2OZ2A

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (k11777)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Vinyl sulfones as antiparasitic agents and a structural basis for drug design.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase
total genus 70
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2oz2A00
2HHNA 4YYRA 2R9MA 2DZYA 1FH0A 1F2BA 2DCDA 2NQIA 4BPVA 1IWDA 2DZZA 1EF7A 2B1NA 2ACTA 1KHQA 3O1GA 1AU2A 2DJFB 2PBHA 2FUDA 3V6EA 3IV2A 4P6EA 4I04A 1PXVA 1ME3A 1QMYA 2GHUA 1CS8A 1EWLA 1CB5A 3H8CA 1S4VA 3H89A 1U9VA 3MTNA 5PADA 4MZSA 3RVXA 4W4UA 3BPFA 4PP1A 3P5VA 3C9EA 1MEMA 3WXFA 1U9QX 2JQGR 1U5IA 1YK7A 1O0EA 3KFQA 2DC6A 4FK5A 1MIRA 1XKGA 1STFE 3V6CA 3BC3A 4PP2E 1KXRA 3K8UA 4CDFB 3PDFA 4PI3A 1MHWA 2DCBA 2NQDB 3OISA 1NPZA 1KFXL 3P5XA 3QJ3A 3MHHA 4XUIA 1A6RA 1DEUA 4CDCB 2E01A 1NQCA 3QSDA 2AIMA 1CSBB 2YJ8A 3IMAA 5JA7A 1SNKA 1HUCB 1KFUL 1K3BB 5A24A 1AIMA 3KWBX 4X6IA 4BS6A 1YK8A 2BDLA 1YVBA 1F2AA 2DCAA 4AXLA 1SP4B 5K16A 2IBIA 3CBKA 1CQDA 3F5VA 2WBFX 4YYSA 5CHTA 1GCBA 5EGWA 2P86A 1GMYA 2CB5A 1AU4A 3N3KA 5CVMA 2FRQA 3HHIA 3HHAA 2XU1A 1AYVA 1BQIA 2NQAA 3F75A 2AVWA 1F29A 4I05A 4QRVA 4PADA 3I3TA 1JQPA 2DCCA 4X6JA 3WXEA 2HH5A 1NLJA 3BPMA 3CH3X 8PCHA 1X9YA 1ICFA 2XU3A 2HXZA 1ITOA 3I06A 3MHSA 4CZWA 2F7DA 3H8BA 3ZUAA 1NB5A 4DMXA 3HWNA 4CDDB 3AI8A 1BGOA 1F2CA 1ZIVA 2R9FA 3N4CA 3P5WA 5CVNB 2ARYA 3S3RA 1VJVA 1VSNA 3KX1A 1TLOA 3OVXA 2JQFR 4QRXA 1PPDA 2HD5A 3KW9A 3PNRA 1NL6A 1AECA 1Y08A 2R9NA 1GECE 4P6GA 2DJGB 3KKUA 1NB3A 1PPNA 1CPJA 5CVOB 1EWPA 3CH2X 4MZOA 1POPA 4OEMA 4XR7A 2ATOA 2G7YA 1CVZA 1AU3A 1TU6A 4W5CA 3H6SA 2AUZA 1PE6A 3CBJA 4RY2A 2R6NA 4YYVA 4G54A 4Q8HA 5CHVA 4MSXA 3NHEA 2AS8A 3P5UA 3LXSA 1DF0A 3RVVA 3LFYA 2AUXA 4DMYA 3N3GA 3DF0A 3USVA 3B79A 2OP3A 1CV8A 1QOLA 3ERVA 1GLOA 1QXPA 3PBHA 3MORA 2R9CA 1PADA 3M99A 6PADA 4Q8GA 3IHPA 1AU0A 2GFOA 3BWKA 1M6DA 2AYOA 2B1MA 2Y5BA 2E02A 4ZUXU 1Q6KA 3IOQA 1PIPA 1QDQA 2XU4A 2NQGA 2YJCA 4N8WA 4BSQA 2OZ2A 3BCNA 4W5BA 3D6SA 1BP4A 2E03A 1ATKA 4QRGA 7PCKA 2FTDA 1EWOA 4K7CA 3HD3A 3GCBA 3BOWA 2G8JA 2FQ9A 1ZCMA 1AYWA 5F02A 2F1GA 4YYWA 3PW3A 4YVAA 3QT4A 3K24A 4FJCA 4N4ZA 3RVWA 2O6XA 2OULA 4AXMA 3OVZA 2DC7A 3OF8A 2FT2A 3OF9A 2AYNA 1TL9A 2BDZA 2YJBA 1BY8A 2VHSA 2P7UA 1THEA 2R9OA 4YYQA 4OELA 2C0YA 4CDEB 2YJ9A 2FYEA 1ME4A 3KWZA 2Y6EA 4HWYA 2CIOA 4QH6A 3K9MA 2FRAA 1PPPA 1U9WA 3O0UA 1MS6A 2E00A 3TNXA 1PCIA 5FPWA 1MEGA 4YYUA 3KSEA 2H7JA 3S3QA 2DC9A 1PBHA 4X6HA 3H7DA 2AU1A 1YT7A 1Y4HA 2IPPB 1KHPA 3WXGA 1U9XA 4FIPA 2DC8A 3IUTA 4KLBA 1PPOA 5EF4A 1MDWA 4BS5A 2PADA 4N79A 1CTEA 4BQVA 2G8EA 1CJLA 2YJ2A 4QBBA 4WA6A 2G6DA 3E1ZB 2XU5A 2PREA 4YV8A 9PAPA 2FO5A 2VHFA 4I07A 5J94A 2P0RA 1EWMA 1AYUA 5JH3A 3IEJA 1YALA 3U8EA 2PNSA
