1X9YA 3P5WA 4MI7A 2OZ2A 2FT2A 5FPWA 5CVOB 1GMYA 2BDZA 1F2CA 3C9EA 3HHIA 5CHTA 1U9QX 1NLJA 3RVVA 4YVAA 2P7UA 4BOZA 1O0EA 1DKIA 2WBFX 4BOPA 3KX1A 1MS6A 3K24A 3HHAA 3PSEA 1PE6A 3TMPA 4YV8A 2R9OA 1JQPA 3V6EA 2AUXA 2F1GA 2BU3A 4CDCB 4BS6A 4FJCA 2GFOA 4OVZB 4MZOA 4I04A 3BC3A 2AGAA 3ZUAA 5EF4A 3BY4A 3N3KA 3C0RA 3E1ZB 1MEMA 1TU6A 4P16A 2H7JA 1YK7A 4REZA 2G6DA 4Q8GA 1ME4A 3TNXA 3O0UA 3O1GA 2DCAA 1EF7A 2DOSA 4D8BA 1QDQA 4ZTBA 4AXMA 2UZJA 2AVWA 2ACTA 4HXDB 4YYRA 3GCBA 2YJ8A 3F75A 3D6SA 4MZSA 4X6IA 2BDLA 4KLBA 1ZCMA 3WXGA 4AXLA 2DZYA 1PPDA 3P5VA 3N3GA 2AS8A 4P6EA 2R9FA 4ZUXU 3BPFA 3KWBX 1U9XA 4OVZA 2JRIA 3PW3A 1IWDA 2ATOA 4IUMA 3U8EA 4QRXA 1HUCB 2C0YA 3CBKA 4CDFB 4W5CA 3I06A 2DCBA 1CS8A 1M6DA 4BSQA 2G8EA 4PT5A 1AU3A 3QSDA 3CH3X 2E01A 1ME3A 1SP4B 1A6RA 2XU5A 3PT2A 1NB3A 1Q6KA 1PBHA 1KFXL 1QMYA 1S4VA 2JTCA 4PP2E 2B1NA 3P5UA 4WA6A 2NQIA 2DC7A 2E03A 5E6JA 1XKGA 4RNAA 2DC6A 3MHSA 1PXVA 2AUZA 2R9MA 5JZEA 1THEA 2AIMA 2Z84A 3HWNA 4I07A 4QRGA 2YJ9A 3IV2A 5EZSA 4RF1A 2DJFB 9PAPA 2HH5A 1UKFA 3TRKA 7PCKA 1PIPA 3B21A 5CHVA 1U5IA 1ZIVA 2PREA 4BOQA 3F5VA 3OF8A 1VSNA 4DMYA 2IBIA 2FTDA 5A24A 3OQCA 1AIMA 5EZQA 4FK5A 1BP4A 1SNKA 2DCDA 2NQGA 3E9SA 2DZZA 4DMXA 4N79A 1GLOA 1KHQA 4OEMA 2OULA 4G54A 1NQCA 2AU1A 1ICFA 1AU4A 3IOQA 2P0RA 3PHWA 4M0WA 1AYWA 1KHPA 1CJLA 2XU4A 1AECA 4OW0A 3KWZA 3BBAA 1BQIA 4QRVA 1KXRA 2FE8A 4YYWA
chains in the Genus database with same CATH topology
2P86A 5CVNB 2G8JA 1CTEA 2G7YA 1QOLA 2PBHA 2R9CA 4FIPA 1W4TA 4CZWA 2NQAA 1PPPA 2GHUA 2FO5A 4C5PA 3IHPA 3MHHA 1POPA 1KFUL 3BWKA 1F29A 2YJCA 3H89A 3NHEA 1NL6A 1YVBA 2Y6EA 2DCCA 2VFCA 3S3RA 4BGFA 2AYNA 3PDFA 4PP1A 1YK8A 3KSEA 4N4ZA 1TLOA 2FQ9A 1U9WA 4YYQA 2JQFR 2R9NA 1YALA 1AU2A 4CDEB 1VJVA 2E00A 4BQVA 2XU3A 1Y08A 2FRAA 1EWOA 4I05A 1BY8A 1PCIA 4XUIA 1CPJA 3N4CA 1PPNA 4X6JA 4BPVA 1EWLA 3IEJA 4HWYA 3P5XA 2PNSA 3CH2X 1GECE 2YJBA 3LXSA 5PADA 2OP3A 4NV7A 2F7DA 1CV8A 1GX3A 3AI8A 1YT7A 1MHWA 4RY2A 1EWMA 3QJ3A 