2AYNA

Structure of usp14, a proteasome-associated deubiquitinating enzyme
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
383
structure length
337
Chain Sequence
MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 14
total genus 85
structure length 337
sequence length 383
chains with identical sequence B, C
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2aynA00
3V6EA 5FPWA 3CBJA 2AVWA 3PDFA 1PBHA 3IHPA 2FUDA 3E1ZB 1ZCMA 2DC7A 4MZSA 2P86A 5CHTA 3C9EA 2DJFB 2F7DA 4FIPA 3ZUAA 3RVWA 1PPDA 1MEGA 1F2AA 2WBFX 4RY2A 2ARYA 1CJLA 3QT4A 2CIOA 1KHQA 1QXPA 1SP4B 1AIMA 4DMYA 2VHFA 4X6HA 3KX1A 1AYUA 1YT7A 2XU4A 3KWZA 4PI3A 3O0UA 1QDQA 4YV8A 2BDZA 1IWDA 4BSQA 4BPVA 2P7UA 3BWKA 2DC9A 8PCHA 1PIPA 3KKUA 5EF4A 2DJGB 2PBHA 1MDWA 2R6NA 2P0RA 1S4VA 1F29A 2GFOA 1BQIA 2BDLA 2YJ2A 3H7DA 3IUTA 3K9MA 4Q8GA 3WXFA 3I06A 4MSXA 3H6SA 1FH0A 3DF0A 2CB5A 3U8EA 2PNSA 1GCBA 1STFE 4K7CA 4CDCB 1TL9A 2DC6A 2Y6EA 3MORA 1U9QX 3BOWA 3KFQA 5CVMA 4N8WA 2FQ9A 3IV2A 2AYNA 3IMAA 2AS8A 4AXLA 1CVZA 1AU4A 1Q6KA 4WA6A 3ERVA 4QRGA 3M99A 1U9XA 4HWYA 4YYSA 4FJCA 2VHSA 2R9FA 3P5UA 4YYWA 3RVVA 1CB5A 3HHAA 3AI8A 2AIMA 2NQAA 5CHVA 4CZWA 1NLJA 3TNXA 4X6JA 1DEUA 1PADA 1EF7A 3KWBX 2IPPB 3S3QA 2R9CA 2XU5A 4I07A 3P5VA 3OVXA 1CV8A 1AU0A 2ATOA 1ATKA 4CDEB 3HHIA 3V6CA 1AECA 1SNKA 2JQFR 2YJBA 4W4UA 3I3TA 1NB5A 3N3KA 9PAPA 2AU1A 5JA7A 1BP4A 2G7YA 1THEA 2XU1A 2HH5A 3OF8A 4XUIA 3HWNA 2DCCA 3OISA 4KLBA 1NQCA 1ITOA 1ZIVA 2DZZA 2OP3A 1MIRA 3LXSA 1KFXL 3OVZA 2YJ8A 1O0EA 2NQGA 1NB3A 4G54A 3K24A 1U5IA 4QBBA 1YALA 3GCBA 3KSEA 1CS8A 1PE6A 1PPOA 1KXRA 2R9OA 2FRAA 2YJ9A 4OEMA 1ME4A 3H8BA 3QSDA 4YYQA 1AYVA 4MZOA 1Y08A 4CDFB 5JH3A 2FRQA 2AUZA 3USVA 4PP1A 1X9YA 2G8JA 1ICFA 4YVAA 3MTNA 1F2CA 2OULA 2DCDA 4QH6A 2NQDB 1YK7A 1TU6A 1U9VA 1GMYA 1AU2A 2H7JA 1VJVA 1CQDA 1MHWA 1PXVA 1YVBA 2HXZA 3BCNA 3N3GA 4BQVA 1JQPA 3O1GA 4YYUA 1POPA 4P6GA 2DCAA 2E02A 1EWLA 4W5CA 4BS6A 4DMXA 4I05A 3H89A 5F02A 2PREA 2E03A 3MHHA 1XKGA 3LFYA 1VSNA 2B1NA 2AYOA 1KHPA 1PCIA 3BPMA 4FK5A 4PP2E 2G8EA 5CVNB 3D6SA 2DC8A 5A24A 1BY8A 1MS6A 3IOQA 3P5WA 1HUCB 5EGWA 3CH2X 1GECE 3PW3A 3WXGA 3CH3X 1F2BA 3RVXA 2JQGR 1PPPA 4PADA 2FYEA 3S3RA 3WXEA 2R9MA 1Y4HA 1CPJA 2R9NA 2OZ2A 3IEJA 3HD3A 1QOLA 1A6RA 3N4CA 1PPNA 2HD5A 3K8UA 3OF9A 1DF0A 4QRXA 3B79A 4QRVA 1TLOA 1YK8A 4CDDB 2E01A 2O6XA 7PCKA 4AXMA 1EWPA 3H8CA 1CSBB 5CVOB 4P6EA 6PADA 4N4ZA 4BS5A 1AU3A 4N79A 2YJCA 3P5XA 3BC3A 4Q8HA 3PBHA 3BPFA 1KFUL 1K3BB 2G6DA 3NHEA 2E00A 2Y5BA 1NL6A 2HHNA 5K16A 4X6IA 1ME3A 4YYVA 1AYWA 2PADA 1MEMA 4I04A 1M6DA 1U9WA 2C0YA 1EWOA 2FTDA 2F1GA 5PADA 2ACTA 2DZYA 2XU3A 3QJ3A 2GHUA 3KW9A 1QMYA 5J94A 4ZUXU 2FT2A 1GLOA 1BGOA 4XR7A 3F5VA 3PNRA 4W5BA 2DCBA 4YYRA 1NPZA 2AUXA 1CTEA 2B1MA 2NQIA 3F75A 2FO5A 2IBIA 3CBKA 1EWMA 4OELA 3MHSA