chains in the Genus database with same CATH superfamily
4XZXA 3PHXA 2HHNA 4YYRA 2R9MA 2DZYA 1FH0A 1F2BA 2DCDA 2NQIA 4BPVA 1IWDA 2DZZA 1EF7A 2B1NA 2ACTA 1KHQA 5EZQA 3O1GA 1AU2A 2DJFB 2PBHA 2FUDA 3V6EA 3IV2A 4P6EA 4I04A 1PVJA 1PXVA 3RNVA 1ME3A 1QMYA 2GHUA 1CS8A 1EWLA 1CB5A 3H8CA 1S4VA 3H89A 1U9VA 3MTNA 5PADA 4P16A 4MZSA 3RVXA 4W4UA 3BPFA 4PP1A 3P5VA 3C9EA 1MEMA 3WXFA 1U9QX 2JQGR 1U5IA 1YK7A 1O0EA 3KFQA 2DC6A 4FK5A 3W31A 3OQCA 4BOQA 4BOPA 2UZJA 1MIRA 1XKGA 1STFE 3V6CA 3BC3A 4PP2E 1KXRA 3K8UA 2AGAA 4CDFB 3PDFA 4PI3A 1MHWA 2DCBA 2NQDB 3OISA 4OVZB 3E9SA 1NPZA 1KFXL 3P5XA 3QJ3A 3MHHA 4IP3A 4XUIA 1A6RA 1DEUA 4CDCB 3BB7A 2E01A 1NQCA 3QSDA 2AIMA 1CSBB 2YJ8A 3IMAA 5JA7A 4RKXA 1SNKA 3B21A 1HUCB 1KFUL 4WURA 1K3BB 5A24A 1AIMA 3KWBX 4X6IA 4BS6A 4MI7A 1YK8A 2BDLA 1YVBA 1F2AA 3PT2A 2DCAA 4AXLA 1SP4B 5K16A 1DKIA 2IBIA 3CBKA 1CQDA 3F5VA 4BOZA 4OW0A 3PRPA 2WBFX 4YYSA 5CHTA 1GCBA 5EGWA 2P86A 1GMYA 2Z84A 2CB5A 5KO3A 4D8BA 1AU4A 3N3KA 3MJ5A 5CVMA 2FRQA 3HHIA 3HHAA 2XU1A 1AYVA 1BQIA 2NQAA 3F75A 2AVWA 3PRMA 1F29A 2FE8A 3C0RA 4I05A 4QRVA 3MP2A 4PADA 3I3TA 1JQPA 2DCCA 4X6JA 3PSEA 3WXEA 2HH5A 1NLJA 3BPMA 3CH3X 3W30A 4BOUA 4PT5A 8PCHA 1X9YA 1ICFA 2XU3A 2HXZA 1ITOA 3I06A 3MHSA 4CZWA 2F7DA 3H8BA 3ZUAA 1NB5A 3TMPA 4DMXA 3HWNA 4A5UA 4CDDB 3AI8A 1BGOA 1F2CA 1ZIVA 2R9FA 3N4CA 3P5WA 5CVNB 2ARYA 3S3RA 1VJVA 1VSNA 3KX1A 1TLOA 2DOSA 3OVXA 2JQFR 4R3DA 4QRXA 1PPDA 2HD5A 2JRIA 3KW9A 3PNRA 4BOSA 1NL6A 1AECA 1Y08A 3ZNHA 2R9NA 3PHWA 1GECE 4P6GA 2DJGB 3KKUA 1NB3A 4MM3B 1PPNA 1CPJA 5CVOB 1EWPA 3CH2X 4MZOA 1POPA 4OEMA 4XR7A 2ATOA 2G7YA 1CVZA 1AU3A 1TU6A 4W5CA 3H6SA 2AUZA 2BTWB 1PE6A 5JZEA 3CBJA 4RY2A 2R6NA 4YYVA 4G54A 4RF1A 4Q8HA 5CHVA 4MSXA 3NHEA 2AS8A 3P5UA 3LXSA 4GUAA 1DF0A 3RVVA 3LFYA 2AUXA 2BU3A 4DMYA 3N3GA 3DF0A 3USVA 2JTCA 4OVZA 3B79A 2OP3A 1CV8A 1QOLA 3ERVA 1GLOA 1QXPA 1UKFA 3MORA 3PBHA 2R9CA 1PADA 3M99A 6PADA 4Q8GA 3IHPA 1AU0A 2GFOA 3BWKA 1M6DA 2AYOA 2B1MA 2Y5BA 2E02A 4ZUXU 1Q6KA 3IOQA 2HWKA 1PIPA 1QDQA 2XU4A 2NQGA 4ZTBA 2YJCA 4N8WA 4BSQA 3BBAA 2OZ2A 3BCNA 4W5BA 3D6SA 1BP4A 2E03A 2J7QC 4D8EA 1ATKA 4QRGA 7PCKA 2FTDA 1EWOA 4K7CA 4D8IA 3HD3A 3GCBA 3BOWA 2G8JA 2FQ9A 1ZCMA 1AYWA 5F02A 2F1GA 4REZA 4YYWA 3PW3A 4YVAA 4RNAA 3QT4A 3K24A 4FJCA 4N4ZA 3RVWA 2O6XA 