2AYNA

Structure of usp14, a proteasome-associated deubiquitinating enzyme
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
383
structure length
337
Chain Sequence
b'MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 85
structure length 337
sequence length 383
chains with identical sequence B, C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aynA00
2AYOA 3KSEA 2YJ2A 3BPMA 3BPFA 3PNRA 1ICFA 1AECA 4RY2A 2XU3A 3H6SA 1YK8A 2B1NA 1GMYA 1EWPA 2AU1A 5CVMA 1VJVA 3HWNA 3CH2X 1XKGA 5CVOB 4N79A 3KWZA 1EWLA 1QOLA 1ZIVA 1QDQA 2DCCA 2YJ8A 1PE6A 2BDLA 4PADA 5CHTA 3QSDA 1POPA 2ATOA 2ACTA 3K9MA 1IWDA 1EWMA 2JQGR 3V6CA 2DC6A 2AUZA 4QH6A 1A6RA 1PIPA 2NQAA 2H7JA 3RVXA 2AYNA 3KX1A 1FH0A 3E1ZB 1X9YA 3C9EA 3RVVA 9PAPA 1F2BA 1EWOA 1TU6A 3M99A 2OP3A 3WXEA 1CS8A 1YT7A 4DMYA 4I07A 4YYSA 1F29A 1CVZA 1U9WA 3OISA 3BOWA 3IOQA 4YV8A 2NQGA 5JH3A 4P6EA 1U9QX 3AI8A 1NPZA 3F5VA 1Q6KA 1MHWA 2CIOA 2R9CA 2XU4A 5J94A 1ATKA 4CDEB 3H8CA 4BPVA 2G8JA 1GECE 2FRAA 2B1MA 4X6IA 4AXLA 4MSXA 3ERVA 4P6GA 2OULA 1BQIA 4DMXA 2FRQA 2XU1A 1BP4A 3S3RA 5JA7A 4ZUXU 5F02A 4CDFB 2VHFA 2BDZA 1TL9A 4MZOA 1U9VA 2HHNA 1QXPA 3QJ3A 3LFYA 1AYVA 4MZSA 1MEGA 2E00A 4YYVA 1U9XA 4QBBA 1NQCA 4N4ZA 3B79A 1K3BB 1GCBA 4QRXA 1CJLA 3IEJA 4WA6A 4PP1A 4W5BA 3OVZA 4I05A 1F2AA 5CVNB 1DEUA 3IMAA 3MTNA 3OVXA 2C0YA 1AYWA 1CB5A 1YVBA 4G54A 4YVAA 3BC3A 3LXSA 1CPJA 3QT4A 2PADA 1STFE 1BY8A 1AU3A 3O0UA 2DCDA 5A24A 4OEMA 4BSQA 4QRGA 3I3TA 2DJGB 2FYEA 2PREA 3PBHA 2YJBA 4BQVA 3USVA 1CSBB 3K8UA 3F75A 2WBFX 1MDWA 3KFQA 1PBHA 3CH3X 1PADA 1CTEA 2HD5A 4W5CA 1PPPA 3NHEA 1CV8A 8PCHA 4W4UA 2R6NA 4FIPA 4X6HA 1ME3A 2P0RA 2F1GA 3P5UA 2G7YA 2CB5A 3BWKA 2VHSA 4BS5A 4PI3A 2G6DA 2YJ9A 1PPNA 1AIMA 4FJCA 1NL6A 1KXRA 2AS8A 2HH5A 4N8WA 4I04A 1JQPA 2OZ2A 2E03A 1MS6A 3D6SA 3DF0A 4YYRA 1EF7A 1KHPA 2O6XA 2FTDA 2R9MA 2FO5A 2E02A 2PNSA 2R9FA 2G8EA 3OF9A 1KFXL 4HWYA 3U8EA 2P7UA 1NB3A 3HD3A 2DC8A 1HUCB 1CQDA 3I06A 2DCAA 1KFUL 3MHSA 3H8BA 5FPWA 3N3KA 2FQ9A 3N4CA 1PCIA 3KKUA 1M6DA 1NB5A 3WXFA 1PPDA 4BS6A 3IUTA 4QRVA 1THEA 3HHAA 3K24A 4YYWA 1QMYA 3GCBA 2Y6EA 1U5IA 3KW9A 4KLBA 1S4VA 2NQDB 3CBJA 3V6EA 4Q8GA 3P5XA 3MHHA 4OELA 1Y08A 3IHPA 6PADA 4CZWA 1O0EA 1F2CA 2FT2A 3RVWA 1AU0A 1SNKA 3P5VA 3N3GA 4YYUA 5PADA 3MORA 1DF0A 3S3QA 3HHIA 1YK7A 2NQIA 3PDFA 5K16A 2IBIA 1ITOA 3TNXA 2IPPB 3H89A 2DC9A 3P5WA 1NLJA 2E01A 2DJFB 2P86A 4CDCB 3PW3A 7PCKA 3H7DA 1PPOA 4Q8HA 1PXVA 1ME4A 2PBHA 3WXGA 2DC7A 1KHQA 2F7DA 3KWBX 2AVWA 1MIRA 4X6JA 2Y5BA 4AXMA 1BGOA 1AYUA 2JQFR 1GLOA 4CDDB 3IV2A 1VSNA 2AUXA 2R9OA 1TLOA 4XR7A 4K7CA 3ZUAA 2GHUA 4FK5A 1AU2A 2AIMA 2DCBA 2ARYA 3CBKA 5EF4A 1Y4HA 2R9NA 4PP2E 2YJCA 2FUDA 2DZYA 3OF8A 2DZZA 1SP4B 4YYQA 3O1GA 1MEMA 1YALA 3BCNA 5CHVA 2XU5A 4XUIA 1AU4A 2HXZA 2GFOA 5EGWA 1ZCMA
