2OZ2A

Crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (k11777)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
molecule tags Hydrolase
source organism Trypanosoma cruzi
publication title Vinyl sulfones as antiparasitic agents and a structural basis for drug design.
pubmed doi rcsb
total genus 70
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2oz2A00
1QMYA 4BPVA 3RVVA 4YVAA 1ZCMA 3HD3A 1X9YA 5CVNB 4MZSA 4Q8HA 1S4VA 3P5UA 4YYUA 4PADA 4XR7A 3BCNA 3H6SA 3E1ZB 3KWBX 4I04A 2DJGB 2FRAA 2G6DA 3O0UA 2HXZA 1U9QX 3WXFA 1AYVA 2DZZA 1CQDA 4N8WA 3IHPA 2P0RA 3KW9A 1VJVA 3I06A 3K9MA 3IUTA 5K16A 1STFE 2F1GA 4MSXA 2FTDA 1MS6A 2DCDA 3OVZA 4YYRA 2PNSA 3IEJA 5CVOB 2G8JA 3H7DA 5A24A 1U9WA 1MHWA 3N4CA 3U8EA 1PBHA 1DF0A 2CIOA 1EWMA 3KX1A 4RY2A 2XU5A 2ARYA 2ATOA 1AU3A 2DCAA 1KXRA 2R9MA 4PP1A 3OF8A 2P86A 3KKUA 4FK5A 1U5IA 3BWKA 1BY8A 1KFXL 1PE6A 1THEA 4MZOA 1Q6KA 4AXLA 2PREA 1F29A 1SNKA 4AXMA 1O0EA 3ZUAA 3KFQA 4QBBA 4CDCB 4WA6A 2FO5A 1K3BB 4P6EA 2NQAA 2DCBA 1CJLA 2YJBA 4X6JA 5FPWA 3RVWA 4DMXA 4YYWA 2G8EA 2ACTA 1AECA 3F5VA 3P5WA 4OELA 1YK8A 4X6HA 1KHQA 3HWNA 2F7DA 1Y4HA 2YJCA 1AYWA 1CVZA 2VHFA 3MORA 4YYQA 3D6SA 1EWPA 1NL6A 1NLJA 1PIPA 2E03A 2AVWA 3HHAA 1EWLA 2FYEA 4BS5A 3F75A 4CDEB 1TU6A 1ME4A 4FIPA 1PPDA 3PNRA 3P5XA 1TL9A 2XU3A 4I05A 2HHNA 4BQVA 3CH3X 4PP2E 2PADA 1BP4A 3MHHA 1MEGA 4YYVA 2WBFX 5PADA 2JQFR 1BQIA 1NB3A 1JQPA 4CZWA 1AU0A 2R6NA 1FH0A 3K8UA 2AU1A 3IV2A 2XU4A 7PCKA 2R9FA 2IPPB 5J94A 1PPPA 1BGOA 2YJ9A 3CH2X 3K24A 1KHPA 1F2CA 2NQDB 3CBJA 2G7YA 1PXVA 3PW3A 2R9NA 2P7UA 3C9EA 1CS8A 2DCCA 2IBIA 5CHVA 2PBHA 3LFYA 1NB5A 1U9XA 2CB5A 1MDWA 2VHSA 1CSBB 1NQCA 3IOQA 4W5BA 4CDDB 2NQIA 2AS8A 1XKGA 2Y5BA 1VSNA 3PDFA 1YVBA 2DC6A 3AI8A 2DJFB 1CB5A 1CV8A 3M99A 1Y08A 3USVA 4W4UA 3HHIA 2HD5A 1U9VA 1GLOA 4KLBA 4DMYA 4N4ZA 3RVXA 1CPJA 3NHEA 4K7CA 2OULA 4QRVA 8PCHA 1ZIVA 4BSQA 1QDQA 3WXGA 3O1GA 3S3QA 3BOWA 3I3TA 1QOLA 1EWOA 1MEMA 2FRQA 3IMAA 5JH3A 3H89A 3QSDA 3DF0A 2AUXA 4Q8GA 2AUZA 1A6RA 2BDZA 3N3GA 2YJ2A 4OEMA 4CDFB 2HH5A 2R9OA 2DC9A 1YALA 3TNXA 5EF4A 2OP3A 3CBKA 1ITOA 4QRGA 2FT2A 3N3KA 4N79A 1ICFA 1KFUL 5JA7A 4X6IA 1EF7A 4I07A 3KWZA 2YJ8A 2Y6EA 2AYNA 4QH6A 2DZYA 1F2AA 4BS6A 3MHSA 3OVXA 5F02A 1AU2A 1AU4A 1M6DA 1F2BA 1ME3A 5CHTA 2FQ9A 5CVMA 