3S3QA 4BS5A 2DC9A 4CDDB 1ITOA 3KW9A 1DF0A 4MSXA 3MTNA 3H8CA 4OELA 3OVXA 2R6NA 3B79A 3H8BA 4NV8A 1NPZA 4QBBA 5K16A 1GCBA 3K9MA 5EGWA 3KFQA 4Q8HA 4N8WA 4XR7A 1EWPA 4YYSA 3H7DA 2PADA 4YYUA 3M99A 5F02A 3BOWA 2FYEA 5CVMA 3IUTA 1F2BA 1U9VA 4YYVA 3LTWA 3RVXA 1ATKA 4GUZA 2XU1A 8PCHA 2FRQA 1CQDA 2E02A 2FUDA 3QT4A 2B1MA 3WXFA 1AYUA 2VHSA 3V6CA 2VFBA 4W5BA 2O6XA 2AYOA 1TL9A 2JQGR 4PI3A 2HHNA 5JA7A 1NB5A 1PADA 1QXPA 5J94A 2YJ2A 1PPOA 3OF9A 1Y4HA 6PADA 2VHFA 3HD3A 3WXEA 2CB5A 1CSBB 3OVZA 1AU0A 2ARYA 4K7CA 5JH3A 1BGOA 1F2AA 2CIOA 4W4UA 4PADA 1DEUA 3USVA 3PNRA 2DJGB 3OISA 3PBHA 3DF0A 1MIRA 4X6HA 1FH0A 2DC8A 3LFYA 2Y5BA 1E2TA 1K3BB 2IPPB 1MEGA 3ERVA 1CB5A 3IMAA 4QH6A 4P6GA 2NQDB 1STFE 3I3TA 3RVWA 2HD5A 3BCNA 3BPMA 3KKUA 1MDWA 3MORA 3CBJA 3K8UA 3H6SA 2HXZA 1AYVA 1W6FA 1CVZA 1X9YA 3P5WA 2OZ2A 2FT2A 5FPWA 5CVOB 1GMYA 2BDZA 1F2CA 3C9EA 3HHIA 5CHTA 1U9QX 1NLJA 3RVVA 4YVAA 2P7UA 1O0EA 2WBFX 3KX1A 1MS6A 3K24A 3HHAA 1PE6A 4YV8A 2R9OA 1JQPA 3V6EA 2AUXA 2F1GA 4CDCB 4BS6A 2BSZA 4FJCA 2GFOA 4MZOA 4I04A 3BC3A 3ZUAA 5EF4A 3N3KA 3E1ZB 1MEMA 1TU6A 2H7JA 1YK7A 2G6DA 4Q8GA 1ME4A 3TNXA 3O0UA 2DCAA 1EF7A 3O1GA 1QDQA 4AXMA 2AVWA 2ACTA 4YYRA 3GCBA 2YJ8A 3F75A 3D6SA 4MZSA 4X6IA 4KLBA 2BDLA 1ZCMA 3WXGA 4AXLA 2DZYA 1PPDA 3P5VA 3N3GA 2AS8A 4P6EA 2R9FA 4ZUXU 3BPFA 3KWBX 1U9XA 3PW3A 1IWDA 2ATOA 3U8EA 4QRXA 1HUCB 2C0YA 3CBKA 4CDFB 4W5CA 3I06A 2DCBA 1CS8A 1M6DA 4BSQA 2G8EA 1AU3A 3QSDA 3CH3X 2E01A 1ME3A 1SP4B 1A6RA 2XU5A 1NB3A 1Q6KA 1PBHA 1KFXL 1QMYA 1S4VA 4PP2E 2B1NA 3P5UA 4WA6A 2NQIA 2DC7A 2E03A 1XKGA 2DC6A 3MHSA 1PXVA 2AUZA 2R9MA 1THEA 2AIMA 3HWNA 4I07A 4QRGA 2YJ9A 3IV2A 2DJFB 9PAPA 2HH5A 7PCKA 1PIPA 5CHVA 1U5IA 1ZIVA 2PREA 3F5VA 3OF8A 1VSNA 4DMYA 2IBIA 2FTDA 5A24A 1AIMA 4FK5A 1BP4A 1SNKA 2DCDA 2NQGA 3D9WA 2DZZA 4DMXA 4N79A 1GLOA 1KHQA 4OEMA 2OULA 4G54A 1NQCA 2AU1A 1ICFA 4B55A 1AU4A 3IOQA 2P0RA 1AYWA 1KHPA 1CJLA 2XU4A 1AECA 1W5RA 3KWZA 1BQIA 4QRVA 1KXRA 4YYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P86 A;  5CVN B;  2G8J A;  1CTE A;  2G7Y A;  1QOL A;  2PBH A;  2R9C A;  4FIP A;  4CZW A;  2NQA A;  1PPP A;  2GHU A;  2FO5 A;  3IHP A;  3MHH A;  1POP A;  1KFU L;  3BWK A;  1F29 A;  2YJC A;  3H89 A;  3NHE A;  1NL6 A;  1YVB A;  2Y6E A;  2DCC A;  3S3R A;  2AYN A;  3PDF A;  4PP1 A;  1YK8 A;  3KSE A;  4N4Z A;  1TLO A;  2FQ9 A;  1U9W A;  4YYQ A;  2JQF R;  2R9N A;  1YAL A;  1AU2 A;  4CDE B;  1VJV A;  2E00 A;  4BQV A;  2XU3 A;  1Y08 A;  2FRA A;  1EWO A;  4I05 A;  1BY8 A;  1PCI A;  4XUI A;  1CPJ A;  3N4C A;  1PPN A;  4X6J A;  4BPV A;  1EWL A;  3IEJ A;  4HWY A;  3P5X A;  2PNS A;  3CH2 X;  1GEC E;  2YJB A;  3LXS A;  5PAD A;  2OP3 A;  2F7D A;  1CV8 A;  3AI8 A;  1YT7 A;  1MHW A;  4RY2 A;  1EWM A;  3QJ3 A;  3S3Q A;  4BS5 A;  2DC9 A;  4CDD B;  1ITO A;  3KW9 A;  1DF0 A;  4MSX A;  3MTN A;  3H8C A;  4OEL A;  3OVX A;  2R6N A;  3B79 A;  3H8B A;  1NPZ A;  4QBB A;  5K16 A;  1GCB A;  3K9M A;  5EGW A;  3KFQ A;  4Q8H A;  4N8W A;  4XR7 A;  1EWP A;  4YYS A;  3H7D A;  2PAD A;  4YYU A;  3M99 A;  5F02 A;  3BOW A;  2FYE A;  5CVM A;  3IUT A;  1F2B A;  1U9V A;  4YYV A;  3RVX A;  1ATK A;  2XU1 A;  8PCH A;  2FRQ A;  1CQD A;  2E02 A;  2FUD A;  3QT4 A;  2B1M A;  3WXF A;  1AYU A;  2VHS A;  3V6C A;  4W5B A;  2O6X A;  2AYO A;  1TL9 A;  2JQG R;  4PI3 A;  2HHN A;  5JA7 A;  1NB5 A;  1PAD A;  1QXP A;  5J94 A;  2YJ2 A;  1PPO A;  3OF9 A;  1Y4H A;  6PAD A;  2VHF A;  3HD3 A;  3WXE A;  2CB5 A;  1CSB B;  3OVZ A;  1AU0 A;  2ARY A;  4K7C A;  5JH3 A;  1BGO A;  1F2A A;  2CIO A;  4W4U A;  4PAD A;  1DEU A;  3USV A;  3PNR A;  2DJG B;  3OIS A;  3PBH A;  3DF0 A;  1MIR A;  4X6H A;  1FH0 A;  2DC8 A;  3LFY A;  2Y5B A;  1K3B B;  2IPP B;  1MEG A;  3ERV A;  1CB5 A;  3IMA A;  4QH6 A;  4P6G A;  2NQD B;  1STF E;  3I3T A;  3RVW A;  2HD5 A;  3BCN A;  3BPM A;  3KKU A;  1MDW A;  3MOR A;  3CBJ A;  3K8U A;  3H6S A;  2HXZ A;  1AYV A;  1CVZ A;  1X9Y A;  3P5W A;  2OZ2 A;  2FT2 