chains in the Genus database with same CATH superfamily
2AYOA 3KSEA 2YJ2A 3BPMA 3BPFA 3PNRA 1ICFA 1AECA 4RY2A 2XU3A 3H6SA 1YK8A 3TRKA 2B1NA 4MM3B 1GMYA 1EWPA 2AU1A 5CVMA 2BU3A 1VJVA 3HWNA 3CH2X 3PSEA 1XKGA 5CVOB 4N79A 3KWZA 1EWLA 1QOLA 1ZIVA 1QDQA 2DCCA 2YJ8A 1PE6A 2BDLA 4PADA 5CHTA 1PVJA 1POPA 2ATOA 2Z84A 3QSDA 2ACTA 3K9MA 1IWDA 1EWMA 2JQGR 3B21A 3V6CA 2DC6A 3PRPA 2AUZA 4QH6A 1A6RA 1PIPA 2NQAA 2H7JA 3OQCA 3RVXA 2AYNA 4M0WA 3KX1A 1FH0A 3E1ZB 1X9YA 4BOQA 4HXDB 3C9EA 3RVVA 9PAPA 1F2BA 1EWOA 1TU6A 3M99A 3O65A 2OP3A 3WXEA 1CS8A 1YT7A 4DMYA 4I07A 4YYSA 1DKIA 1F29A 4MI7A 4A5UA 1CVZA 1U9WA 3OISA 3BOWA 3IOQA 4BOUA 2HWKA 4OW0A 4YV8A 2NQGA 5JH3A 1U9QX 4P6EA 3AI8A 1NPZA 3F5VA 1Q6KA 1MHWA 5E6JA 2CIOA 2R9CA 2XU4A 5J94A 1ATKA 4CDEB 2DOSA 3H8CA 4IP3A 4BPVA 2G8JA 1GECE 2FRAA 2B1MA 4X6IA 4D8BA 4AXLA 4MSXA 3ERVA 4P6GA 2OULA 1BQIA 2UZJA 4DMXA 2FRQA 2XU1A 1BP4A 3S3RA 5JA7A 4ZUXU 5F02A 4CDFB 2VHFA 2BDZA 1TL9A 4MZOA 1U9VA 2HHNA 4IUMA 1QXPA 3QJ3A 3LFYA 1AYVA 3C0RA 1MEGA 4MZSA 4BOZA 2E00A 4YYVA 2JRIA 1U9XA 4QBBA 4D8IA 1NQCA 4N4ZA 3B79A 4RF1A 1K3BB 1GCBA 4QRXA 1CJLA 3IEJA 4WA6A 3MJ5A 4PP1A 5KO3A 3MTVA 4W5BA 3OVZA 1YZBA 4I05A 1F2AA 5CVNB 1DEUA 3IMAA 3MTNA 3OVXA 2C0YA 1AYWA 1CB5A 1YVBA 4G54A 4YVAA 3BC3A 3LXSA 1CPJA 3QT4A 3BB7A 2PADA 1STFE 3BBAA 1BY8A 1AU3A 3O0UA 4BOSA 2DCDA 5A24A 4OEMA 4BSQA 4QRGA 3I3TA 2DJGB 2FYEA 2PREA 3PBHA 4OVZB 4P16A 2YJBA 4BQVA 3USVA 1CSBB 3K8UA 3F75A 2WBFX 1MDWA 3KFQA 2BTWB 1PBHA 3CH3X 1PADA 1CTEA 4RF0A 2HD5A 4W5CA 1PPPA 3NHEA 1CV8A 8PCHA 3BY4A 4W4UA 2R6NA 3PRMA 4FIPA 4X6HA 1ME3A 2P0RA 2F1GA 3P5UA 2G7YA 2CB5A 3BWKA 2VHSA 4BS5A 4PI3A 2G6DA 2YJ9A 3ZNHA 1PPNA 1AIMA 4FJCA 1NL6A 1KXRA 2AS8A 2HH5A 4N8WA 4I04A 1JQPA 2OZ2A 2E03A 4RKXA 1MS6A 3D6SA 3DF0A 4YYRA 1EF7A 1KHPA 2O6XA 2FTDA 2R9MA 2FO5A 2E02A 2PNSA 2R9FA 2G8EA 3OF9A 3PHWA 1KFXL 4HWYA 3U8EA 3W31A 3TMPA 2P7UA 1NB3A 3HD3A 2DC8A 1HUCB 1CQDA 3I06A 2DCAA 1KFUL 4R3DA 3MHSA 3H8BA 5FPWA 3IFUA 3N3KA 2FQ9A 3W30A 3N4CA 1PCIA 3KKUA 1M6DA 1NB5A 3WXFA 1PPDA 4BS6A 3IUTA 2J7QA 4QRVA 1THEA 3HHAA 3K24A 4YYWA 1QMYA 3GCBA 2Y6EA 1U5IA 3KW9A 4KLBA 1S4VA 2NQDB 3CBJA 3V6EA 4Q8GA 3P5XA 3MHHA 4OELA 4D8EA 3PT2A 1Y08A 3IHPA 6PADA 5EZQA 4CZWA 3RNVA 1O0EA 1F2CA 2FT2A 3RVWA 