chains in the Genus database with same CATH superfamily
3V6EA 5FPWA 3CBJA 2AVWA 3PDFA 1PBHA 3IHPA 2FUDA 3E1ZB 1ZCMA 2DC7A 4MZSA 2P86A 5CHTA 3C9EA 2DJFB 2J7QA 2BTWB 2F7DA 4FIPA 3ZUAA 3RVWA 2AGAA 1PPDA 1MEGA 1F2AA 2WBFX 3W31A 3MJ5A 4RY2A 2ARYA 3O65A 1CJLA 3QT4A 2CIOA 1KHQA 1QXPA 1SP4B 4GUAA 1AIMA 4DMYA 2VHFA 4X6HA 3KX1A 4ZTBA 2DOSA 1AYUA 1YT7A 2XU4A 3KWZA 4PI3A 3O0UA 1QDQA 4YV8A 2BDZA 1IWDA 4BSQA 4BPVA 3W30A 3BB7A 2P7UA 4RF0A 3BWKA 2DC9A 3PHUA 8PCHA 4M0WA 1PIPA 3KKUA 5EF4A 2DJGB 2PBHA 1MDWA 4D8BA 2R6NA 2P0RA 1S4VA 4WURA 1F29A 2GFOA 1BQIA 2BDLA 2JTCA 2YJ2A 3H7DA 3IUTA 3K9MA 4Q8GA 3WXFA 3I06A 4MSXA 3H6SA 1FH0A 3DF0A 2CB5A 3U8EA 4BOPA 2PNSA 1GCBA 1STFE 4K7CA 4CDCB 1TL9A 2DC6A 2Y6EA 3MORA 1U9QX 3BY4A 3IFUA 3BOWA 3KFQA 5CVMA 3MP2A 4N8WA 2FQ9A 3IV2A 2AYNA 3IMAA 4R3DA 2AS8A 4AXLA 1CVZA 1AU4A 4A5UA 4OVZA 4BOUA 1Q6KA 4WA6A 3ERVA 4QRGA 3M99A 1U9XA 4BOZA 4HWYA 4YYSA 4FJCA 2VHSA 2R9FA 3P5UA 4YYWA 3RVVA 1CB5A 3HHAA 3AI8A 4RNAA 2AIMA 2NQAA 5CHVA 4CZWA 1NLJA 3PT2A 3TNXA 4IUMA 4X6JA 1DEUA 2BTWA 1PADA 1EF7A 3KWBX 5EZSA 2IPPB 3S3QA 2R9CA 2XU5A 4I07A 3P5VA 3OVXA 4MI7A 1CV8A 1AU0A 2ATOA 1ATKA 4CDEB 3HHIA 3V6CA 1AECA 1SNKA 2JQFR 2YJBA 4W4UA 3I3TA 1NB5A 3N3KA 9PAPA 2AU1A 5JA7A 1BP4A 3B21A 4D8IA 2G7YA 1THEA 2XU1A 2HH5A 3OF8A 4XUIA 3HWNA 2HWKA 2DCCA 3OISA 4KLBA 1NQCA 1ITOA 1ZIVA 2DZZA 2OP3A 3PHXA 1MIRA 3LXSA 1KFXL 3OVZA 2YJ8A 1O0EA 2NQGA 1NB3A 4G54A 3K24A 1U5IA 4QBBA 1YALA 3GCBA 5EZQA 3KSEA 1CS8A 3TMPA 1PE6A 1PPOA 1KXRA 2R9OA 2FRAA 2YJ9A 4OEMA 1ME4A 3H8BA 3QSDA 4YYQA 1AYVA 4MZOA 1Y08A 4CDFB 5JH3A 2FRQA 2AUZA 3USVA 4PP1A 1X9YA 2G8JA 1ICFA 4YVAA 3MTNA 2J7QC 1F2CA 2OULA 2DCDA 4QH6A 3E9SA 2NQDB 3BBAA 1YK7A 1TU6A 1U9VA 1GMYA 1AU2A 2H7JA 1DKIA 1VJVA 1CQDA 1MHWA 1PXVA 1YVBA 2HXZA 3BCNA 3N3GA 4BQVA 1JQPA 3O1GA 4YYUA 1POPA 4P6GA 2DCAA 2E02A 1EWLA 4OVZB 4W5CA 4BS6A 4DMXA 4I05A 3H89A 5F02A 2PREA 3PSEA 4BOSA 2E03A 3MHHA 4MM3B 1XKGA 3LFYA 2JRIA 1VSNA 2B1NA 3PRPA 2AYOA 1KHPA 1PCIA 3BPMA 2Z84A 4FK5A 4PP2E 2G8EA 5CVNB 5KO3A 3D6SA 1YZBA 2DC8A 4D8EA 4HXDB 5A24A 1BY8A 1MS6A 3IOQA 3P5WA 1HUCB 5EGWA 3CH2X 1GECE 3PW3A 4RF1A 3WXGA 3CH3X 1F2BA 3RVXA 2JQGR 1PPPA 4PADA 2FYEA 3S3RA 3WXEA 5JZEA 2R9MA 4P16A 1Y4HA 1CPJA 2R9NA 3C0RA 