2GFOA 2GHUA 1AIMA 5EGWA 2B1NA 2DC8A 3KSEA 1DEUA 3OISA 4W5CA 3S3RA 3BC3A 1HUCB 3ERVA 2AIMA 1QXPA 2E01A 6PADA 2XU1A 2O6XA 2OZ2A 2BDLA 1MIRA 1YK7A 1GMYA 1POPA 1CTEA 2AYOA 2E02A 4HWYA 1ATKA 3BPFA 3H8BA 9PAPA 4PI3A 3B79A 1SP4B 3WXEA 1PCIA 4YV8A 1PADA 2DC7A 2FUDA 2H7JA 3P5VA 3H8CA 1PPOA 2R9CA 2B1MA 1NPZA 4FJCA 3GCBA 2NQGA 3MTNA 1GECE 1TLOA 3PBHA 1IWDA 4YYSA 3V6CA 3LXSA 3QT4A 2E00A 2JQGR 1GCBA 3V6EA 3BPMA 2C0YA 4ZUXU 4G54A 1PPNA 4QRXA 4P6GA 3QJ3A 1AYUA 3OF9A 1YT7A 4XUIA
chains in the Genus database with same CATH superfamily
1QMYA 4BPVA 3RVVA 4YVAA 1ZCMA 3HD3A 2J7QC 1X9YA 5CVNB 4MZSA 4Q8HA 1S4VA 3P5UA 4YYUA 3PHUA 4PADA 4XR7A 4R3DA 3BCNA 4MI7A 3H6SA 3E1ZB 3KWBX 4OVZA 3BY4A 4I04A 2DJGB 2FRAA 2G6DA 3O0UA 2HXZA 1U9QX 3WXFA 1AYVA 2DZZA 1CQDA 2Z84A 4N8WA 3IHPA 2P0RA 3MJ5A 1YZBA 3KW9A 1VJVA 3I06A 3K9MA 3IUTA 5K16A 3E9SA 1STFE 2F1GA 4MSXA 2FE8A 2FTDA 1MS6A 2DCDA 3OVZA 4YYRA 4BOSA 2PNSA 3IEJA 3IFUA 5CVOB 2G8JA 3H7DA 5A24A 1U9WA 1MHWA 3N4CA 3U8EA 1PBHA 1DF0A 2CIOA 1EWMA 3KX1A 4RY2A 2XU5A 2ARYA 2ATOA 1AU3A 2DCAA 1KXRA 2R9MA 4PP1A 3OF8A 2P86A 3KKUA 4FK5A 1U5IA 3BWKA 1BY8A 1KFXL 1PE6A 1THEA 4MZOA 4OVZB 1Q6KA 2JTCA 4AXLA 2PREA 1F29A 1SNKA 4AXMA 1O0EA 3B21A 4OW0A 3ZUAA 3KFQA 4REZA 4QBBA 4CDCB 4WA6A 5EZQA 4M0WA 2FO5A 1K3BB 4P6EA 2NQAA 2DCBA 1CJLA 2YJBA 4X6JA 5FPWA 3RVWA 4DMXA 4YYWA 2G8EA 2ACTA 1AECA 3F5VA 3P5WA 4OELA 1YK8A 4X6HA 1KHQA 3HWNA 2F7DA 3TMPA 1Y4HA 2YJCA 1AYWA 1CVZA 2VHFA 3MORA 4YYQA 3D6SA 1EWPA 4RKXA 1NL6A 1NLJA 1PIPA 2E03A 2AVWA 3TRKA 3HHAA 1EWLA 2FYEA 3MP2A 4BS5A 3F75A 4CDEB 1TU6A 1ME4A 4FIPA 1PPDA 4D8EA 3MTVA 3PNRA 3P5XA 1TL9A 4D8BA 2XU3A 4I05A 2HHNA 4BQVA 3CH3X 4PP2E 2PADA 3PHWA 1BP4A 3MHHA 1MEGA 1DKIA 4YYVA 2WBFX 3PSEA 5PADA 2JQFR 1BQIA 1NB3A 1JQPA 4CZWA 1AU0A 2R6NA 1FH0A 3BB7A 3K8UA 2AU1A 3IV2A 2XU4A 7PCKA 2R9FA 5KO3A 2IPPB 5J94A 4BOQA 1PPPA 1BGOA 2YJ9A 3CH2X 3K24A 1KHPA 4MM3B 1F2CA 2NQDB 3CBJA 5E6JA 2G7YA 1PXVA 3PW3A 2R9NA 2P7UA 3BBAA 3C9EA 3W30A 1CS8A 2DCCA 2IBIA 3PT2A 5CHVA 4IUMA 2PBHA 4A5UA 3LFYA 1NB5A 1U9XA 2CB5A 1MDWA 2VHSA 1CSBB 1NQCA 3IOQA 4W5BA 2JRIA 2HWKA 3C0RA 4CDDB 2NQIA 2AS8A 4P16A 2BTWB 1XKGA 2Y5BA 1VSNA 4BOUA 3PDFA 4HXDB 1YVBA 2DC6A 3AI8A 2DJFB 1CB5A 4PT5A 1CV8A 3M99A 4BOZA 1Y08A 2J7QA 3PRPA 3USVA 4W4UA 3HHIA 