1AU0A 1SNKA 4ZTBA 3E9SA 3P5VA 3N3GA 4YYUA 5PADA 3MORA 1DF0A 3S3QA 3HHIA 1YK7A 4PT5A 2NQIA 3PDFA 5K16A 2IBIA 1ITOA 3TNXA 2IPPB 3MP2A 4BOPA 3H89A 2DC9A 3P5WA 1NLJA 2E01A 2DJFB 2P86A 4CDCB 3PW3A 7PCKA 3H7DA 1PPOA 4Q8HA 1PXVA 1ME4A 2PBHA 5EZSA 3WXGA 2DC7A 1KHQA 2F7DA 3KWBX 4OVZA 2AVWA 1MIRA 4X6JA 2J7QC 4RNAA 4GUAA 2FE8A 2Y5BA 4AXMA 1BGOA 1AYUA 2JQFR 1GLOA 4CDDB 2BTWA 3IV2A 1VSNA 2AUXA 2R9OA 4WURA 1TLOA 4XR7A 3PHUA 4K7CA 3ZUAA 2GHUA 4FK5A 1AU2A 2AIMA 2DCBA 2ARYA 3CBKA 5EF4A 1Y4HA 2R9NA 3PHXA 4REZA 4PP2E 1UKFA 2YJCA 2FUDA 2DZYA 3OF8A 2DZZA 1SP4B 4YYQA 3O1GA 2JTCA 4XZXA 1MEMA 1YALA 3BCNA 5CHVA 2XU5A 4XUIA 5JZEA 1AU4A 2HXZA 2GFOA 5EGWA 2AGAA 1ZCMA
chains in the Genus database with same CATH topology
2AYOA 3KSEA 2YJ2A 3BPMA 4B55A 3BPFA 3PNRA 1ICFA 2VFBA 1AECA 4RY2A 2XU3A 3H6SA 1YK8A 2B1NA 1GMYA 1EWPA 2AU1A 5CVMA 1VJVA 3HWNA 3CH2X 1XKGA 5CVOB 1E2TA 4N79A 3KWZA 1EWLA 1QOLA 1ZIVA 1QDQA 2DCCA 2YJ8A 1PE6A 2BDLA 4PADA 5CHTA 3QSDA 1POPA 2ATOA 2ACTA 3K9MA 1IWDA 1EWMA 2JQGR 3V6CA 4GUZA 2DC6A 2AUZA 4QH6A 1A6RA 1PIPA 2NQAA 2H7JA 3RVXA 2AYNA 3KX1A 1FH0A 3E1ZB 1X9YA 3C9EA 3RVVA 9PAPA 1F2BA 1EWOA 1TU6A 4C5PA 3M99A 2OP3A 3WXEA 1CS8A 1YT7A 4DMYA 4I07A 4YYSA 1F29A 1CVZA 4BGFA 1U9WA 3OISA 3BOWA 3IOQA 4YV8A 2NQGA 5JH3A 1U9QX 4P6EA 3AI8A 1NPZA 3F5VA 1Q6KA 1MHWA 2CIOA 2R9CA 2XU4A 5J94A 1ATKA 4CDEB 3H8CA 4BPVA 2G8JA 1GECE 2FRAA 2B1MA 4X6IA 4AXLA 4MSXA 3ERVA 4P6GA 2OULA 1BQIA 4DMXA 2FRQA 2XU1A 1BP4A 3S3RA 5JA7A 4ZUXU 5F02A 4CDFB 2VHFA 1W5RA 2BDZA 1TL9A 4MZOA 1U9VA 2HHNA 1QXPA 3QJ3A 3LFYA 1AYVA 4MZSA 1MEGA 2E00A 4YYVA 1U9XA 4QBBA 1NQCA 4N4ZA 3B79A 1K3BB 1GCBA 4QRXA 1CJLA 3IEJA 4WA6A 4PP1A 1GX3A 4W5BA 3LTWA 3OVZA 4I05A 1F2AA 5CVNB 1DEUA 3IMAA 2BSZA 3MTNA 3OVXA 2C0YA 1AYWA 1CB5A 1YVBA 4G54A 4YVAA 3BC3A 3LXSA 1CPJA 3QT4A 2PADA 1STFE 1BY8A 1AU3A 3O0UA 2DCDA 5A24A 4OEMA 4BSQA 1W6FA 4QRGA 4NV7A 2VFCA 3I3TA 2DJGB 2FYEA 2PREA 3PBHA 2YJBA 4BQVA 3USVA 1CSBB 3K8UA 3F75A 2WBFX 1MDWA 3KFQA 1PBHA 3CH3X 1PADA 1CTEA 2HD5A 4W5CA 1PPPA 3NHEA 1CV8A 8PCHA 4W4UA 2R6NA 4FIPA 4X6HA 1ME3A 2P0RA 2F1GA 3P5UA 2G7YA 2CB5A 3BWKA 2VHSA 3D9WA 4BS5A 4PI3A 2G6DA 2YJ9A 1PPNA 1AIMA 4FJCA 1NL6A 1KXRA 2AS8A 2HH5A 4N8WA 4I04A 1JQPA 2OZ2A 2E03A 1MS6A 3D6SA 3DF0A 4YYRA 1EF7A 1KHPA 2O6XA 2FTDA 2R9MA 2FO5A 2E02A 2PNSA 2R9FA 2G8EA 3OF9A 1KFXL 4HWYA 3U8EA 2P7UA 1NB3A 3HD3A 2DC8A 1HUCB 1CQDA 3I06A 2DCAA 1KFUL 3MHSA 3H8BA 5FPWA 3N3KA 2FQ9A 3N4CA 1PCIA 3KKUA 1M6DA 1NB5A 3WXFA 1PPDA 4BS6A 3IUTA 4QRVA 1THEA 3HHAA 