A;  5FPW A;  5CVO B;  1GMY A;  2BDZ A;  1F2C A;  3C9E A;  3HHI A;  5CHT A;  1U9Q X;  1NLJ A;  3RVV A;  4YVA A;  2P7U A;  1O0E A;  2WBF X;  3KX1 A;  1MS6 A;  3K24 A;  3HHA A;  1PE6 A;  4YV8 A;  2R9O A;  1JQP A;  3V6E A;  2AUX A;  2F1G A;  4CDC B;  4BS6 A;  4FJC A;  2GFO A;  4MZO A;  4I04 A;  3BC3 A;  3ZUA A;  5EF4 A;  3N3K A;  3E1Z B;  1MEM A;  1TU6 A;  2H7J A;  1YK7 A;  2G6D A;  4Q8G A;  1ME4 A;  3TNX A;  3O0U A;  2DCA A;  1EF7 A;  3O1G A;  1QDQ A;  4AXM A;  2AVW A;  2ACT A;  4YYR A;  3GCB A;  2YJ8 A;  3F75 A;  3D6S A;  4MZS A;  4X6I A;  4KLB A;  2BDL A;  1ZCM A;  3WXG A;  4AXL A;  2DZY A;  1PPD A;  3P5V A;  3N3G A;  2AS8 A;  4P6E A;  2R9F A;  4ZUX U;  3BPF A;  3KWB X;  1U9X A;  3PW3 A;  1IWD A;  2ATO A;  3U8E A;  4QRX A;  1HUC B;  2C0Y A;  3CBK A;  4CDF B;  4W5C A;  3I06 A;  2DCB A;  1CS8 A;  1M6D A;  4BSQ A;  2G8E A;  1AU3 A;  3QSD A;  3CH3 X;  2E01 A;  1ME3 A;  1SP4 B;  1A6R A;  2XU5 A;  1NB3 A;  1Q6K A;  1PBH A;  1KFX L;  1QMY A;  1S4V A;  4PP2 E;  2B1N A;  3P5U A;  4WA6 A;  2NQI A;  2DC7 A;  2E03 A;  1XKG A;  2DC6 A;  3MHS A;  1PXV A;  2AUZ A;  2R9M A;  1THE A;  2AIM A;  3HWN A;  4I07 A;  4QRG A;  2YJ9 A;  3IV2 A;  2DJF B;  9PAP A;  2HH5 A;  7PCK A;  1PIP A;  5CHV A;  1U5I A;  1ZIV A;  2PRE A;  3F5V A;  3OF8 A;  1VSN A;  4DMY A;  2IBI A;  2FTD A;  5A24 A;  1AIM A;  4FK5 A;  1BP4 A;  1SNK A;  2DCD A;  2NQG A;  2DZZ A;  4DMX A;  4N79 A;  1GLO A;  1KHQ A;  4OEM A;  2OUL A;  4G54 A;  1NQC A;  2AU1 A;  1ICF A;  1AU4 A;  3IOQ A;  2P0R A;  1AYW A;  1KHP A;  1CJL A;  2XU4 A;  1AEC A;  3KWZ A;  1BQI A;  4QRV A;  1KXR A;  4YYW A; 
#chains in the Genus database with same CATH topology