2OZ2A 3PHWA 3IEJA 3HD3A 1QOLA 4XZXA 4BOQA 4REZA 1A6RA 4IP3A 3N4CA 1PPNA 2HD5A 3K8UA 3OF9A 4OW0A 1DF0A 4QRXA 3B79A 4QRVA 1TLOA 1YK8A 4CDDB 2E01A 2O6XA 7PCKA 4AXMA 3RNVA 1EWPA 3H8CA 3ZNHA 1CSBB 5CVOB 4P6EA 6PADA 4N4ZA 4BS5A 1AU3A 4N79A 2YJCA 3P5XA 3BC3A 4Q8HA 3PBHA 2FE8A 3BPFA 1KFUL 1K3BB 2G6DA 3NHEA 4RKXA 1PVJA 2E00A 2Y5BA 1NL6A 2HHNA 5K16A 4X6IA 1ME3A 4YYVA 1AYWA 2PADA 1MEMA 4I04A 1M6DA 1U9WA 2C0YA 1EWOA 2FTDA 2F1GA 5PADA 2ACTA 1UKFA 2DZYA 2XU3A 3QJ3A 2GHUA 3KW9A 1QMYA 3MTVA 5J94A 3TRKA 4ZUXU 2FT2A 1GLOA 4PT5A 5E6JA 1BGOA 4XR7A 3F5VA 3PNRA 3OQCA 4W5BA 2DCBA 4YYRA 1NPZA 2AUXA 1CTEA 3PRMA 2B1MA 2NQIA 3F75A 2FO5A 2IBIA 3CBKA 1EWMA 4OELA 2UZJA 2BU3A 3MHSA
chains in the Genus database with same CATH topology
4GUZA 3V6EA 5FPWA 3CBJA 2AVWA 3PDFA 1PBHA 3IHPA 2FUDA 3E1ZB 1ZCMA 2DC7A 4MZSA 2P86A 5CHTA 3C9EA 4B55A 2DJFB 2F7DA 4FIPA 3ZUAA 3RVWA 1PPDA 1MEGA 1F2AA 2WBFX 4RY2A 2ARYA 1CJLA 3QT4A 2CIOA 1KHQA 1QXPA 1SP4B 1AIMA 4DMYA 2VFBA 2VHFA 4X6HA 3KX1A 1AYUA 1YT7A 2XU4A 3KWZA 4PI3A 3O0UA 1QDQA 4YV8A 2BDZA 1IWDA 4BSQA 4BPVA 2P7UA 3BWKA 2DC9A 8PCHA 1PIPA 3KKUA 5EF4A 2DJGB 2PBHA 1MDWA 2R6NA 2P0RA 1S4VA 1F29A 2GFOA 1BQIA 3D9WA 2BDLA 2YJ2A 3H7DA 3IUTA 1GX3A 3K9MA 4Q8GA 3WXFA 1W5RA 3I06A 4MSXA 3H6SA 1FH0A 3DF0A 2CB5A 3U8EA 2PNSA 1GCBA 1STFE 2BSZA 4K7CA 4CDCB 1TL9A 2DC6A 2Y6EA 3MORA 1U9QX 3BOWA 3KFQA 5CVMA 4N8WA 2FQ9A 3IV2A 2AYNA 3IMAA 4NV7A 2AS8A 4AXLA 1CVZA 1AU4A 1Q6KA 4WA6A 3ERVA 4QRGA 3M99A 1U9XA 4HWYA 4YYSA 4FJCA 2VHSA 2R9FA 3P5UA 4YYWA 3RVVA 1CB5A 3HHAA 3AI8A 2AIMA 2NQAA 5CHVA 4CZWA 1NLJA 2VFCA 3TNXA 4X6JA 1DEUA 1PADA 1EF7A 3KWBX 2IPPB 3S3QA 2R9CA 2XU5A 4I07A 3P5VA 3OVXA 1CV8A 1AU0A 2ATOA 1ATKA 4CDEB 3HHIA 3V6CA 1AECA 1SNKA 2JQFR 2YJBA 4W4UA 3I3TA 1NB5A 3N3KA 9PAPA 2AU1A 5JA7A 1BP4A 2G7YA 1THEA 2XU1A 2HH5A 3OF8A 4XUIA 3HWNA 2DCCA 3OISA 4KLBA 1NQCA 1ITOA 1ZIVA 2DZZA 2OP3A 1MIRA 1W6FA 3LXSA 1KFXL 3OVZA 2YJ8A 1O0EA 2NQGA 1NB3A 4G54A 3K24A 1U5IA 4QBBA 1YALA 3GCBA 3KSEA 1CS8A 1PE6A 1PPOA 1KXRA 2R9OA 2FRAA 2YJ9A 4OEMA 1ME4A 3H8BA 3QSDA 4YYQA 1AYVA 4MZOA 1Y08A 4CDFB 5JH3A 2FRQA 2AUZA 3USVA 4PP1A 1X9YA 2G8JA 1ICFA 4YVAA 3MTNA 1F2CA 2OULA 2DCDA 4QH6A 4BGFA 2NQDB 1YK7A 1TU6A 1U9VA 1GMYA 1AU2A 2H7JA 1VJVA 1CQDA 1MHWA 1PXVA 1YVBA 2HXZA 3BCNA 3N3GA 4BQVA 1JQPA 3O1GA 4YYUA 1E2TA 1POPA 4P6GA 2DCAA 2E02A 1EWLA 4W5CA 4BS6A 4DMXA 4I05A 1W4TA 3H89A 5F02A 2PREA 2E03A 3MHHA 1XKGA 3LFYA 1VSNA 2B1NA 2AYOA 1KHPA 1PCIA 3BPMA 4FK5A 4PP2E 2G8EA 5CVNB 3D6SA 2DC8A 4C5PA 5A24A 1BY8A 