3K24A 4YYWA 1QMYA 3GCBA 2Y6EA 1U5IA 3KW9A 4KLBA 1S4VA 2NQDB 3CBJA 3V6EA 4Q8GA 3P5XA 3MHHA 1W4TA 4OELA 1Y08A 3IHPA 6PADA 4CZWA 1O0EA 1F2CA 2FT2A 3RVWA 1AU0A 1SNKA 3P5VA 3N3GA 4YYUA 5PADA 3MORA 1DF0A 3S3QA 3HHIA 1YK7A 2NQIA 3PDFA 5K16A 2IBIA 1ITOA 3TNXA 2IPPB 3H89A 2DC9A 3P5WA 1NLJA 2E01A 2DJFB 2P86A 4CDCB 3PW3A 7PCKA 3H7DA 1PPOA 4Q8HA 1PXVA 1ME4A 2PBHA 3WXGA 2DC7A 1KHQA 2F7DA 3KWBX 2AVWA 1MIRA 4X6JA 2Y5BA 4AXMA 1BGOA 1AYUA 2JQFR 1GLOA 4CDDB 4NV8A 3IV2A 1VSNA 2AUXA 2R9OA 1TLOA 4XR7A 4K7CA 3ZUAA 2GHUA 4FK5A 1AU2A 2AIMA 2DCBA 2ARYA 3CBKA 5EF4A 1Y4HA 2R9NA 4PP2E 2YJCA 2FUDA 2DZYA 3OF8A 2DZZA 1SP4B 4YYQA 3O1GA 1MEMA 1YALA 3BCNA 5CHVA 2XU5A 4XUIA 1AU4A 2HXZA 2GFOA 5EGWA 1ZCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYO A;  3KSE A;  2YJ2 A;  3BPM A;  3BPF A;  3PNR A;  1ICF A;  1AEC A;  4RY2 A;  2XU3 A;  3H6S A;  1YK8 A;  2B1N A;  1GMY A;  1EWP A;  2AU1 A;  5CVM A;  1VJV A;  3HWN A;  3CH2 X;  1XKG A;  5CVO B;  4N79 A;  3KWZ A;  1EWL A;  1QOL A;  1ZIV A;  1QDQ A;  2DCC A;  2YJ8 A;  1PE6 A;  2BDL A;  4PAD A;  5CHT A;  3QSD A;  1POP A;  2ATO A;  2ACT A;  3K9M A;  1IWD A;  1EWM A;  2JQG R;  3V6C A;  2DC6 A;  2AUZ A;  4QH6 A;  1A6R A;  1PIP A;  2NQA A;  2H7J A;  3RVX A;  2AYN A;  3KX1 A;  1FH0 A;  3E1Z B;  1X9Y A;  3C9E A;  3RVV A;  9PAP A;  1F2B A;  1EWO A;  1TU6 A;  3M99 A;  2OP3 A;  3WXE A;  1CS8 A;  1YT7 A;  4DMY A;  4I07 A;  4YYS A;  1F29 A;  1CVZ A;  1U9W A;  3OIS A;  3BOW A;  3IOQ A;  4YV8 A;  2NQG A;  5JH3 A;  4P6E A;  1U9Q X;  3AI8 A;  1NPZ A;  3F5V A;  1Q6K A;  1MHW A;  2CIO A;  2R9C A;  2XU4 A;  5J94 A;  1ATK A;  4CDE B;  3H8C A;  4BPV A;  2G8J A;  1GEC E;  2FRA A;  2B1M A;  4X6I A;  4AXL A;  4MSX A;  3ERV A;  4P6G A;  2OUL A;  1BQI A;  4DMX A;  2FRQ A;  2XU1 A;  1BP4 A;  3S3R A;  5JA7 A;  4ZUX U;  5F02 A;  4CDF B;  2VHF A;  2BDZ A;  1TL9 A;  4MZO A;  1U9V A;  2HHN A;  1QXP A;  3QJ3 A;  3LFY A;  1AYV A;  4MZS A;  1MEG A;  2E00 A;  4YYV A;  1U9X A;  4QBB A;  1NQC A;  4N4Z A;  3B79 A;  1K3B B;  1GCB A;  4QRX A;  1CJL A;  3IEJ A;  4WA6 A;  4PP1 A;  4W5B A;  3OVZ A;  4I05 A;  1F2A A;  5CVN B;  1DEU A;  3IMA A;  3MTN A;  3OVX A;  2C0Y A;  1AYW A;  1CB5 A;  1YVB A;  4G54 A;  4YVA A;  3BC3 A;  3LXS A;  1CPJ A;  3QT4 A;  2PAD A;  1STF E;  1BY8 A;  1AU3 A;  3O0U A;  2DCD A;  5A24 A;  4OEM A;  4BSQ A;  4QRG A;  3I3T A;  2DJG B;  2FYE A;  2PRE A;  3PBH A;  2YJB A;  4BQV A;  3USV A;  1CSB B;  3K8U A;  3F75 A;  2WBF X;  1MDW A;  3KFQ A;  1PBH