2OULA 4AXMA 3OVZA 2DC7A 3OF8A 2FT2A 2J7QA 3OF9A 2AYNA 1TL9A 2BDZA 2YJBA 1BY8A 2VHSA 5EZSA 2P7UA 3BY4A 4RF0A 1THEA 2R9OA 4YYQA 4OELA 2C0YA 4CDEB 2YJ9A 4IUMA 2FYEA 1ME4A 3KWZA 3PHUA 2Y6EA 4HWYA 2CIOA 4QH6A 3K9MA 3MTVA 2FRAA 1PPPA 1U9WA 3O0UA 1MS6A 1YZBA 3TRKA 2E00A 3TNXA 1PCIA 5FPWA 1MEGA 4YYUA 3KSEA 2H7JA 3S3QA 2DC9A 1PBHA 4X6HA 3H7DA 2AU1A 1YT7A 1Y4HA 2IPPB 1KHPA 3IFUA 3WXGA 1U9XA 4FIPA 2DC8A 3IUTA 3O65A 4KLBA 1PPOA 5EF4A 1MDWA 4BS5A 2PADA 4N79A 1CTEA 4BQVA 2G8EA 1CJLA 2YJ2A 4QBBA 4WA6A 2G6DA 3E1ZB 4HXDB 4M0WA 2XU5A 2PREA 4YV8A 9PAPA 2BTWA 2FO5A 2VHFA 4I07A 5J94A 2P0RA 1EWMA 1AYUA 5JH3A 3IEJA 5E6JA 1YALA 3U8EA 2PNSA
chains in the Genus database with same CATH topology
2HHNA 4YYRA 2R9MA 2DZYA 1FH0A 1F2BA 4B55A 2DCDA 2NQIA 4BPVA 1IWDA 2DZZA 1EF7A 2B1NA 2ACTA 1KHQA 3O1GA 1AU2A 2DJFB 2PBHA 2FUDA 3V6EA 3IV2A 4P6EA 4I04A 1PXVA 1ME3A 1QMYA 2GHUA 1CS8A 1EWLA 1CB5A 3H8CA 1S4VA 3H89A 1U9VA 3MTNA 5PADA 4MZSA 3RVXA 4W4UA 3BPFA 4PP1A 3P5VA 3C9EA 1MEMA 3WXFA 1U9QX 2JQGR 1U5IA 1YK7A 1O0EA 3KFQA 2DC6A 4FK5A 1W6FA 1MIRA 1XKGA 1STFE 3V6CA 3BC3A 4PP2E 1KXRA 3K8UA 4CDFB 3PDFA 4PI3A 1MHWA 2DCBA 2NQDB 3OISA 1NPZA 1KFXL 3P5XA 3QJ3A 3MHHA 4XUIA 4BGFA 1A6RA 1DEUA 4CDCB 2E01A 1NQCA 3QSDA 2AIMA 1CSBB 2YJ8A 3IMAA 5JA7A 1SNKA 1HUCB 1KFUL 1W5RA 1K3BB 5A24A 1AIMA 3KWBX 4X6IA 4BS6A 1YK8A 2BDLA 1YVBA 4NV7A 1F2AA 2DCAA 4AXLA 1SP4B 5K16A 2IBIA 3CBKA 1CQDA 3F5VA 2WBFX 4YYSA 5CHTA 1GCBA 5EGWA 2P86A 1GMYA 2CB5A 1AU4A 3N3KA 5CVMA 2FRQA 3HHIA 3HHAA 2XU1A 1AYVA 1BQIA 2NQAA 3F75A 2AVWA 1F29A 4I05A 4QRVA 2BSZA 4PADA 3I3TA 1JQPA 2DCCA 4X6JA 3WXEA 2HH5A 1NLJA 3BPMA 3CH3X 8PCHA 1X9YA 1ICFA 2XU3A 2HXZA 1ITOA 3I06A 3MHSA 4CZWA 2F7DA 3H8BA 3ZUAA 1NB5A 4DMXA 3HWNA 4CDDB 3AI8A 1BGOA 1F2CA 1ZIVA 2R9FA 3N4CA 2VFCA 3P5WA 5CVNB 2ARYA 3S3RA 1VJVA 1VSNA 3KX1A 1TLOA 3OVXA 2JQFR 4QRXA 1PPDA 2HD5A 3KW9A 3PNRA 1NL6A 1AECA 1Y08A 2R9NA 1GECE 4P6GA 2DJGB 3KKUA 1NB3A 1PPNA 1CPJA 5CVOB 1EWPA 3CH2X 4MZOA 1POPA 4OEMA 4XR7A 2ATOA 2G7YA 1CVZA 1AU3A 1TU6A 4W5CA 3H6SA 2AUZA 1PE6A 3CBJA 4RY2A 2R6NA 4YYVA 4G54A 4Q8HA 5CHVA 4MSXA 3NHEA 2AS8A 3P5UA 3LXSA 1DF0A 3RVVA 3LFYA 3D9WA 2AUXA 4DMYA 3N3GA 3DF0A 3USVA 3B79A 2OP3A 1CV8A 1QOLA 3ERVA 1GLOA 1QXPA 3PBHA 3MORA 2R9CA 1PADA 3M99A 6PADA 4Q8GA 3IHPA 1AU0A 2GFOA 3BWKA 1M6DA 2AYOA 2B1MA 2Y5BA 2E02A 4ZUXU 1Q6KA 3IOQA 1PIPA 1QDQA 2XU4A 2NQGA 2YJCA 4N8WA 4BSQA 2OZ2A 3BCNA 4W5BA 3D6SA 1BP4A 2E03A 1ATKA 4NV8A 4QRGA 7PCKA 2FTDA 1EWOA 4K7CA 3HD3A 3GCBA 3BOWA 2G8JA 2FQ9A 