1MS6A 3IOQA 3P5WA 1HUCB 5EGWA 3CH2X 1GECE 3PW3A 3WXGA 3CH3X 1F2BA 3RVXA 2JQGR 1PPPA 4PADA 2FYEA 3S3RA 3WXEA 2R9MA 1Y4HA 1CPJA 2R9NA 2OZ2A 3IEJA 3HD3A 1QOLA 1A6RA 3N4CA 1PPNA 2HD5A 3K8UA 3OF9A 1DF0A 4QRXA 3B79A 4QRVA 1TLOA 1YK8A 4CDDB 2E01A 2O6XA 7PCKA 4AXMA 1EWPA 3H8CA 1CSBB 5CVOB 4P6EA 6PADA 4N4ZA 4BS5A 1AU3A 4N79A 2YJCA 3P5XA 3BC3A 4Q8HA 3PBHA 3BPFA 1KFUL 1K3BB 2G6DA 3NHEA 2E00A 2Y5BA 1NL6A 2HHNA 5K16A 4X6IA 1ME3A 4YYVA 1AYWA 2PADA 1MEMA 4I04A 1M6DA 1U9WA 2C0YA 1EWOA 2FTDA 2F1GA 5PADA 2ACTA 2DZYA 2XU3A 3QJ3A 2GHUA 3KW9A 1QMYA 5J94A 4ZUXU 3LTWA 2FT2A 1GLOA 4NV8A 1BGOA 4XR7A 3F5VA 3PNRA 4W5BA 2DCBA 4YYRA 1NPZA 2AUXA 1CTEA 2B1MA 2NQIA 3F75A 2FO5A 2IBIA 3CBKA 1EWMA 4OELA 3MHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6E A;  5FPW A;  3CBJ A;  2AVW A;  3PDF A;  1PBH A;  3IHP A;  2FUD A;  3E1Z B;  1ZCM A;  2DC7 A;  4MZS A;  2P86 A;  5CHT A;  3C9E A;  2DJF B;  2F7D A;  4FIP A;  3ZUA A;  3RVW A;  1PPD A;  1MEG A;  1F2A A;  2WBF X;  4RY2 A;  2ARY A;  1CJL A;  3QT4 A;  2CIO A;  1KHQ A;  1QXP A;  1SP4 B;  1AIM A;  4DMY A;  2VHF A;  4X6H A;  3KX1 A;  1AYU A;  1YT7 A;  2XU4 A;  3KWZ A;  4PI3 A;  3O0U A;  1QDQ A;  4YV8 A;  2BDZ A;  1IWD A;  4BSQ A;  4BPV A;  2P7U A;  3BWK A;  2DC9 A;  8PCH A;  1PIP A;  3KKU A;  5EF4 A;  2DJG B;  2PBH A;  1MDW A;  2R6N A;  2P0R A;  1S4V A;  1F29 A;  2GFO A;  1BQI A;  2BDL A;  2YJ2 A;  3H7D A;  3IUT A;  3K9M A;  4Q8G A;  3WXF A;  3I06 A;  4MSX A;  3H6S A;  1FH0 A;  3DF0 A;  2CB5 A;  3U8E A;  2PNS A;  1GCB A;  1STF E;  4K7C A;  4CDC B;  1TL9 A;  2DC6 A;  2Y6E A;  3MOR A;  1U9Q X;  3BOW A;  3KFQ A;  5CVM A;  4N8W A;  2FQ9 A;  3IV2 A;  2AYN A;  3IMA A;  2AS8 A;  4AXL A;  1CVZ A;  1AU4 A;  1Q6K A;  4WA6 A;  3ERV A;  4QRG A;  3M99 A;  1U9X A;  4HWY A;  4YYS A;  4FJC A;  2VHS A;  2R9F A;  3P5U A;  4YYW A;  3RVV A;  1CB5 A;  3HHA A;  3AI8 A;  2AIM A;  2NQA A;  5CHV A;  4CZW A;  1NLJ A;  3TNX A;  4X6J A;  1DEU A;  1PAD A;  1EF7 A;  3KWB X;  2IPP B;  3S3Q A;  2R9C A;  2XU5 A;  4I07 A;  3P5V A;  3OVX A;  1CV8 A;  1AU0 A;  2ATO A;  1ATK A;  4CDE B;  3HHI A;  3V6C A;  1AEC A;  1SNK A;  2JQF R;  2YJB A;  4W4U A;  3I3T A;  1NB5 A;  3N3K A;  9PAP A;  2AU1 A;  5JA7 A;  1BP4 A;  2G7Y A;  1THE A;  2XU1 A;  2HH5 A;  3OF8 A;  4XUI A;  3HWN A;  2DCC A;  3OIS A;  4KLB A;  1NQC A;  1ITO A;  1ZIV A;  2DZZ A;  2OP3 A;  1MIR A;  3LXS A;  1KFX L;  3OVZ A;  2YJ8 A;  1O0E A;  2NQG A;  1NB3 A;  4G54 A;  3K24 A;  1U5I A;  4QBB A;  1YAL