 1PVJ A;  2P86 A;  4RF0 A;  5CVN B;  2G8J A;  1CTE A;  2G7Y A;  4MM3 B;  1QOL A;  2PBH A;  2R9C A;  4FIP A;  4CZW A;  2NQA A;  1PPP A;  2GHU A;  2FO5 A;  3IHP A;  3MHH A;  4R3D A;  1POP A;  4WUR A;  1KFU L;  3MJ5 A;  3BWK A;  4BOU A;  1F29 A;  2YJC A;  3H89 A;  3NHE A;  1NL6 A;  1YVB A;  2Y6E A;  2DCC A;  3S3R A;  2AYN A;  3PDF A;  4PP1 A;  1YK8 A;  3KSE A;  4N4Z A;  1TLO A;  2FQ9 A;  3W31 A;  1U9W A;  4YYQ A;  2JQF R;  2R9N A;  1YAL A;  1AU2 A;  4CDE B;  3W30 A;  1VJV A;  2E00 A;  4IP3 A;  2BTW A;  4BQV A;  2XU3 A;  1Y08 A;  2FRA A;  3RNV A;  1EWO A;  4I05 A;  1BY8 A;  1PCI A;  2J7Q C;  4XUI A;  1CPJ A;  3N4C A;  1PPN A;  4X6J A;  4BPV A;  1EWL A;  3IEJ A;  4HWY A;  3ZNH A;  3P5X A;  2PNS A;  3CH2 X;  1GEC E;  2YJB A;  3LXS A;  5PAD A;  5KO3 A;  2OP3 A;  4BOS A;  2F7D A;  4RKX A;  1CV8 A;  3AI8 A;  1YT7 A;  1MHW A;  4RY2 A;  1EWM A;  3QJ3 A;  3S3Q A;  4BS5 A;  2DC9 A;  4CDD B;  1ITO A;  3KW9 A;  1DF0 A;  4MSX A;  3MTN A;  3H8C A;  4GUA A;  4OEL A;  4D8I A;  3OVX A;  2R6N A;  3B79 A;  3H8B A;  1NPZ A;  4QBB A;  5K16 A;  1GCB A;  3K9M A;  5EGW A;  3KFQ A;  4Q8H A;  4N8W A;  4XR7 A;  1EWP A;  4YYS A;  3H7D A;  2PAD A;  4YYU A;  3M99 A;  5F02 A;  3BOW A;  2FYE A;  2HWK A;  5CVM A;  3IUT A;  2J7Q A;  3BB7 A;  1F2B A;  1U9V A;  4YYV A;  4D8E A;  2BTW B;  3RVX A;  1ATK A;  2XU1 A;  8PCH A;  2FRQ A;  1CQD A;  2E02 A;  2FUD A;  3QT4 A;  2B1M A;  3PHU A;  3MP2 A;  3WXF A;  1AYU A;  2VHS A;  3V6C A;  4XZX A;  4W5B A;  2O6X A;  2AYO A;  1TL9 A;  2JQG R;  4PI3 A;  2HHN A;  5JA7 A;  1NB5 A;  1PAD A;  1QXP A;  5J94 A;  2YJ2 A;  1PPO A;  3OF9 A;  1Y4H A;  6PAD A;  2VHF A;  3HD3 A;  3WXE A;  2CB5 A;  1CSB B;  3OVZ A;  1AU0 A;  2ARY A;  4K7C A;  5JH3 A;  1BGO A;  1F2A A;  2CIO A;  4W4U A;  4PAD A;  1DEU A;  3USV A;  3PRM A;  3PNR A;  3MTV A;  2DJG B;  3OIS A;  3IFU A;  3DF0 A;  3PBH A;  3PRP A;  1MIR A;  4X6H A;  1FH0 A;  2DC8 A;  3LFY A;  2Y5B A;  3O65 A;  1K3B B;  2IPP B;  1MEG A;  3ERV A;  1CB5 A;  3IMA A;  4QH6 A;  4P6G A;  2NQD B;  1STF E;  3I3T A;  3RVW A;  3PHX A;  2HD5 A;  3BCN A;  3BPM A;  3KKU A;  1MDW A;  3MOR A;  3CBJ A;  4A5U A;  3K8U A;  3H6S A;  2HXZ A;  1AYV A;  1YZB A;  1CVZ A;  1X9Y