1UKFA 2HD5A 1U9VA 1GLOA 4KLBA 4DMYA 4N4ZA 3RVXA 1CPJA 3NHEA 4K7CA 2OULA 4QRVA 8PCHA 1ZIVA 4BSQA 1QDQA 3WXGA 3O1GA 3S3QA 3BOWA 3I3TA 1QOLA 4ZTBA 1EWOA 2BTWA 1MEMA 2FRQA 3IMAA 5JH3A 3H89A 3QSDA 3DF0A 2AUXA 3W31A 2AUZA 4Q8GA 1A6RA 2BDZA 3N3GA 3PHXA 2YJ2A 4OEMA 4RF1A 4CDFB 2HH5A 2R9OA 2DC9A 1YALA 3TNXA 5EF4A 4BOPA 2OP3A 3CBKA 1ITOA 4QRGA 1PVJA 2FT2A 3N3KA 3RNVA 4N79A 3OQCA 1ICFA 1KFUL 5JA7A 4IP3A 4X6IA 1EF7A 4I07A 3KWZA 2YJ8A 2Y6EA 4RNAA 2AYNA 4QH6A 2DZYA 1F2AA 4BS6A 4XZXA 3O65A 3MHSA 3OVXA 5F02A 1AU2A 1AU4A 1M6DA 1F2BA 1ME3A 5CHTA 2FQ9A 5CVMA 3ZNHA 2GFOA 2GHUA 4GUAA 1AIMA 5EGWA 2B1NA 2DC8A 3KSEA 1DEUA 3OISA 4W5CA 4WURA 3S3RA 3BC3A 1HUCB 5EZSA 3ERVA 2AIMA 1QXPA 4RF0A 3PRMA 2E01A 2DOSA 6PADA 2XU1A 2BU3A 2O6XA 2OZ2A 2BDLA 1MIRA 1YK7A 1GMYA 1POPA 1CTEA 2AYOA 5JZEA 2E02A 4HWYA 1ATKA 3BPFA 3H8BA 9PAPA 4PI3A 3B79A 1SP4B 3WXEA 1PCIA 4YV8A 1PADA 2DC7A 2FUDA 2H7JA 3P5VA 3H8CA 1PPOA 2R9CA 2B1MA 1NPZA 4FJCA 3GCBA 2NQGA 3MTNA 1GECE 1TLOA 3PBHA 1IWDA 4YYSA 3V6CA 2UZJA 3LXSA 3QT4A 2E00A 2JQGR 4D8IA 1GCBA 3V6EA 3BPMA 2C0YA 4ZUXU 4G54A 1PPNA 4QRXA 4P6GA 3QJ3A 1AYUA 2AGAA 3OF9A 1YT7A 4XUIA
chains in the Genus database with same CATH topology
1QMYA 4BPVA 1W6FA 3RVVA 4YVAA 1ZCMA 3HD3A 1X9YA 5CVNB 4MZSA 4Q8HA 1S4VA 3P5UA 4YYUA 4PADA 4XR7A 3BCNA 3H6SA 3E1ZB 3KWBX 4I04A 2DJGB 2FRAA 2G6DA 3O0UA 2HXZA 1U9QX 3WXFA 1AYVA 2DZZA 1CQDA 4N8WA 3IHPA 2P0RA 3KW9A 1VJVA 3I06A 3K9MA 3IUTA 5K16A 1STFE 2F1GA 4MSXA 2FTDA 1MS6A 2DCDA 3OVZA 4YYRA 2PNSA 3IEJA 5CVOB 2G8JA 3H7DA 5A24A 1U9WA 1MHWA 3N4CA 3U8EA 1PBHA 1DF0A 2CIOA 1EWMA 3KX1A 4RY2A 2XU5A 2ARYA 2ATOA 1AU3A 2DCAA 1KXRA 2R9MA 4PP1A 3OF8A 2P86A 3KKUA 4FK5A 1U5IA 3BWKA 1BY8A 1KFXL 1PE6A 1THEA 4MZOA 1Q6KA 4AXLA 2PREA 1F29A 1SNKA 4AXMA 1O0EA 3ZUAA 3KFQA 4QBBA 4CDCB 4WA6A 2FO5A 1K3BB 4P6EA 2NQAA 2DCBA 1CJLA 2YJBA 4X6JA 5FPWA 3RVWA 4DMXA 4YYWA 2G8EA 2ACTA 1AECA 3F5VA 3P5WA 4OELA 1YK8A 4X6HA 1KHQA 3HWNA 2F7DA 1Y4HA 2YJCA 1AYWA 1CVZA 2VHFA 3MORA 4YYQA 3D6SA 1EWPA 1NL6A 1NLJA 1PIPA 2E03A 2BSZA 2AVWA 3HHAA 1EWLA 2FYEA 1GX3A 4BS5A 3F75A 4CDEB 1TU6A 1ME4A 4FIPA 1PPDA 3PNRA 3P5XA 1TL9A 2XU3A 4I05A 2HHNA 4BQVA 3CH3X 4PP2E 2PADA 1BP4A 3MHHA 1MEGA 2VFCA 2WBFX 4YYVA 4B55A 5PADA 2JQFR 1BQIA 1NB3A 1JQPA 4CZWA 1AU0A 2R6NA 