1ZCMA 1AYWA 1W4TA 5F02A 2F1GA 4YYWA 3PW3A 4YVAA 3QT4A 3K24A 4FJCA 4N4ZA 3RVWA 2O6XA 2OULA 4AXMA 3OVZA 2DC7A 3OF8A 2FT2A 3OF9A 2AYNA 1TL9A 2BDZA 2YJBA 1E2TA 1BY8A 2VHSA 2P7UA 1THEA 2R9OA 4YYQA 4OELA 2C0YA 4CDEB 2YJ9A 2FYEA 1ME4A 3KWZA 2Y6EA 4HWYA 2CIOA 4QH6A 3K9MA 2FRAA 1PPPA 1U9WA 3O0UA 1MS6A 2E00A 3TNXA 1PCIA 5FPWA 1MEGA 4YYUA 3KSEA 2H7JA 3S3QA 2DC9A 4GUZA 1PBHA 3LTWA 4X6HA 3H7DA 2AU1A 1GX3A 1YT7A 1Y4HA 2IPPB 1KHPA 3WXGA 1U9XA 4FIPA 2DC8A 3IUTA 4KLBA 1PPOA 5EF4A 1MDWA 4BS5A 2PADA 4N79A 1CTEA 4BQVA 2G8EA 1CJLA 2YJ2A 4QBBA 4WA6A 2G6DA 3E1ZB 2XU5A 2PREA 4YV8A 4C5PA 9PAPA 2FO5A 2VHFA 4I07A 2VFBA 5J94A 2P0RA 1EWMA 1AYUA 5JH3A 3IEJA 1YALA 3U8EA 2PNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHN A;  4YYR A;  2R9M A;  2DZY A;  1FH0 A;  1F2B A;  2DCD A;  2NQI A;  4BPV A;  1IWD A;  2DZZ A;  1EF7 A;  2B1N A;  2ACT A;  1KHQ A;  3O1G A;  1AU2 A;  2DJF B;  2PBH A;  2FUD A;  3V6E A;  3IV2 A;  4P6E A;  4I04 A;  1PXV A;  1ME3 A;  1QMY A;  2GHU A;  1CS8 A;  1EWL A;  1CB5 A;  3H8C A;  1S4V A;  3H89 A;  1U9V A;  3MTN A;  5PAD A;  4MZS A;  3RVX A;  4W4U A;  3BPF A;  4PP1 A;  3P5V A;  3C9E A;  1MEM A;  3WXF A;  1U9Q X;  2JQG R;  1U5I A;  1YK7 A;  1O0E A;  3KFQ A;  2DC6 A;  4FK5 A;  1MIR A;  1XKG A;  1STF E;  3V6C A;  3BC3 A;  4PP2 E;  1KXR A;  3K8U A;  4CDF B;  3PDF A;  4PI3 A;  1MHW A;  2DCB A;  2NQD B;  3OIS A;  1NPZ A;  1KFX L;  3P5X A;  3QJ3 A;  3MHH A;  4XUI A;  1A6R A;  1DEU A;  4CDC B;  2E01 A;  1NQC A;  3QSD A;  2AIM A;  1CSB B;  2YJ8 A;  3IMA A;  5JA7 A;  1SNK A;  1HUC B;  1KFU L;  1K3B B;  5A24 A;  1AIM A;  3KWB X;  4X6I A;  4BS6 A;  1YK8 A;  2BDL A;  1YVB A;  1F2A A;  2DCA A;  4AXL A;  1SP4 B;  5K16 A;  2IBI A;  3CBK A;  1CQD A;  3F5V A;  2WBF X;  4YYS A;  5CHT A;  1GCB A;  5EGW A;  2P86 A;  1GMY A;  2CB5 A;  1AU4 A;  3N3K A;  5CVM A;  2FRQ A;  3HHI A;  3HHA A;  2XU1 A;  1AYV A;  1BQI A;  2NQA A;  3F75 A;  2AVW A;  1F29 A;  4I05 A;  4QRV A;  4PAD A;  3I3T A;  1JQP A;  2DCC A;  4X6J A;  3WXE A;  2HH5 A;  1NLJ A;  3BPM A;  3CH3 X;  8PCH A;  1X9Y A;  1ICF A;  2XU3 A;  2HXZ A;  1ITO A;  3I06 A;  3MHS A;  4CZW A;  2F7D A;  3H8B A;  3ZUA A;  1NB5 A;  4DMX A;  3HWN A;  4CDD B;  3AI8 A;  1BGO A;  1F2C A;  1ZIV A;  2R9F A;  3N4C A;  3P5W A;  5CVN B;  2ARY A;  3S3R A;  1VJV A;  1VSN A;  3KX1 A;  1TLO A;  3OVX A;  2JQF R;  4QRX A;  1PPD A;  2HD5 A;  3KW9 A;  3PNR A;  1NL6 A;  1AEC A;  1Y08 A;  2R9N A;  1GEC E;  4P6G A;  2DJG B;  3KKU A;  