A;  3P5W A;  4MI7 A;  2OZ2 A;  2FT2 A;  5FPW A;  5CVO B;  1GMY A;  2BDZ A;  1F2C A;  3C9E A;  3HHI A;  5CHT A;  1U9Q X;  1NLJ A;  3RVV A;  4YVA A;  2P7U A;  4BOZ A;  1O0E A;  1DKI A;  2WBF X;  4BOP A;  3KX1 A;  1MS6 A;  3K24 A;  3HHA A;  3PSE A;  1PE6 A;  3TMP A;  4YV8 A;  2R9O A;  1JQP A;  3V6E A;  2AUX A;  2F1G A;  2BU3 A;  4CDC B;  4BS6 A;  4FJC A;  2GFO A;  4OVZ B;  4MZO A;  4I04 A;  3BC3 A;  2AGA A;  3ZUA A;  5EF4 A;  3BY4 A;  3N3K A;  3C0R A;  3E1Z B;  1MEM A;  1TU6 A;  4P16 A;  2H7J A;  1YK7 A;  4REZ A;  2G6D A;  4Q8G A;  1ME4 A;  3TNX A;  3O0U A;  3O1G A;  2DCA A;  1EF7 A;  2DOS A;  4D8B A;  1QDQ A;  4ZTB A;  4AXM A;  2UZJ A;  2AVW A;  2ACT A;  4HXD B;  4YYR A;  3GCB A;  2YJ8 A;  3F75 A;  3D6S A;  4MZS A;  4X6I A;  2BDL A;  4KLB A;  1ZCM A;  3WXG A;  4AXL A;  2DZY A;  1PPD A;  3P5V A;  3N3G A;  2AS8 A;  4P6E A;  2R9F A;  4ZUX U;  3BPF A;  3KWB X;  1U9X A;  4OVZ A;  2JRI A;  3PW3 A;  1IWD A;  2ATO A;  4IUM A;  3U8E A;  4QRX A;  1HUC B;  2C0Y A;  3CBK A;  4CDF B;  4W5C A;  3I06 A;  2DCB A;  1CS8 A;  1M6D A;  4BSQ A;  2G8E A;  4PT5 A;  1AU3 A;  3QSD A;  3CH3 X;  2E01 A;  1ME3 A;  1SP4 B;  1A6R A;  2XU5 A;  3PT2 A;  1NB3 A;  1Q6K A;  1PBH A;  1KFX L;  1QMY A;  1S4V A;  2JTC A;  4PP2 E;  2B1N A;  3P5U A;  4WA6 A;  2NQI A;  2DC7 A;  2E03 A;  5E6J A;  1XKG A;  4RNA A;  2DC6 A;  3MHS A;  1PXV A;  2AUZ A;  2R9M A;  5JZE A;  1THE A;  2AIM A;  2Z84 A;  3HWN A;  4I07 A;  4QRG A;  2YJ9 A;  3IV2 A;  5EZS A;  4RF1 A;  2DJF B;  9PAP A;  2HH5 A;  1UKF A;  3TRK A;  7PCK A;  1PIP A;  3B21 A;  5CHV A;  1U5I A;  1ZIV A;  2PRE A;  4BOQ A;  3F5V A;  3OF8 A;  1VSN A;  4DMY A;  2IBI A;  2FTD A;  5A24 A;  3OQC A;  1AIM A;  5EZQ A;  4FK5 A;  1BP4 A;  1SNK A;  2DCD A;  2NQG A;  3E9S A;  2DZZ A;  4DMX A;  4N79 A;  1GLO A;  1KHQ A;  4OEM A;  2OUL A;  4G54 A;  1NQC A;  2AU1 A;  1ICF A;  1AU4 A;  3IOQ A;  2P0R A;  3PHW A;  4M0W A;  1AYW A;  1KHP A;  1CJL A;  2XU4 A;  1AEC A;  4OW0 A;  3KWZ A;  3BBA A;  1BQI A;  4QRV A;  1KXR A;  2FE8 A;  4YYW A; 