1FH0A 3K8UA 2AU1A 3IV2A 2XU4A 7PCKA 2R9FA 2IPPB 5J94A 1PPPA 1BGOA 2YJ9A 3CH2X 3K24A 1KHPA 1F2CA 2NQDB 3CBJA 2G7YA 1PXVA 3PW3A 2R9NA 2P7UA 3C9EA 1CS8A 2DCCA 2IBIA 5CHVA 2PBHA 3LFYA 1NB5A 1U9XA 2CB5A 1MDWA 2VHSA 1CSBB 1NQCA 3IOQA 4W5BA 1W4TA 4CDDB 2NQIA 2AS8A 1XKGA 2Y5BA 1E2TA 1VSNA 3PDFA 1YVBA 2DC6A 3AI8A 2DJFB 1CB5A 1CV8A 3M99A 1Y08A 3USVA 4W4UA 3HHIA 2HD5A 1U9VA 1GLOA 4KLBA 4DMYA 4N4ZA 3RVXA 1CPJA 3NHEA 4K7CA 2OULA 4QRVA 8PCHA 1ZIVA 4BSQA 1QDQA 4GUZA 3WXGA 3O1GA 3S3QA 3BOWA 3I3TA 1QOLA 1EWOA 1MEMA 2FRQA 3IMAA 5JH3A 3H89A 3QSDA 3DF0A 2AUXA 4Q8GA 2AUZA 1A6RA 2BDZA 3N3GA 2YJ2A 4OEMA 4CDFB 2HH5A 2R9OA 2DC9A 1YALA 3TNXA 5EF4A 2OP3A 3CBKA 1ITOA 4QRGA 2FT2A 3N3KA 4N79A 1ICFA 1KFUL 5JA7A 4X6IA 1EF7A 4I07A 3KWZA 2YJ8A 2Y6EA 2AYNA 4QH6A 2DZYA 1F2AA 4BS6A 3MHSA 3OVXA 5F02A 4C5PA 1AU2A 1AU4A 1M6DA 1F2BA 1ME3A 5CHTA 2FQ9A 5CVMA 2GFOA 2GHUA 1AIMA 5EGWA 2B1NA 2DC8A 3KSEA 1DEUA 3OISA 4W5CA 3S3RA 3BC3A 1HUCB 3ERVA 2AIMA 1QXPA 2E01A 6PADA 2XU1A 2O6XA 2OZ2A 2BDLA 1MIRA 1YK7A 1GMYA 1POPA 1CTEA 2AYOA 2E02A 4HWYA 1ATKA 3BPFA 3H8BA 9PAPA 4PI3A 3B79A 1SP4B 1W5RA 3WXEA 1PCIA 4BGFA 4YV8A 1PADA 2DC7A 2FUDA 2VFBA 2H7JA 3P5VA 3H8CA 1PPOA 2R9CA 2B1MA 1NPZA 4FJCA 4NV8A 3GCBA 2NQGA 3MTNA 1GECE 1TLOA 3PBHA 1IWDA 4YYSA 3V6CA 3LXSA 3QT4A 2E00A 2JQGR 3LTWA 1GCBA 3V6EA 3BPMA 4NV7A 2C0YA 4ZUXU 4G54A 1PPNA 4QRXA 4P6GA 3QJ3A 1AYUA 3OF9A 1YT7A 4XUIA 3D9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMY A;  4BPV A;  3RVV A;  4YVA A;  1ZCM A;  3HD3 A;  1X9Y A;  5CVN B;  4MZS A;  4Q8H A;  1S4V A;  3P5U A;  4YYU A;  4PAD A;  4XR7 A;  3BCN A;  3H6S A;  3E1Z B;  3KWB X;  4I04 A;  2DJG B;  2FRA A;  2G6D A;  3O0U A;  2HXZ A;  1U9Q X;  3WXF A;  1AYV A;  2DZZ A;  1CQD A;  4N8W A;  3IHP A;  2P0R A;  3KW9 A;  1VJV A;  3I06 A;  3K9M A;  3IUT A;  5K16 A;  1STF E;  2F1G A;  4MSX A;  2FTD A;  1MS6 A;  2DCD A;  3OVZ A;  4YYR A;  2PNS A;  3IEJ A;  5CVO B;  2G8J A;  3H7D A;  5A24 A;  1U9W A;  1MHW A;  3N4C A;  3U8E A;  1PBH A;  1DF0 A;  2CIO A;  1EWM A;  3KX1 A;  4RY2 A;  2XU5 A;  2ARY A;  2ATO A;  1AU3 A;  2DCA A;  1KXR A;  2R9M A;  4PP1 A;  3OF8 A;  2P86 A;  3KKU A;  4FK5 A;  1U5I A;  3BWK A;  1BY8 A;  1KFX L;  1PE6 A;  1THE A;  4MZO A;  1Q6K A;  4AXL A;  2PRE A;  1F29 A;  