A;  3CH3 X;  1PAD A;  1CTE A;  2HD5 A;  4W5C A;  1PPP A;  3NHE A;  1CV8 A;  8PCH A;  4W4U A;  2R6N A;  4FIP A;  4X6H A;  1ME3 A;  2P0R A;  2F1G A;  3P5U A;  2G7Y A;  2CB5 A;  3BWK A;  2VHS A;  4BS5 A;  4PI3 A;  2G6D A;  2YJ9 A;  1PPN A;  1AIM A;  4FJC A;  1NL6 A;  1KXR A;  2AS8 A;  2HH5 A;  4N8W A;  4I04 A;  1JQP A;  2OZ2 A;  2E03 A;  1MS6 A;  3D6S A;  3DF0 A;  4YYR A;  1EF7 A;  1KHP A;  2O6X A;  2FTD A;  2R9M A;  2FO5 A;  2E02 A;  2PNS A;  2R9F A;  2G8E A;  3OF9 A;  1KFX L;  4HWY A;  3U8E A;  2P7U A;  1NB3 A;  3HD3 A;  2DC8 A;  1HUC B;  1CQD A;  3I06 A;  2DCA A;  1KFU L;  3MHS A;  3H8B A;  5FPW A;  3N3K A;  2FQ9 A;  3N4C A;  1PCI A;  3KKU A;  1M6D A;  1NB5 A;  3WXF A;  1PPD A;  4BS6 A;  3IUT A;  4QRV A;  1THE A;  3HHA A;  3K24 A;  4YYW A;  1QMY A;  3GCB A;  2Y6E A;  1U5I A;  3KW9 A;  4KLB A;  1S4V A;  2NQD B;  3CBJ A;  3V6E A;  4Q8G A;  3P5X A;  3MHH A;  4OEL A;  1Y08 A;  3IHP A;  6PAD A;  4CZW A;  1O0E A;  1F2C A;  2FT2 A;  3RVW A;  1AU0 A;  1SNK A;  3P5V A;  3N3G A;  4YYU A;  5PAD A;  3MOR A;  1DF0 A;  3S3Q A;  3HHI A;  1YK7 A;  2NQI A;  3PDF A;  5K16 A;  2IBI A;  1ITO A;  3TNX A;  2IPP B;  3H89 A;  2DC9 A;  3P5W A;  1NLJ A;  2E01 A;  2DJF B;  2P86 A;  4CDC B;  3PW3 A;  7PCK A;  3H7D A;  1PPO A;  4Q8H A;  1PXV A;  1ME4 A;  2PBH A;  3WXG A;  2DC7 A;  1KHQ A;  2F7D A;  3KWB X;  2AVW A;  1MIR A;  4X6J A;  2Y5B A;  4AXM A;  1BGO A;  1AYU A;  2JQF R;  1GLO A;  4CDD B;  3IV2 A;  1VSN A;  2AUX A;  2R9O A;  1TLO A;  4XR7 A;  4K7C A;  3ZUA A;  2GHU A;  4FK5 A;  1AU2 A;  2AIM A;  2DCB A;  2ARY A;  3CBK A;  5EF4 A;  1Y4H A;  2R9N A;  4PP2 E;  2YJC A;  2FUD A;  2DZY A;  3OF8 A;  2DZZ A;  1SP4 B;  4YYQ A;  3O1G A;  1MEM A;  1YAL A;  3BCN A;  5CHV A;  2XU5 A;  4XUI A;  1AU4 A;  2HXZ A;  2GFO A;  5EGW A;  1ZCM A; 
#chains in the Genus database with same CATH topology
 2AYO A;  3KSE A;  2YJ2 A;  3BPM A;  3BPF A;  3PNR A;  1ICF A;  1AEC A;  4RY2 A;  2XU3 A;  3H6S A;  1YK8 A;  3TRK A;  2B1N A;  4MM3 B;  1GMY A;  1EWP A;  2AU1 A;  5CVM A;  2BU3 A;  1VJV A;  3HWN A;  3CH2 X;  3PSE A;  1XKG A;  5CVO B;  4N79 A;  3KWZ A;  1EWL A;  1QOL A;  1ZIV A;  1QDQ A;  2DCC A;  2YJ8 A;  1PE6 A;  2BDL A;  4PAD A;  5CHT A;  1PVJ A;  1POP A;  2ATO A;  2Z84 A;  3QSD A;  2ACT A;  3K9M A;  1IWD A;  1EWM A;  2JQG R;  3B21 A;  3V6C A;  2DC6 A;  3PRP A;  2AUZ A;  4QH6 A;  1A6R A;  1PIP A;  2NQA A;  2H7J A;  3OQC A;  3RVX A;  2AYN A;  4M0W A;  3KX1 A;  1FH0 A;  3E1Z B;  