1NB3 A;  1PPN A;  1CPJ A;  5CVO B;  1EWP A;  3CH2 X;  4MZO A;  1POP A;  4OEM A;  4XR7 A;  2ATO A;  2G7Y A;  1CVZ A;  1AU3 A;  1TU6 A;  4W5C A;  3H6S A;  2AUZ A;  1PE6 A;  3CBJ A;  4RY2 A;  2R6N A;  4YYV A;  4G54 A;  4Q8H A;  5CHV A;  4MSX A;  3NHE A;  2AS8 A;  3P5U A;  3LXS A;  1DF0 A;  3RVV A;  3LFY A;  2AUX A;  4DMY A;  3N3G A;  3DF0 A;  3USV A;  3B79 A;  2OP3 A;  1CV8 A;  1QOL A;  3ERV A;  1GLO A;  1QXP A;  3PBH A;  3MOR A;  2R9C A;  1PAD A;  3M99 A;  6PAD A;  4Q8G A;  3IHP A;  1AU0 A;  2GFO A;  3BWK A;  1M6D A;  2AYO A;  2B1M A;  2Y5B A;  2E02 A;  4ZUX U;  1Q6K A;  3IOQ A;  1PIP A;  1QDQ A;  2XU4 A;  2NQG A;  2YJC A;  4N8W A;  4BSQ A;  2OZ2 A;  3BCN A;  4W5B A;  3D6S A;  1BP4 A;  2E03 A;  1ATK A;  4QRG A;  7PCK A;  2FTD A;  1EWO A;  4K7C A;  3HD3 A;  3GCB A;  3BOW A;  2G8J A;  2FQ9 A;  1ZCM A;  1AYW A;  5F02 A;  2F1G A;  4YYW A;  3PW3 A;  4YVA A;  3QT4 A;  3K24 A;  4FJC A;  4N4Z A;  3RVW A;  2O6X A;  2OUL A;  4AXM A;  3OVZ A;  2DC7 A;  3OF8 A;  2FT2 A;  3OF9 A;  2AYN A;  1TL9 A;  2BDZ A;  2YJB A;  1BY8 A;  2VHS A;  2P7U A;  1THE A;  2R9O A;  4YYQ A;  4OEL A;  2C0Y A;  4CDE B;  2YJ9 A;  2FYE A;  1ME4 A;  3KWZ A;  2Y6E A;  4HWY A;  2CIO A;  4QH6 A;  3K9M A;  2FRA A;  1PPP A;  1U9W A;  3O0U A;  1MS6 A;  2E00 A;  3TNX A;  1PCI A;  5FPW A;  1MEG A;  4YYU A;  3KSE A;  2H7J A;  3S3Q A;  2DC9 A;  1PBH A;  4X6H A;  3H7D A;  2AU1 A;  1YT7 A;  1Y4H A;  2IPP B;  1KHP A;  3WXG A;  1U9X A;  4FIP A;  2DC8 A;  3IUT A;  4KLB A;  1PPO A;  5EF4 A;  1MDW A;  4BS5 A;  2PAD A;  4N79 A;  1CTE A;  4BQV A;  2G8E A;  1CJL A;  2YJ2 A;  4QBB A;  4WA6 A;  2G6D A;  3E1Z B;  2XU5 A;  2PRE A;  4YV8 A;  9PAP A;  2FO5 A;  2VHF A;  4I07 A;  5J94 A;  2P0R A;  1EWM A;  1AYU A;  5JH3 A;  3IEJ A;  1YAL A;  3U8E A;  2PNS A; 
#chains in the Genus database with same CATH topology
 4XZX A;  3PHX A;  2HHN A;  4YYR A;  2R9M A;  2DZY A;  1FH0 A;  1F2B A;  2DCD A;  2NQI A;  4BPV A;  1IWD A;  2DZZ A;  1EF7 A;  2B1N A;  2ACT A;  1KHQ A;  5EZQ A;  3O1G A;  1AU2 A;  2DJF B;  2PBH A;  2FUD A;  3V6E A;  3IV2 A;  4P6E A;  4I04 A;  1PVJ A;  1PXV A;  3RNV A;  1ME3 A;  1QMY A;  2GHU A;  1CS8 A;  1EWL A;  1CB5 A;  3H8C A;  1S4V A;  3H89 A;  1U9V A;  3MTN A;  5PAD A;  4P16 A;  4MZS A;  3RVX A;  4W4U A;  3BPF A;  4PP1 A;  3P5V A;  3C9E A;  1MEM A;  3WXF A;  1U9Q X;  2JQG R;  1U5I A;  1YK7 A;  1O0E A;  3KFQ A;  2DC6 A;  4FK5 A;  3W31 A;  3OQC A;  4BOQ A;  4BOP A;  2UZJ A;  1MIR A;  1XKG