1SNK A;  4AXM A;  1O0E A;  3ZUA A;  3KFQ A;  4QBB A;  4CDC B;  4WA6 A;  2FO5 A;  1K3B B;  4P6E A;  2NQA A;  2DCB A;  1CJL A;  2YJB A;  4X6J A;  5FPW A;  3RVW A;  4DMX A;  4YYW A;  2G8E A;  2ACT A;  1AEC A;  3F5V A;  3P5W A;  4OEL A;  1YK8 A;  4X6H A;  1KHQ A;  3HWN A;  2F7D A;  1Y4H A;  2YJC A;  1AYW A;  1CVZ A;  2VHF A;  3MOR A;  4YYQ A;  3D6S A;  1EWP A;  1NL6 A;  1NLJ A;  1PIP A;  2E03 A;  2AVW A;  3HHA A;  1EWL A;  2FYE A;  4BS5 A;  3F75 A;  4CDE B;  1TU6 A;  1ME4 A;  4FIP A;  1PPD A;  3PNR A;  3P5X A;  1TL9 A;  2XU3 A;  4I05 A;  2HHN A;  4BQV A;  3CH3 X;  4PP2 E;  2PAD A;  1BP4 A;  3MHH A;  1MEG A;  4YYV A;  2WBF X;  5PAD A;  2JQF R;  1BQI A;  1NB3 A;  1JQP A;  4CZW A;  1AU0 A;  2R6N A;  1FH0 A;  3K8U A;  2AU1 A;  3IV2 A;  2XU4 A;  7PCK A;  2R9F A;  2IPP B;  5J94 A;  1PPP A;  1BGO A;  2YJ9 A;  3CH2 X;  3K24 A;  1KHP A;  1F2C A;  2NQD B;  3CBJ A;  2G7Y A;  1PXV A;  3PW3 A;  2R9N A;  2P7U A;  3C9E A;  1CS8 A;  2DCC A;  2IBI A;  5CHV A;  2PBH A;  3LFY A;  1NB5 A;  1U9X A;  2CB5 A;  1MDW A;  2VHS A;  1CSB B;  1NQC A;  3IOQ A;  4W5B A;  4CDD B;  2NQI A;  2AS8 A;  1XKG A;  2Y5B A;  1VSN A;  3PDF A;  1YVB A;  2DC6 A;  3AI8 A;  2DJF B;  1CB5 A;  1CV8 A;  3M99 A;  1Y08 A;  3USV A;  4W4U A;  3HHI A;  2HD5 A;  1U9V A;  1GLO A;  4KLB A;  4DMY A;  4N4Z A;  3RVX A;  1CPJ A;  3NHE A;  4K7C A;  2OUL A;  4QRV A;  8PCH A;  1ZIV A;  4BSQ A;  1QDQ A;  3WXG A;  3O1G A;  3S3Q A;  3BOW A;  3I3T A;  1QOL A;  1EWO A;  1MEM A;  2FRQ A;  3IMA A;  5JH3 A;  3H89 A;  3QSD A;  3DF0 A;  2AUX A;  4Q8G A;  2AUZ A;  1A6R A;  2BDZ A;  3N3G A;  2YJ2 A;  4OEM A;  4CDF B;  2HH5 A;  2R9O A;  2DC9 A;  1YAL A;  3TNX A;  5EF4 A;  2OP3 A;  3CBK A;  1ITO A;  4QRG A;  2FT2 A;  3N3K A;  4N79 A;  1ICF A;  1KFU L;  5JA7 A;  4X6I A;  1EF7 A;  4I07 A;  3KWZ A;  2YJ8 A;  2Y6E A;  2AYN A;  4QH6 A;  2DZY A;  1F2A A;  4BS6 A;  3MHS A;  3OVX A;  5F02 A;  1AU2 A;  1AU4 A;  1M6D A;  1F2B A;  1ME3 A;  5CHT A;  2FQ9 A;  5CVM A;  2GFO A;  2GHU A;  1AIM A;  5EGW A;  2B1N A;  2DC8 A;  3KSE A;  1DEU A;  3OIS A;  4W5C A;  3S3R A;  3BC3 A;  1HUC B;  3ERV A;  2AIM A;  1QXP A;  2E01 A;  6PAD A;  2XU1 A;  2O6X A;  2OZ2 A;  2BDL A;  1MIR A;  1YK7 A;  1GMY A;  1POP A;  1CTE A;  2AYO