1X9Y A;  4BOQ A;  4HXD B;  3C9E A;  3RVV A;  9PAP A;  1F2B A;  1EWO A;  1TU6 A;  3M99 A;  3O65 A;  2OP3 A;  3WXE A;  1CS8 A;  1YT7 A;  4DMY A;  4I07 A;  4YYS A;  1DKI A;  1F29 A;  4MI7 A;  4A5U A;  1CVZ A;  1U9W A;  3OIS A;  3BOW A;  3IOQ A;  4BOU A;  2HWK A;  4OW0 A;  4YV8 A;  2NQG A;  5JH3 A;  1U9Q X;  4P6E A;  3AI8 A;  1NPZ A;  3F5V A;  1Q6K A;  1MHW A;  5E6J A;  2CIO A;  2R9C A;  2XU4 A;  5J94 A;  1ATK A;  4CDE B;  2DOS A;  3H8C A;  4IP3 A;  4BPV A;  2G8J A;  1GEC E;  2FRA A;  2B1M A;  4X6I A;  4D8B A;  4AXL A;  4MSX A;  3ERV A;  4P6G A;  2OUL A;  1BQI A;  2UZJ A;  4DMX A;  2FRQ A;  2XU1 A;  1BP4 A;  3S3R A;  5JA7 A;  4ZUX U;  5F02 A;  4CDF B;  2VHF A;  2BDZ A;  1TL9 A;  4MZO A;  1U9V A;  2HHN A;  4IUM A;  1QXP A;  3QJ3 A;  3LFY A;  1AYV A;  3C0R A;  1MEG A;  4MZS A;  4BOZ A;  2E00 A;  4YYV A;  2JRI A;  1U9X A;  4QBB A;  4D8I A;  1NQC A;  4N4Z A;  3B79 A;  4RF1 A;  1K3B B;  1GCB A;  4QRX A;  1CJL A;  3IEJ A;  4WA6 A;  3MJ5 A;  4PP1 A;  5KO3 A;  3MTV A;  4W5B A;  3OVZ A;  1YZB A;  4I05 A;  1F2A A;  5CVN B;  1DEU A;  3IMA A;  3MTN A;  3OVX A;  2C0Y A;  1AYW A;  1CB5 A;  1YVB A;  4G54 A;  4YVA A;  3BC3 A;  3LXS A;  1CPJ A;  3QT4 A;  3BB7 A;  2PAD A;  1STF E;  3BBA A;  1BY8 A;  1AU3 A;  3O0U A;  4BOS A;  2DCD A;  5A24 A;  4OEM A;  4BSQ A;  4QRG A;  3I3T A;  2DJG B;  2FYE A;  2PRE A;  3PBH A;  4OVZ B;  4P16 A;  2YJB A;  4BQV A;  3USV A;  1CSB B;  3K8U A;  3F75 A;  2WBF X;  1MDW A;  3KFQ A;  2BTW B;  1PBH A;  3CH3 X;  1PAD A;  1CTE A;  4RF0 A;  2HD5 A;  4W5C A;  1PPP A;  3NHE A;  1CV8 A;  8PCH A;  3BY4 A;  4W4U A;  2R6N A;  3PRM A;  4FIP A;  4X6H A;  1ME3 A;  2P0R A;  2F1G A;  3P5U A;  2G7Y A;  2CB5 A;  3BWK A;  2VHS A;  4BS5 A;  4PI3 A;  2G6D A;  2YJ9 A;  3ZNH A;  1PPN A;  1AIM A;  4FJC A;  1NL6 A;  1KXR A;  2AS8 A;  2HH5 A;  4N8W A;  4I04 A;  1JQP A;  2OZ2 A;  2E03 A;  4RKX A;  1MS6 A;  3D6S A;  3DF0 A;  4YYR A;  1EF7 A;  1KHP A;  2O6X A;  2FTD A;  2R9M A;  2FO5 A;  2E02 A;  2PNS A;  2R9F A;  2G8E A;  3OF9 A;  3PHW A;  1KFX L;  4HWY A;  3U8E A;  3W31 A;  3TMP A;  2P7U A;  1NB3 A;  3HD3 A;  2DC8 A;  1HUC B;  1CQD A;  3I06 A;  2DCA A;  1KFU L;  4R3D A;  3MHS A;  3H8B A;  5FPW A;  3IFU A;  3N3K A;  2FQ9 A;  3W30 A;  3N4C A;  1PCI A;  3KKU A;  1M6D A;  1NB5 A;  3WXF A;  1PPD A;  4BS6 A;  3IUT A;  2J7Q A;  4QRV A;  1THE A;  3HHA A;  3K24 A;  4YYW A;  1QMY A;  3GCB A;  2Y6E A;  1U5I A;  3KW9 A;  4KLB A;  1S4V A;  2NQD B;  3CBJ A;  3V6E A;  