A;  3GCB A;  3KSE A;  1CS8 A;  1PE6 A;  1PPO A;  1KXR A;  2R9O A;  2FRA A;  2YJ9 A;  4OEM A;  1ME4 A;  3H8B A;  3QSD A;  4YYQ A;  1AYV A;  4MZO A;  1Y08 A;  4CDF B;  5JH3 A;  2FRQ A;  2AUZ A;  3USV A;  4PP1 A;  1X9Y A;  2G8J A;  1ICF A;  4YVA A;  3MTN A;  1F2C A;  2OUL A;  2DCD A;  4QH6 A;  2NQD B;  1YK7 A;  1TU6 A;  1U9V A;  1GMY A;  1AU2 A;  2H7J A;  1VJV A;  1CQD A;  1MHW A;  1PXV A;  1YVB A;  2HXZ A;  3BCN A;  3N3G A;  4BQV A;  1JQP A;  3O1G A;  4YYU A;  1POP A;  4P6G A;  2DCA A;  2E02 A;  1EWL A;  4W5C A;  4BS6 A;  4DMX A;  4I05 A;  3H89 A;  5F02 A;  2PRE A;  2E03 A;  3MHH A;  1XKG A;  3LFY A;  1VSN A;  2B1N A;  2AYO A;  1KHP A;  1PCI A;  3BPM A;  4FK5 A;  4PP2 E;  2G8E A;  5CVN B;  3D6S A;  2DC8 A;  5A24 A;  1BY8 A;  1MS6 A;  3IOQ A;  3P5W A;  1HUC B;  5EGW A;  3CH2 X;  1GEC E;  3PW3 A;  3WXG A;  3CH3 X;  1F2B A;  3RVX A;  2JQG R;  1PPP A;  4PAD A;  2FYE A;  3S3R A;  3WXE A;  2R9M A;  1Y4H A;  1CPJ A;  2R9N A;  2OZ2 A;  3IEJ A;  3HD3 A;  1QOL A;  1A6R A;  3N4C A;  1PPN A;  2HD5 A;  3K8U A;  3OF9 A;  1DF0 A;  4QRX A;  3B79 A;  4QRV A;  1TLO A;  1YK8 A;  4CDD B;  2E01 A;  2O6X A;  7PCK A;  4AXM A;  1EWP A;  3H8C A;  1CSB B;  5CVO B;  4P6E A;  6PAD A;  4N4Z A;  4BS5 A;  1AU3 A;  4N79 A;  2YJC A;  3P5X A;  3BC3 A;  4Q8H A;  3PBH A;  3BPF A;  1KFU L;  1K3B B;  2G6D A;  3NHE A;  2E00 A;  2Y5B A;  1NL6 A;  2HHN A;  5K16 A;  4X6I A;  1ME3 A;  4YYV A;  1AYW A;  2PAD A;  1MEM A;  4I04 A;  1M6D A;  1U9W A;  2C0Y A;  1EWO A;  2FTD A;  2F1G A;  5PAD A;  2ACT A;  2DZY A;  2XU3 A;  3QJ3 A;  2GHU A;  3KW9 A;  1QMY A;  5J94 A;  4ZUX U;  2FT2 A;  1GLO A;  1BGO A;  4XR7 A;  3F5V A;  3PNR A;  4W5B A;  2DCB A;  4YYR A;  1NPZ A;  2AUX A;  1CTE A;  2B1M A;  2NQI A;  3F75 A;  2FO5 A;  2IBI A;  3CBK A;  1EWM A;  4OEL A;  3MHS A; 
#chains in the Genus database with same CATH topology
 3V6E A;  5FPW A;  3CBJ A;  2AVW A;  3PDF A;  1PBH A;  3IHP A;  2FUD A;  3E1Z B;  1ZCM A;  2DC7 A;  4MZS A;  2P86 A;  5CHT A;  3C9E A;  2DJF B;  2J7Q A;  2BTW B;  2F7D A;  4FIP A;  3ZUA A;  3RVW A;  2AGA A;  1PPD A;  1MEG A;  1F2A A;  2WBF X;  3W31 A;  3MJ5 A;  4RY2 A;  2ARY A;  3O65 A;  1CJL A;  3QT4 A;  2CIO A;  1KHQ A;  1QXP A;  1SP4 B;  4GUA A;  1AIM A;  4DMY A;  2VHF A;  4X6H A;  3KX1 A;  4ZTB A;  2DOS A;  1AYU A;  1YT7 A;  2XU4 A;  3KWZ A;  4PI3 A;  3O0U A;  1QDQ A;  4YV8 A;  2BDZ A;  1IWD A;  4BSQ A;  4BPV A;  3W30 A;  3BB7 A;  2P7U A;  4RF0 A;  3BWK A;  2DC9 A;  3PHU