A;  2E02 A;  4HWY A;  1ATK A;  3BPF A;  3H8B A;  9PAP A;  4PI3 A;  3B79 A;  1SP4 B;  3WXE A;  1PCI A;  4YV8 A;  1PAD A;  2DC7 A;  2FUD A;  2H7J A;  3P5V A;  3H8C A;  1PPO A;  2R9C A;  2B1M A;  1NPZ A;  4FJC A;  3GCB A;  2NQG A;  3MTN A;  1GEC E;  1TLO A;  3PBH A;  1IWD A;  4YYS A;  3V6C A;  3LXS A;  3QT4 A;  2E00 A;  2JQG R;  1GCB A;  3V6E A;  3BPM A;  2C0Y A;  4ZUX U;  4G54 A;  1PPN A;  4QRX A;  4P6G A;  3QJ3 A;  1AYU A;  3OF9 A;  1YT7 A;  4XUI A; 
#chains in the Genus database with same CATH topology
 1QMY A;  4BPV A;  3RVV A;  4YVA A;  1ZCM A;  3HD3 A;  2J7Q C;  1X9Y A;  5CVN B;  4MZS A;  4Q8H A;  1S4V A;  3P5U A;  4YYU A;  3PHU A;  4PAD A;  4XR7 A;  4R3D A;  3BCN A;  4MI7 A;  3H6S A;  3E1Z B;  3KWB X;  4OVZ A;  3BY4 A;  4I04 A;  2DJG B;  2FRA A;  2G6D A;  3O0U A;  2HXZ A;  1U9Q X;  3WXF A;  1AYV A;  2DZZ A;  1CQD A;  2Z84 A;  4N8W A;  3IHP A;  2P0R A;  3MJ5 A;  1YZB A;  3KW9 A;  1VJV A;  3I06 A;  3K9M A;  3IUT A;  5K16 A;  3E9S A;  1STF E;  2F1G A;  4MSX A;  2FE8 A;  2FTD A;  1MS6 A;  2DCD A;  3OVZ A;  4YYR A;  4BOS A;  2PNS A;  3IEJ A;  3IFU A;  5CVO B;  2G8J A;  3H7D A;  5A24 A;  1U9W A;  1MHW A;  3N4C A;  3U8E A;  1PBH A;  1DF0 A;  2CIO A;  1EWM A;  3KX1 A;  4RY2 A;  2XU5 A;  2ARY A;  2ATO A;  1AU3 A;  2DCA A;  1KXR A;  2R9M A;  4PP1 A;  3OF8 A;  2P86 A;  3KKU A;  4FK5 A;  1U5I A;  3BWK A;  1BY8 A;  1KFX L;  1PE6 A;  1THE A;  4MZO A;  4OVZ B;  1Q6K A;  2JTC A;  4AXL A;  2PRE A;  1F29 A;  1SNK A;  4AXM A;  1O0E A;  3B21 A;  4OW0 A;  3ZUA A;  3KFQ A;  4REZ A;  4QBB A;  4CDC B;  4WA6 A;  5EZQ A;  4M0W A;  2FO5 A;  1K3B B;  4P6E A;  2NQA A;  2DCB A;  1CJL A;  2YJB A;  4X6J A;  5FPW A;  3RVW A;  4DMX A;  4YYW A;  2G8E A;  2ACT A;  1AEC A;  3F5V A;  3P5W A;  4OEL A;  1YK8 A;  4X6H A;  1KHQ A;  3HWN A;  2F7D A;  3TMP A;  1Y4H A;  2YJC A;  1AYW A;  1CVZ A;  2VHF A;  3MOR A;  4YYQ A;  3D6S A;  1EWP A;  4RKX A;  1NL6 A;  1NLJ A;  1PIP A;  2E03 A;  2AVW A;  3TRK A;  3HHA A;  1EWL A;  2FYE A;  3MP2 A;  4BS5 A;  3F75 A;  4CDE B;  1TU6 A;  1ME4 A;  4FIP A;  1PPD A;  4D8E A;  3MTV A;  3PNR A;  3P5X A;  1TL9 A;  4D8B A;  2XU3 A;  4I05 A;  2HHN A;  4BQV A;  3CH3 X;  4PP2 E;  2PAD A;  3PHW A;  1BP4 A;  3MHH A;  1MEG A;  1DKI A;  