4Q8G A;  3P5X A;  3MHH A;  4OEL A;  4D8E A;  3PT2 A;  1Y08 A;  3IHP A;  6PAD A;  5EZQ A;  4CZW A;  3RNV A;  1O0E A;  1F2C A;  2FT2 A;  3RVW A;  1AU0 A;  1SNK A;  4ZTB A;  3E9S A;  3P5V A;  3N3G A;  4YYU A;  5PAD A;  3MOR A;  1DF0 A;  3S3Q A;  3HHI A;  1YK7 A;  4PT5 A;  2NQI A;  3PDF A;  5K16 A;  2IBI A;  1ITO A;  3TNX A;  2IPP B;  3MP2 A;  4BOP A;  3H89 A;  2DC9 A;  3P5W A;  1NLJ A;  2E01 A;  2DJF B;  2P86 A;  4CDC B;  3PW3 A;  7PCK A;  3H7D A;  1PPO A;  4Q8H A;  1PXV A;  1ME4 A;  2PBH A;  5EZS A;  3WXG A;  2DC7 A;  1KHQ A;  2F7D A;  3KWB X;  4OVZ A;  2AVW A;  1MIR A;  4X6J A;  2J7Q C;  4RNA A;  4GUA A;  2FE8 A;  2Y5B A;  4AXM A;  1BGO A;  1AYU A;  2JQF R;  1GLO A;  4CDD B;  2BTW A;  3IV2 A;  1VSN A;  2AUX A;  2R9O A;  4WUR A;  1TLO A;  4XR7 A;  3PHU A;  4K7C A;  3ZUA A;  2GHU A;  4FK5 A;  1AU2 A;  2AIM A;  2DCB A;  2ARY A;  3CBK A;  5EF4 A;  1Y4H A;  2R9N A;  3PHX A;  4REZ A;  4PP2 E;  1UKF A;  2YJC A;  2FUD A;  2DZY A;  3OF8 A;  2DZZ A;  1SP4 B;  4YYQ A;  3O1G A;  2JTC A;  4XZX A;  1MEM A;  1YAL A;  3BCN A;  5CHV A;  2XU5 A;  4XUI A;  5JZE A;  1AU4 A;  2HXZ A;  2GFO A;  5EGW A;  2AGA A;  1ZCM A; 
#chains in the Genus database with same CATH homology
 2AYO A;  3KSE A;  2YJ2 A;  3BPM A;  4B55 A;  3BPF A;  3PNR A;  1ICF A;  2VFB A;  1AEC A;  4RY2 A;  2XU3 A;  3H6S A;  1YK8 A;  2B1N A;  1GMY A;  1EWP A;  2AU1 A;  5CVM A;  1VJV A;  3HWN A;  3CH2 X;  1XKG A;  5CVO B;  1E2T A;  4N79 A;  3KWZ A;  1EWL A;  1QOL A;  1ZIV A;  1QDQ A;  2DCC A;  2YJ8 A;  1PE6 A;  2BDL A;  4PAD A;  5CHT A;  3QSD A;  1POP A;  2ATO A;  2ACT A;  3K9M A;  1IWD A;  1EWM A;  2JQG R;  3V6C A;  4GUZ A;  2DC6 A;  2AUZ A;  4QH6 A;  1A6R A;  1PIP A;  2NQA A;  2H7J A;  3RVX A;  2AYN A;  3KX1 A;  1FH0 A;  3E1Z B;  1X9Y A;  3C9E A;  3RVV A;  9PAP A;  1F2B A;  1EWO A;  1TU6 A;  4C5P A;  3M99 A;  2OP3 A;  3WXE A;  1CS8 A;  1YT7 A;  4DMY A;  4I07 A;  4YYS A;  1F29 A;  1CVZ A;  4BGF A;  1U9W A;  3OIS A;  3BOW A;  3IOQ A;  4YV8 A;  2NQG A;  5JH3 A;  1U9Q X;  4P6E A;  3AI8 A;  1NPZ A;  3F5V A;  1Q6K A;  1MHW A;  2CIO A;  2R9C A;  2XU4 A;  5J94 A;  1ATK A;  4CDE B;  3H8C A;  4BPV A;  2G8J A;  1GEC E;  2FRA A;  2B1M A;  4X6I A;  4AXL A;  4MSX A;  3ERV A;  4P6G A;  2OUL A;  1BQI A;  4DMX A;  2FRQ A;  2XU1 A;  1BP4 A;  3S3R A;  5JA7 A;  4ZUX U;  5F02 A;  4CDF B;  2VHF A;  1W5R A;  2BDZ A;  1TL9 A;  4MZO A;  1U9V A;  2HHN A;  1QXP A;  3QJ3 A;  3LFY A;  1AYV A;  4MZS A;  1MEG A;  2E00 