A;  8PCH A;  4M0W A;  1PIP A;  3KKU A;  5EF4 A;  2DJG B;  2PBH A;  1MDW A;  4D8B A;  2R6N A;  2P0R A;  1S4V A;  4WUR A;  1F29 A;  2GFO A;  1BQI A;  2BDL A;  2JTC A;  2YJ2 A;  3H7D A;  3IUT A;  3K9M A;  4Q8G A;  3WXF A;  3I06 A;  4MSX A;  3H6S A;  1FH0 A;  3DF0 A;  2CB5 A;  3U8E A;  4BOP A;  2PNS A;  1GCB A;  1STF E;  4K7C A;  4CDC B;  1TL9 A;  2DC6 A;  2Y6E A;  3MOR A;  1U9Q X;  3BY4 A;  3IFU A;  3BOW A;  3KFQ A;  5CVM A;  3MP2 A;  4N8W A;  2FQ9 A;  3IV2 A;  2AYN A;  3IMA A;  4R3D A;  2AS8 A;  4AXL A;  1CVZ A;  1AU4 A;  4A5U A;  4OVZ A;  4BOU A;  1Q6K A;  4WA6 A;  3ERV A;  4QRG A;  3M99 A;  1U9X A;  4BOZ A;  4HWY A;  4YYS A;  4FJC A;  2VHS A;  2R9F A;  3P5U A;  4YYW A;  3RVV A;  1CB5 A;  3HHA A;  3AI8 A;  4RNA A;  2AIM A;  2NQA A;  5CHV A;  4CZW A;  1NLJ A;  3PT2 A;  3TNX A;  4IUM A;  4X6J A;  1DEU A;  2BTW A;  1PAD A;  1EF7 A;  3KWB X;  5EZS A;  2IPP B;  3S3Q A;  2R9C A;  2XU5 A;  4I07 A;  3P5V A;  3OVX A;  4MI7 A;  1CV8 A;  1AU0 A;  2ATO A;  1ATK A;  4CDE B;  3HHI A;  3V6C A;  1AEC A;  1SNK A;  2JQF R;  2YJB A;  4W4U A;  3I3T A;  1NB5 A;  3N3K A;  9PAP A;  2AU1 A;  5JA7 A;  1BP4 A;  3B21 A;  4D8I A;  2G7Y A;  1THE A;  2XU1 A;  2HH5 A;  3OF8 A;  4XUI A;  3HWN A;  2HWK A;  2DCC A;  3OIS A;  4KLB A;  1NQC A;  1ITO A;  1ZIV A;  2DZZ A;  2OP3 A;  3PHX A;  1MIR A;  3LXS A;  1KFX L;  3OVZ A;  2YJ8 A;  1O0E A;  2NQG A;  1NB3 A;  4G54 A;  3K24 A;  1U5I A;  4QBB A;  1YAL A;  3GCB A;  5EZQ A;  3KSE A;  1CS8 A;  3TMP A;  1PE6 A;  1PPO A;  1KXR A;  2R9O A;  2FRA A;  2YJ9 A;  4OEM A;  1ME4 A;  3H8B A;  3QSD A;  4YYQ A;  1AYV A;  4MZO A;  1Y08 A;  4CDF B;  5JH3 A;  2FRQ A;  2AUZ A;  3USV A;  4PP1 A;  1X9Y A;  2G8J A;  1ICF A;  4YVA A;  3MTN A;  2J7Q C;  1F2C A;  2OUL A;  2DCD A;  4QH6 A;  3E9S A;  2NQD B;  3BBA A;  1YK7 A;  1TU6 A;  1U9V A;  1GMY A;  1AU2 A;  2H7J A;  1DKI A;  1VJV A;  1CQD A;  1MHW A;  1PXV A;  1YVB A;  2HXZ A;  3BCN A;  3N3G A;  4BQV A;  1JQP A;  3O1G A;  4YYU A;  1POP A;  4P6G A;  2DCA A;  2E02 A;  1EWL A;  4OVZ B;  4W5C A;  4BS6 A;  4DMX A;  4I05 A;  3H89 A;  5F02 A;  2PRE A;  3PSE A;  4BOS A;  2E03 A;  3MHH A;  4MM3 B;  1XKG A;  3LFY A;  2JRI A;  1VSN A;  2B1N A;  3PRP A;  2AYO A;  1KHP A;  1PCI A;  3BPM A;  2Z84 A;  4FK5 A;  4PP2 E;  2G8E A;  5CVN B;  5KO3 A;  3D6S A;  1YZB A;  2DC8 A;  4D8E A;  4HXD B;  5A24 A;  1BY8 A;  1MS6 A;  3IOQ A;  3P5W A;  1HUC B;  5EGW A;  3CH2 X;  1GEC E;  3PW3 A;  4RF1 A;  3WXG A;  3CH3 X;  1F2B