4YYV A;  2WBF X;  3PSE A;  5PAD A;  2JQF R;  1BQI A;  1NB3 A;  1JQP A;  4CZW A;  1AU0 A;  2R6N A;  1FH0 A;  3BB7 A;  3K8U A;  2AU1 A;  3IV2 A;  2XU4 A;  7PCK A;  2R9F A;  5KO3 A;  2IPP B;  5J94 A;  4BOQ A;  1PPP A;  1BGO A;  2YJ9 A;  3CH2 X;  3K24 A;  1KHP A;  4MM3 B;  1F2C A;  2NQD B;  3CBJ A;  5E6J A;  2G7Y A;  1PXV A;  3PW3 A;  2R9N A;  2P7U A;  3BBA A;  3C9E A;  3W30 A;  1CS8 A;  2DCC A;  2IBI A;  3PT2 A;  5CHV A;  4IUM A;  2PBH A;  4A5U A;  3LFY A;  1NB5 A;  1U9X A;  2CB5 A;  1MDW A;  2VHS A;  1CSB B;  1NQC A;  3IOQ A;  4W5B A;  2JRI A;  2HWK A;  3C0R A;  4CDD B;  2NQI A;  2AS8 A;  4P16 A;  2BTW B;  1XKG A;  2Y5B A;  1VSN A;  4BOU A;  3PDF A;  4HXD B;  1YVB A;  2DC6 A;  3AI8 A;  2DJF B;  1CB5 A;  4PT5 A;  1CV8 A;  3M99 A;  4BOZ A;  1Y08 A;  2J7Q A;  3PRP A;  3USV A;  4W4U A;  3HHI A;  1UKF A;  2HD5 A;  1U9V A;  1GLO A;  4KLB A;  4DMY A;  4N4Z A;  3RVX A;  1CPJ A;  3NHE A;  4K7C A;  2OUL A;  4QRV A;  8PCH A;  1ZIV A;  4BSQ A;  1QDQ A;  3WXG A;  3O1G A;  3S3Q A;  3BOW A;  3I3T A;  1QOL A;  4ZTB A;  1EWO A;  2BTW A;  1MEM A;  2FRQ A;  3IMA A;  5JH3 A;  3H89 A;  3QSD A;  3DF0 A;  2AUX A;  3W31 A;  2AUZ A;  4Q8G A;  1A6R A;  2BDZ A;  3N3G A;  3PHX A;  2YJ2 A;  4OEM A;  4RF1 A;  4CDF B;  2HH5 A;  2R9O A;  2DC9 A;  1YAL A;  3TNX A;  5EF4 A;  4BOP A;  2OP3 A;  3CBK A;  1ITO A;  4QRG A;  1PVJ A;  2FT2 A;  3N3K A;  3RNV A;  4N79 A;  3OQC A;  1ICF A;  1KFU L;  5JA7 A;  4IP3 A;  4X6I A;  1EF7 A;  4I07 A;  3KWZ A;  2YJ8 A;  2Y6E A;  4RNA A;  2AYN A;  4QH6 A;  2DZY A;  1F2A A;  4BS6 A;  4XZX A;  3O65 A;  3MHS A;  3OVX A;  5F02 A;  1AU2 A;  1AU4 A;  1M6D A;  1F2B A;  1ME3 A;  5CHT A;  2FQ9 A;  5CVM A;  3ZNH A;  2GFO A;  2GHU A;  4GUA A;  1AIM A;  5EGW A;  2B1N A;  2DC8 A;  3KSE A;  1DEU A;  3OIS A;  4W5C A;  4WUR A;  3S3R A;  3BC3 A;  1HUC B;  5EZS A;  3ERV A;  2AIM A;  1QXP A;  4RF0 A;  3PRM A;  2E01 A;  2DOS A;  6PAD A;  2XU1 A;  2BU3 A;  2O6X A;  2OZ2 A;  2BDL A;  1MIR A;  1YK7 A;  1GMY A;  1POP A;  1CTE A;  2AYO A;  5JZE A;  2E02 A;  4HWY A;  1ATK A;  3BPF A;  3H8B A;  9PAP A;  4PI3 A;  3B79 A;  1SP4 B;  3WXE A;  1PCI A;  4YV8 A;  1PAD A;  2DC7 A;  2FUD A;  2H7J A;  3P5V A;  3H8C A;  1PPO A;  2R9C A;  2B1M A;  1NPZ A;  4FJC A;  3GCB A;  2NQG A;  3MTN A;  1GEC E;  1TLO A;  3PBH A;  1IWD A;  4YYS A;  3V6C A;  2UZJ A;  3LXS A;  3QT4 A;  2E00 A;  2JQG R;  4D8I A;  1GCB A;  3V6E A;  3BPM A;  2C0Y A;  4ZUX U;  4G54 A;  1PPN A;  4QRX A;  4P6G A;  3QJ3 A;  1AYU A;  2AGA A;  3OF9 A;  1YT7 A;  4XUI A; 