A;  1STF E;  3V6C A;  3BC3 A;  4PP2 E;  1KXR A;  3K8U A;  2AGA A;  4CDF B;  3PDF A;  4PI3 A;  1MHW A;  2DCB A;  2NQD B;  3OIS A;  4OVZ B;  3E9S A;  1NPZ A;  1KFX L;  3P5X A;  3QJ3 A;  3MHH A;  4IP3 A;  4XUI A;  1A6R A;  1DEU A;  4CDC B;  3BB7 A;  2E01 A;  1NQC A;  3QSD A;  2AIM A;  1CSB B;  2YJ8 A;  3IMA A;  5JA7 A;  4RKX A;  1SNK A;  3B21 A;  1HUC B;  1KFU L;  4WUR A;  1K3B B;  5A24 A;  1AIM A;  3KWB X;  4X6I A;  4BS6 A;  4MI7 A;  1YK8 A;  2BDL A;  1YVB A;  1F2A A;  3PT2 A;  2DCA A;  4AXL A;  1SP4 B;  5K16 A;  1DKI A;  2IBI A;  3CBK A;  1CQD A;  3F5V A;  4BOZ A;  4OW0 A;  3PRP A;  2WBF X;  4YYS A;  5CHT A;  1GCB A;  5EGW A;  2P86 A;  1GMY A;  2Z84 A;  2CB5 A;  5KO3 A;  4D8B A;  1AU4 A;  3N3K A;  3MJ5 A;  5CVM A;  2FRQ A;  3HHI A;  3HHA A;  2XU1 A;  1AYV A;  1BQI A;  2NQA A;  3F75 A;  2AVW A;  3PRM A;  1F29 A;  2FE8 A;  3C0R A;  4I05 A;  4QRV A;  3MP2 A;  4PAD A;  3I3T A;  1JQP A;  2DCC A;  4X6J A;  3PSE A;  3WXE A;  2HH5 A;  1NLJ A;  3BPM A;  3CH3 X;  3W30 A;  4BOU A;  4PT5 A;  8PCH A;  1X9Y A;  1ICF A;  2XU3 A;  2HXZ A;  1ITO A;  3I06 A;  3MHS A;  4CZW A;  2F7D A;  3H8B A;  3ZUA A;  1NB5 A;  3TMP A;  4DMX A;  3HWN A;  4A5U A;  4CDD B;  3AI8 A;  1BGO A;  1F2C A;  1ZIV A;  2R9F A;  3N4C A;  3P5W A;  5CVN B;  2ARY A;  3S3R A;  1VJV A;  1VSN A;  3KX1 A;  1TLO A;  2DOS A;  3OVX A;  2JQF R;  4R3D A;  4QRX A;  1PPD A;  2HD5 A;  2JRI A;  3KW9 A;  3PNR A;  4BOS A;  1NL6 A;  1AEC A;  1Y08 A;  3ZNH A;  2R9N A;  3PHW A;  1GEC E;  4P6G A;  2DJG B;  3KKU A;  1NB3 A;  4MM3 B;  1PPN A;  1CPJ A;  5CVO B;  1EWP A;  3CH2 X;  4MZO A;  1POP A;  4OEM A;  4XR7 A;  2ATO A;  2G7Y A;  1CVZ A;  1AU3 A;  1TU6 A;  4W5C A;  3H6S A;  2AUZ A;  2BTW B;  1PE6 A;  5JZE A;  3CBJ A;  4RY2 A;  2R6N A;  4YYV A;  4G54 A;  4RF1 A;  4Q8H A;  5CHV A;  4MSX A;  3NHE A;  2AS8 A;  3P5U A;  3LXS A;  4GUA A;  1DF0 A;  3RVV A;  3LFY A;  2AUX A;  2BU3 A;  4DMY A;  3N3G A;  3DF0 A;  3USV A;  2JTC A;  4OVZ A;  3B79 A;  2OP3 A;  1CV8 A;  1QOL A;  3ERV A;  1GLO A;  1QXP A;  1UKF A;  3MOR A;  3PBH A;  2R9C A;  1PAD A;  3M99 A;  6PAD A;  4Q8G A;  3IHP A;  1AU0 A;  2GFO A;  3BWK A;  1M6D A;  2AYO A;  2B1M A;  2Y5B A;  2E02 A;  4ZUX U;  1Q6K A;  3IOQ A;  2HWK A;  1PIP A;  1QDQ A;  2XU4 A;  2NQG A;  4ZTB A;  2YJC A;  4N8W A;  4BSQ A;  3BBA A;  2OZ2 A;  3BCN A;  4W5B A;  3D6S A;  1BP4 A;  2E03 A;  2J7Q C;  4D8E A;  1ATK A;  4QRG A;  7PCK A;  2FTD A;  1EWO A;  4K7C A;  4D8I A;  3HD3 A;  