A;  4YYV A;  1U9X A;  4QBB A;  1NQC A;  4N4Z A;  3B79 A;  1K3B B;  1GCB A;  4QRX A;  1CJL A;  3IEJ A;  4WA6 A;  4PP1 A;  1GX3 A;  4W5B A;  3LTW A;  3OVZ A;  4I05 A;  1F2A A;  5CVN B;  1DEU A;  3IMA A;  2BSZ A;  3MTN A;  3OVX A;  2C0Y A;  1AYW A;  1CB5 A;  1YVB A;  4G54 A;  4YVA A;  3BC3 A;  3LXS A;  1CPJ A;  3QT4 A;  2PAD A;  1STF E;  1BY8 A;  1AU3 A;  3O0U A;  2DCD A;  5A24 A;  4OEM A;  4BSQ A;  1W6F A;  4QRG A;  4NV7 A;  2VFC A;  3I3T A;  2DJG B;  2FYE A;  2PRE A;  3PBH A;  2YJB A;  4BQV A;  3USV A;  1CSB B;  3K8U A;  3F75 A;  2WBF X;  1MDW A;  3KFQ A;  1PBH A;  3CH3 X;  1PAD A;  1CTE A;  2HD5 A;  4W5C A;  1PPP A;  3NHE A;  1CV8 A;  8PCH A;  4W4U A;  2R6N A;  4FIP A;  4X6H A;  1ME3 A;  2P0R A;  2F1G A;  3P5U A;  2G7Y A;  2CB5 A;  3BWK A;  2VHS A;  3D9W A;  4BS5 A;  4PI3 A;  2G6D A;  2YJ9 A;  1PPN A;  1AIM A;  4FJC A;  1NL6 A;  1KXR A;  2AS8 A;  2HH5 A;  4N8W A;  4I04 A;  1JQP A;  2OZ2 A;  2E03 A;  1MS6 A;  3D6S A;  3DF0 A;  4YYR A;  1EF7 A;  1KHP A;  2O6X A;  2FTD A;  2R9M A;  2FO5 A;  2E02 A;  2PNS A;  2R9F A;  2G8E A;  3OF9 A;  1KFX L;  4HWY A;  3U8E A;  2P7U A;  1NB3 A;  3HD3 A;  2DC8 A;  1HUC B;  1CQD A;  3I06 A;  2DCA A;  1KFU L;  3MHS A;  3H8B A;  5FPW A;  3N3K A;  2FQ9 A;  3N4C A;  1PCI A;  3KKU A;  1M6D A;  1NB5 A;  3WXF A;  1PPD A;  4BS6 A;  3IUT A;  4QRV A;  1THE A;  3HHA A;  3K24 A;  4YYW A;  1QMY A;  3GCB A;  2Y6E A;  1U5I A;  3KW9 A;  4KLB A;  1S4V A;  2NQD B;  3CBJ A;  3V6E A;  4Q8G A;  3P5X A;  3MHH A;  1W4T A;  4OEL A;  1Y08 A;  3IHP A;  6PAD A;  4CZW A;  1O0E A;  1F2C A;  2FT2 A;  3RVW A;  1AU0 A;  1SNK A;  3P5V A;  3N3G A;  4YYU A;  5PAD A;  3MOR A;  1DF0 A;  3S3Q A;  3HHI A;  1YK7 A;  2NQI A;  3PDF A;  5K16 A;  2IBI A;  1ITO A;  3TNX A;  2IPP B;  3H89 A;  2DC9 A;  3P5W A;  1NLJ A;  2E01 A;  2DJF B;  2P86 A;  4CDC B;  3PW3 A;  7PCK A;  3H7D A;  1PPO A;  4Q8H A;  1PXV A;  1ME4 A;  2PBH A;  3WXG A;  2DC7 A;  1KHQ A;  2F7D A;  3KWB X;  2AVW A;  1MIR A;  4X6J A;  2Y5B A;  4AXM A;  1BGO A;  1AYU A;  2JQF R;  1GLO A;  4CDD B;  4NV8 A;  3IV2 A;  1VSN A;  2AUX A;  2R9O A;  1TLO A;  4XR7 A;  4K7C A;  3ZUA A;  2GHU A;  4FK5 A;  1AU2 A;  2AIM A;  2DCB A;  2ARY A;  3CBK A;  5EF4 A;  1Y4H A;  2R9N A;  4PP2 E;  2YJC A;  2FUD A;  2DZY A;  3OF8 A;  2DZZ A;  1SP4 B;  4YYQ A;  3O1G A;  1MEM A;  1YAL A;  3BCN A;  5CHV A;  2XU5 A;  4XUI A;  1AU4 A;  2HXZ A;  2GFO A;  5EGW A;  1ZCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...