A;  3RVX A;  2JQG R;  1PPP A;  4PAD A;  2FYE A;  3S3R A;  3WXE A;  5JZE A;  2R9M A;  4P16 A;  1Y4H A;  1CPJ A;  2R9N A;  3C0R A;  2OZ2 A;  3PHW A;  3IEJ A;  3HD3 A;  1QOL A;  4XZX A;  4BOQ A;  4REZ A;  1A6R A;  4IP3 A;  3N4C A;  1PPN A;  2HD5 A;  3K8U A;  3OF9 A;  4OW0 A;  1DF0 A;  4QRX A;  3B79 A;  4QRV A;  1TLO A;  1YK8 A;  4CDD B;  2E01 A;  2O6X A;  7PCK A;  4AXM A;  3RNV A;  1EWP A;  3H8C A;  3ZNH A;  1CSB B;  5CVO B;  4P6E A;  6PAD A;  4N4Z A;  4BS5 A;  1AU3 A;  4N79 A;  2YJC A;  3P5X A;  3BC3 A;  4Q8H A;  3PBH A;  2FE8 A;  3BPF A;  1KFU L;  1K3B B;  2G6D A;  3NHE A;  4RKX A;  1PVJ A;  2E00 A;  2Y5B A;  1NL6 A;  2HHN A;  5K16 A;  4X6I A;  1ME3 A;  4YYV A;  1AYW A;  2PAD A;  1MEM A;  4I04 A;  1M6D A;  1U9W A;  2C0Y A;  1EWO A;  2FTD A;  2F1G A;  5PAD A;  2ACT A;  1UKF A;  2DZY A;  2XU3 A;  3QJ3 A;  2GHU A;  3KW9 A;  1QMY A;  3MTV A;  5J94 A;  3TRK A;  4ZUX U;  2FT2 A;  1GLO A;  4PT5 A;  5E6J A;  1BGO A;  4XR7 A;  3F5V A;  3PNR A;  3OQC A;  4W5B A;  2DCB A;  4YYR A;  1NPZ A;  2AUX A;  1CTE A;  3PRM A;  2B1M A;  2NQI A;  3F75 A;  2FO5 A;  2IBI A;  3CBK A;  1EWM A;  4OEL A;  2UZJ A;  2BU3 A;  3MHS A; 
#chains in the Genus database with same CATH homology
 4GUZ A;  3V6E A;  5FPW A;  3CBJ A;  2AVW A;  3PDF A;  1PBH A;  3IHP A;  2FUD A;  3E1Z B;  1ZCM A;  2DC7 A;  4MZS A;  2P86 A;  5CHT A;  3C9E A;  4B55 A;  2DJF B;  2F7D A;  4FIP A;  3ZUA A;  3RVW A;  1PPD A;  1MEG A;  1F2A A;  2WBF X;  4RY2 A;  2ARY A;  1CJL A;  3QT4 A;  2CIO A;  1KHQ A;  1QXP A;  1SP4 B;  1AIM A;  4DMY A;  2VFB A;  2VHF A;  4X6H A;  3KX1 A;  1AYU A;  1YT7 A;  2XU4 A;  3KWZ A;  4PI3 A;  3O0U A;  1QDQ A;  4YV8 A;  2BDZ A;  1IWD A;  4BSQ A;  4BPV A;  2P7U A;  3BWK A;  2DC9 A;  8PCH A;  1PIP A;  3KKU A;  5EF4 A;  2DJG B;  2PBH A;  1MDW A;  2R6N A;  2P0R A;  1S4V A;  1F29 A;  2GFO A;  1BQI A;  3D9W A;  2BDL A;  2YJ2 A;  3H7D A;  3IUT A;  1GX3 A;  3K9M A;  4Q8G A;  3WXF A;  1W5R A;  3I06 A;  4MSX A;  3H6S A;  1FH0 A;  3DF0 A;  2CB5 A;  3U8E A;  2PNS A;  1GCB A;  1STF E;  2BSZ A;  4K7C A;  4CDC B;  1TL9 A;  2DC6 A;  2Y6E A;  3MOR A;  1U9Q X;  3BOW A;  3KFQ A;  5CVM A;  4N8W A;  2FQ9 A;  3IV2 A;  2AYN A;  3IMA A;  4NV7 A;  2AS8 A;  4AXL A;  1CVZ A;  1AU4 A;  1Q6K A;  4WA6 A;  3ERV A;  4QRG A;  3M99 A;  1U9X A;  4HWY A;  4YYS A;  4FJC A;  2VHS A;  2R9F A;  3P5U A;  4YYW A;  3RVV A;  1CB5 A;  3HHA A;  3AI8 A;  2AIM A;  2NQA A;  5CHV A;  4CZW A;  1NLJ A;  2VFC A;  3TNX A;  4X6J