3GCB A;  3BOW A;  2G8J A;  2FQ9 A;  1ZCM A;  1AYW A;  5F02 A;  2F1G A;  4REZ A;  4YYW A;  3PW3 A;  4YVA A;  4RNA A;  3QT4 A;  3K24 A;  4FJC A;  4N4Z A;  3RVW A;  2O6X A;  2OUL A;  4AXM A;  3OVZ A;  2DC7 A;  3OF8 A;  2FT2 A;  2J7Q A;  3OF9 A;  2AYN A;  1TL9 A;  2BDZ A;  2YJB A;  1BY8 A;  2VHS A;  5EZS A;  2P7U A;  3BY4 A;  4RF0 A;  1THE A;  2R9O A;  4YYQ A;  4OEL A;  2C0Y A;  4CDE B;  2YJ9 A;  4IUM A;  2FYE A;  1ME4 A;  3KWZ A;  3PHU A;  2Y6E A;  4HWY A;  2CIO A;  4QH6 A;  3K9M A;  3MTV A;  2FRA A;  1PPP A;  1U9W A;  3O0U A;  1MS6 A;  1YZB A;  3TRK A;  2E00 A;  3TNX A;  1PCI A;  5FPW A;  1MEG A;  4YYU A;  3KSE A;  2H7J A;  3S3Q A;  2DC9 A;  1PBH A;  4X6H A;  3H7D A;  2AU1 A;  1YT7 A;  1Y4H A;  2IPP B;  1KHP A;  3IFU A;  3WXG A;  1U9X A;  4FIP A;  2DC8 A;  3IUT A;  3O65 A;  4KLB A;  1PPO A;  5EF4 A;  1MDW A;  4BS5 A;  2PAD A;  4N79 A;  1CTE A;  4BQV A;  2G8E A;  1CJL A;  2YJ2 A;  4QBB A;  4WA6 A;  2G6D A;  3E1Z B;  4HXD B;  4M0W A;  2XU5 A;  2PRE A;  4YV8 A;  9PAP A;  2BTW A;  2FO5 A;  2VHF A;  4I07 A;  5J94 A;  2P0R A;  1EWM A;  1AYU A;  5JH3 A;  3IEJ A;  5E6J A;  1YAL A;  3U8E A;  2PNS A; 
#chains in the Genus database with same CATH homology
 2HHN A;  4YYR A;  2R9M A;  2DZY A;  1FH0 A;  1F2B A;  4B55 A;  2DCD A;  2NQI A;  4BPV A;  1IWD A;  2DZZ A;  1EF7 A;  2B1N A;  2ACT A;  1KHQ A;  3O1G A;  1AU2 A;  2DJF B;  2PBH A;  2FUD A;  3V6E A;  3IV2 A;  4P6E A;  4I04 A;  1PXV A;  1ME3 A;  1QMY A;  2GHU A;  1CS8 A;  1EWL A;  1CB5 A;  3H8C A;  1S4V A;  3H89 A;  1U9V A;  3MTN A;  5PAD A;  4MZS A;  3RVX A;  4W4U A;  3BPF A;  4PP1 A;  3P5V A;  3C9E A;  1MEM A;  3WXF A;  1U9Q X;  2JQG R;  1U5I A;  1YK7 A;  1O0E A;  3KFQ A;  2DC6 A;  4FK5 A;  1W6F A;  1MIR A;  1XKG A;  1STF E;  3V6C A;  3BC3 A;  4PP2 E;  1KXR A;  3K8U A;  4CDF B;  3PDF A;  4PI3 A;  1MHW A;  2DCB A;  2NQD B;  3OIS A;  1NPZ A;  1KFX L;  3P5X A;  3QJ3 A;  3MHH A;  4XUI A;  4BGF A;  1A6R A;  1DEU A;  4CDC B;  2E01 A;  1NQC A;  3QSD A;  2AIM A;  1CSB B;  2YJ8 A;  3IMA A;  5JA7 A;  1SNK A;  1HUC B;  1KFU L;  1W5R A;  1K3B B;  5A24 A;  1AIM A;  3KWB X;  4X6I A;  4BS6 A;  1YK8 A;  2BDL A;  1YVB A;  4NV7 A;  1F2A A;  2DCA A;  4AXL A;  1SP4 B;  5K16 A;  2IBI A;  3CBK A;  1CQD A;  3F5V A;  2WBF X;  4YYS A;  5CHT A;  1GCB A;  5EGW A;  2P86 A;  1GMY A;  2CB5 A;  1AU4 A;  3N3K A;  5CVM A;  2FRQ A;  3HHI A;  3HHA A;  2XU1 A;  1AYV A;  1BQI A;  2NQA A;  3F75 A;  2AVW A;  1F29 A;  4I05 A;  