#chains in the Genus database with same CATH homology
 2P86 A;  5CVN B;  2G8J A;  1CTE A;  2G7Y A;  1QOL A;  2PBH A;  2R9C A;  4FIP A;  1W4T A;  4CZW A;  2NQA A;  1PPP A;  2GHU A;  2FO5 A;  4C5P A;  3IHP A;  3MHH A;  1POP A;  1KFU L;  3BWK A;  1F29 A;  2YJC A;  3H89 A;  3NHE A;  1NL6 A;  1YVB A;  2Y6E A;  2DCC A;  2VFC A;  3S3R A;  4BGF A;  2AYN A;  3PDF A;  4PP1 A;  1YK8 A;  3KSE A;  4N4Z A;  1TLO A;  2FQ9 A;  1U9W A;  4YYQ A;  2JQF R;  2R9N A;  1YAL A;  1AU2 A;  4CDE B;  1VJV A;  2E00 A;  4BQV A;  2XU3 A;  1Y08 A;  2FRA A;  1EWO A;  4I05 A;  1BY8 A;  1PCI A;  4XUI A;  1CPJ A;  3N4C A;  1PPN A;  4X6J A;  4BPV A;  1EWL A;  3IEJ A;  4HWY A;  3P5X A;  2PNS A;  3CH2 X;  1GEC E;  2YJB A;  3LXS A;  5PAD A;  2OP3 A;  4NV7 A;  2F7D A;  1CV8 A;  1GX3 A;  3AI8 A;  1YT7 A;  1MHW A;  4RY2 A;  1EWM A;  3QJ3 A;  3S3Q A;  4BS5 A;  2DC9 A;  4CDD B;  1ITO A;  3KW9 A;  1DF0 A;  4MSX A;  3MTN A;  3H8C A;  4OEL A;  3OVX A;  2R6N A;  3B79 A;  3H8B A;  4NV8 A;  1NPZ A;  4QBB A;  5K16 A;  1GCB A;  3K9M A;  5EGW A;  3KFQ A;  4Q8H A;  4N8W A;  4XR7 A;  1EWP A;  4YYS A;  3H7D A;  2PAD A;  4YYU A;  3M99 A;  5F02 A;  3BOW A;  2FYE A;  5CVM A;  3IUT A;  1F2B A;  1U9V A;  4YYV A;  3LTW A;  3RVX A;  1ATK A;  4GUZ A;  2XU1 A;  8PCH A;  2FRQ A;  1CQD A;  2E02 A;  2FUD A;  3QT4 A;  2B1M A;  3WXF A;  1AYU A;  2VHS A;  3V6C A;  2VFB A;  4W5B A;  2O6X A;  2AYO A;  1TL9 A;  2JQG R;  4PI3 A;  2HHN A;  5JA7 A;  1NB5 A;  1PAD A;  1QXP A;  5J94 A;  2YJ2 A;  1PPO A;  3OF9 A;  1Y4H A;  6PAD A;  2VHF A;  3HD3 A;  3WXE A;  2CB5 A;  1CSB B;  3OVZ A;  1AU0 A;  2ARY A;  4K7C A;  5JH3 A;  1BGO A;  1F2A A;  2CIO A;  4W4U A;  4PAD A;  1DEU A;  3USV A;  3PNR A;  2DJG B;  3OIS A;  3PBH A;  3DF0 A;  1MIR A;  4X6H A;  1FH0 A;  2DC8 A;  3LFY A;  2Y5B A;  1E2T A;  1K3B B;  2IPP B;  1MEG A;  3ERV