A;  1DEU A;  1PAD A;  1EF7 A;  3KWB X;  2IPP B;  3S3Q A;  2R9C A;  2XU5 A;  4I07 A;  3P5V A;  3OVX A;  1CV8 A;  1AU0 A;  2ATO A;  1ATK A;  4CDE B;  3HHI A;  3V6C A;  1AEC A;  1SNK A;  2JQF R;  2YJB A;  4W4U A;  3I3T A;  1NB5 A;  3N3K A;  9PAP A;  2AU1 A;  5JA7 A;  1BP4 A;  2G7Y A;  1THE A;  2XU1 A;  2HH5 A;  3OF8 A;  4XUI A;  3HWN A;  2DCC A;  3OIS A;  4KLB A;  1NQC A;  1ITO A;  1ZIV A;  2DZZ A;  2OP3 A;  1MIR A;  1W6F A;  3LXS A;  1KFX L;  3OVZ A;  2YJ8 A;  1O0E A;  2NQG A;  1NB3 A;  4G54 A;  3K24 A;  1U5I A;  4QBB A;  1YAL A;  3GCB A;  3KSE A;  1CS8 A;  1PE6 A;  1PPO A;  1KXR A;  2R9O A;  2FRA A;  2YJ9 A;  4OEM A;  1ME4 A;  3H8B A;  3QSD A;  4YYQ A;  1AYV A;  4MZO A;  1Y08 A;  4CDF B;  5JH3 A;  2FRQ A;  2AUZ A;  3USV A;  4PP1 A;  1X9Y A;  2G8J A;  1ICF A;  4YVA A;  3MTN A;  1F2C A;  2OUL A;  2DCD A;  4QH6 A;  4BGF A;  2NQD B;  1YK7 A;  1TU6 A;  1U9V A;  1GMY A;  1AU2 A;  2H7J A;  1VJV A;  1CQD A;  1MHW A;  1PXV A;  1YVB A;  2HXZ A;  3BCN A;  3N3G A;  4BQV A;  1JQP A;  3O1G A;  4YYU A;  1E2T A;  1POP A;  4P6G A;  2DCA A;  2E02 A;  1EWL A;  4W5C A;  4BS6 A;  4DMX A;  4I05 A;  1W4T A;  3H89 A;  5F02 A;  2PRE A;  2E03 A;  3MHH A;  1XKG A;  3LFY A;  1VSN A;  2B1N A;  2AYO A;  1KHP A;  1PCI A;  3BPM A;  4FK5 A;  4PP2 E;  2G8E A;  5CVN B;  3D6S A;  2DC8 A;  4C5P A;  5A24 A;  1BY8 A;  1MS6 A;  3IOQ A;  3P5W A;  1HUC B;  5EGW A;  3CH2 X;  1GEC E;  3PW3 A;  3WXG A;  3CH3 X;  1F2B A;  3RVX A;  2JQG R;  1PPP A;  4PAD A;  2FYE A;  3S3R A;  3WXE A;  2R9M A;  1Y4H A;  1CPJ A;  2R9N A;  2OZ2 A;  3IEJ A;  3HD3 A;  1QOL A;  1A6R A;  3N4C A;  1PPN A;  2HD5 A;  3K8U A;  3OF9 A;  1DF0 A;  4QRX A;  3B79 A;  4QRV A;  1TLO A;  1YK8 A;  4CDD B;  2E01 A;  2O6X A;  7PCK A;  4AXM A;  1EWP A;  3H8C A;  1CSB B;  5CVO B;  4P6E A;  6PAD A;  4N4Z A;  4BS5 A;  1AU3 A;  4N79 A;  2YJC A;  3P5X A;  3BC3 A;  4Q8H A;  3PBH A;  3BPF A;  1KFU L;  1K3B B;  2G6D A;  3NHE A;  2E00 A;  2Y5B A;  1NL6 A;  2HHN A;  5K16 A;  4X6I A;  1ME3 A;  4YYV A;  1AYW A;  2PAD A;  1MEM A;  4I04 A;  1M6D A;  1U9W A;  2C0Y A;  1EWO A;  2FTD A;  2F1G A;  5PAD A;  2ACT A;  2DZY A;  2XU3 A;  3QJ3 A;  2GHU A;  3KW9 A;  1QMY A;  5J94 A;  4ZUX U;  3LTW A;  2FT2 A;  1GLO A;  4NV8 A;  1BGO A;  4XR7 A;  3F5V A;  3PNR A;  4W5B A;  2DCB A;  4YYR A;  1NPZ A;  2AUX A;  1CTE A;  2B1M A;  2NQI A;  3F75 A;  2FO5 A;  2IBI A;  3CBK A;  1EWM A;  4OEL A;  3MHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...