4QRV A;  2BSZ A;  4PAD A;  3I3T A;  1JQP A;  2DCC A;  4X6J A;  3WXE A;  2HH5 A;  1NLJ A;  3BPM A;  3CH3 X;  8PCH A;  1X9Y A;  1ICF A;  2XU3 A;  2HXZ A;  1ITO A;  3I06 A;  3MHS A;  4CZW A;  2F7D A;  3H8B A;  3ZUA A;  1NB5 A;  4DMX A;  3HWN A;  4CDD B;  3AI8 A;  1BGO A;  1F2C A;  1ZIV A;  2R9F A;  3N4C A;  2VFC A;  3P5W A;  5CVN B;  2ARY A;  3S3R A;  1VJV A;  1VSN A;  3KX1 A;  1TLO A;  3OVX A;  2JQF R;  4QRX A;  1PPD A;  2HD5 A;  3KW9 A;  3PNR A;  1NL6 A;  1AEC A;  1Y08 A;  2R9N A;  1GEC E;  4P6G A;  2DJG B;  3KKU A;  1NB3 A;  1PPN A;  1CPJ A;  5CVO B;  1EWP A;  3CH2 X;  4MZO A;  1POP A;  4OEM A;  4XR7 A;  2ATO A;  2G7Y A;  1CVZ A;  1AU3 A;  1TU6 A;  4W5C A;  3H6S A;  2AUZ A;  1PE6 A;  3CBJ A;  4RY2 A;  2R6N A;  4YYV A;  4G54 A;  4Q8H A;  5CHV A;  4MSX A;  3NHE A;  2AS8 A;  3P5U A;  3LXS A;  1DF0 A;  3RVV A;  3LFY A;  3D9W A;  2AUX A;  4DMY A;  3N3G A;  3DF0 A;  3USV A;  3B79 A;  2OP3 A;  1CV8 A;  1QOL A;  3ERV A;  1GLO A;  1QXP A;  3PBH A;  3MOR A;  2R9C A;  1PAD A;  3M99 A;  6PAD A;  4Q8G A;  3IHP A;  1AU0 A;  2GFO A;  3BWK A;  1M6D A;  2AYO A;  2B1M A;  2Y5B A;  2E02 A;  4ZUX U;  1Q6K A;  3IOQ A;  1PIP A;  1QDQ A;  2XU4 A;  2NQG A;  2YJC A;  4N8W A;  4BSQ A;  2OZ2 A;  3BCN A;  4W5B A;  3D6S A;  1BP4 A;  2E03 A;  1ATK A;  4NV8 A;  4QRG A;  7PCK A;  2FTD A;  1EWO A;  4K7C A;  3HD3 A;  3GCB A;  3BOW A;  2G8J A;  2FQ9 A;  1ZCM A;  1AYW A;  1W4T A;  5F02 A;  2F1G A;  4YYW A;  3PW3 A;  4YVA A;  3QT4 A;  3K24 A;  4FJC A;  4N4Z A;  3RVW A;  2O6X A;  2OUL A;  4AXM A;  3OVZ A;  2DC7 A;  3OF8 A;  2FT2 A;  3OF9 A;  2AYN A;  1TL9 A;  2BDZ A;  2YJB A;  1E2T A;  1BY8 A;  2VHS A;  2P7U A;  1THE A;  2R9O A;  4YYQ A;  4OEL A;  2C0Y A;  4CDE B;  2YJ9 A;  2FYE A;  1ME4 A;  3KWZ A;  2Y6E A;  4HWY A;  2CIO A;  4QH6 A;  3K9M A;  2FRA A;  1PPP A;  1U9W A;  3O0U A;  1MS6 A;  2E00 A;  3TNX A;  1PCI A;  5FPW A;  1MEG A;  4YYU A;  3KSE A;  2H7J A;  3S3Q A;  2DC9 A;  4GUZ A;  1PBH A;  3LTW A;  4X6H A;  3H7D A;  2AU1 A;  1GX3 A;  1YT7 A;  1Y4H A;  2IPP B;  1KHP A;  3WXG A;  1U9X A;  4FIP A;  2DC8 A;  3IUT A;  4KLB A;  1PPO A;  5EF4 A;  1MDW A;  4BS5 A;  2PAD A;  4N79 A;  1CTE A;  4BQV A;  2G8E A;  1CJL A;  2YJ2 A;  4QBB A;  4WA6 A;  2G6D A;  3E1Z B;  2XU5 A;  2PRE A;  4YV8 A;  4C5P A;  9PAP A;  2FO5 A;  2VHF A;  4I07 A;  2VFB A;  5J94 A;  2P0R A;  1EWM A;  1AYU A;  5JH3 A;  3IEJ A;  1YAL A;  3U8E A;  2PNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...