A;  1CB5 A;  3IMA A;  4QH6 A;  4P6G A;  2NQD B;  1STF E;  3I3T A;  3RVW A;  2HD5 A;  3BCN A;  3BPM A;  3KKU A;  1MDW A;  3MOR A;  3CBJ A;  3K8U A;  3H6S A;  2HXZ A;  1AYV A;  1W6F A;  1CVZ A;  1X9Y A;  3P5W A;  2OZ2 A;  2FT2 A;  5FPW A;  5CVO B;  1GMY A;  2BDZ A;  1F2C A;  3C9E A;  3HHI A;  5CHT A;  1U9Q X;  1NLJ A;  3RVV A;  4YVA A;  2P7U A;  1O0E A;  2WBF X;  3KX1 A;  1MS6 A;  3K24 A;  3HHA A;  1PE6 A;  4YV8 A;  2R9O A;  1JQP A;  3V6E A;  2AUX A;  2F1G A;  4CDC B;  4BS6 A;  2BSZ A;  4FJC A;  2GFO A;  4MZO A;  4I04 A;  3BC3 A;  3ZUA A;  5EF4 A;  3N3K A;  3E1Z B;  1MEM A;  1TU6 A;  2H7J A;  1YK7 A;  2G6D A;  4Q8G A;  1ME4 A;  3TNX A;  3O0U A;  2DCA A;  1EF7 A;  3O1G A;  1QDQ A;  4AXM A;  2AVW A;  2ACT A;  4YYR A;  3GCB A;  2YJ8 A;  3F75 A;  3D6S A;  4MZS A;  4X6I A;  4KLB A;  2BDL A;  1ZCM A;  3WXG A;  4AXL A;  2DZY A;  1PPD A;  3P5V A;  3N3G A;  2AS8 A;  4P6E A;  2R9F A;  4ZUX U;  3BPF A;  3KWB X;  1U9X A;  3PW3 A;  1IWD A;  2ATO A;  3U8E A;  4QRX A;  1HUC B;  2C0Y A;  3CBK A;  4CDF B;  4W5C A;  3I06 A;  2DCB A;  1CS8 A;  1M6D A;  4BSQ A;  2G8E A;  1AU3 A;  3QSD A;  3CH3 X;  2E01 A;  1ME3 A;  1SP4 B;  1A6R A;  2XU5 A;  1NB3 A;  1Q6K A;  1PBH A;  1KFX L;  1QMY A;  1S4V A;  4PP2 E;  2B1N A;  3P5U A;  4WA6 A;  2NQI A;  2DC7 A;  2E03 A;  1XKG A;  2DC6 A;  3MHS A;  1PXV A;  2AUZ A;  2R9M A;  1THE A;  2AIM A;  3HWN A;  4I07 A;  4QRG A;  2YJ9 A;  3IV2 A;  2DJF B;  9PAP A;  2HH5 A;  7PCK A;  1PIP A;  5CHV A;  1U5I A;  1ZIV A;  2PRE A;  3F5V A;  3OF8 A;  1VSN A;  4DMY A;  2IBI A;  2FTD A;  5A24 A;  1AIM A;  4FK5 A;  1BP4 A;  1SNK A;  2DCD A;  2NQG A;  3D9W A;  2DZZ A;  4DMX A;  4N79 A;  1GLO A;  1KHQ A;  4OEM A;  2OUL A;  4G54 A;  1NQC A;  2AU1 A;  1ICF A;  4B55 A;  1AU4 A;  3IOQ A;  2P0R A;  1AYW A;  1KHP A;  1CJL A;  2XU4 A;  1AEC A;  1W5R A;  3KWZ A;  1BQI A;  4QRV A;  1KXR A;  4YYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...