#chains in the Genus database with same CATH homology
 1QMY A;  4BPV A;  1W6F A;  3RVV A;  4YVA A;  1ZCM A;  3HD3 A;  1X9Y A;  5CVN B;  4MZS A;  4Q8H A;  1S4V A;  3P5U A;  4YYU A;  4PAD A;  4XR7 A;  3BCN A;  3H6S A;  3E1Z B;  3KWB X;  4I04 A;  2DJG B;  2FRA A;  2G6D A;  3O0U A;  2HXZ A;  1U9Q X;  3WXF A;  1AYV A;  2DZZ A;  1CQD A;  4N8W A;  3IHP A;  2P0R A;  3KW9 A;  1VJV A;  3I06 A;  3K9M A;  3IUT A;  5K16 A;  1STF E;  2F1G A;  4MSX A;  2FTD A;  1MS6 A;  2DCD A;  3OVZ A;  4YYR A;  2PNS A;  3IEJ A;  5CVO B;  2G8J A;  3H7D A;  5A24 A;  1U9W A;  1MHW A;  3N4C A;  3U8E A;  1PBH A;  1DF0 A;  2CIO A;  1EWM A;  3KX1 A;  4RY2 A;  2XU5 A;  2ARY A;  2ATO A;  1AU3 A;  2DCA A;  1KXR A;  2R9M A;  4PP1 A;  3OF8 A;  2P86 A;  3KKU A;  4FK5 A;  1U5I A;  3BWK A;  1BY8 A;  1KFX L;  1PE6 A;  1THE A;  4MZO A;  1Q6K A;  4AXL A;  2PRE A;  1F29 A;  1SNK A;  4AXM A;  1O0E A;  3ZUA A;  3KFQ A;  4QBB A;  4CDC B;  4WA6 A;  2FO5 A;  1K3B B;  4P6E A;  2NQA A;  2DCB A;  1CJL A;  2YJB A;  4X6J A;  5FPW A;  3RVW A;  4DMX A;  4YYW A;  2G8E A;  2ACT A;  1AEC A;  3F5V A;  3P5W A;  4OEL A;  1YK8 A;  4X6H A;  1KHQ A;  3HWN A;  2F7D A;  1Y4H A;  2YJC A;  1AYW A;  1CVZ A;  2VHF A;  3MOR A;  4YYQ A;  3D6S A;  1EWP A;  1NL6 A;  1NLJ A;  1PIP A;  2E03 A;  2BSZ A;  2AVW A;  3HHA A;  1EWL A;  2FYE A;  1GX3 A;  4BS5 A;  3F75 A;  4CDE B;  1TU6 A;  1ME4 A;  4FIP A;  1PPD A;  3PNR A;  3P5X A;  1TL9 A;  2XU3 A;  4I05 A;  2HHN A;  4BQV A;  3CH3 X;  4PP2 E;  2PAD A;  1BP4 A;  3MHH A;  1MEG A;  2VFC A;  2WBF X;  4YYV A;  4B55 A;  5PAD A;  2JQF R;  1BQI A;  1NB3 A;  1JQP A;  4CZW A;  1AU0 A;  2R6N A;  1FH0 A;  3K8U A;  2AU1 A;  3IV2 A;  2XU4 A;  7PCK A;  2R9F A;  2IPP B;  5J94 A;  1PPP A;  1BGO A;  2YJ9 A;  3CH2 X;  3K24 A;  1KHP A;  1F2C A;  2NQD B;  3CBJ A;  2G7Y A;  1PXV A;  3PW3 A;  2R9N A;  2P7U A;  3C9E A;  1CS8 A;  2DCC A;  2IBI A;  5CHV A;  2PBH A;  3LFY A;  1NB5 A;  1U9X A;  2CB5 A;  1MDW A;  2VHS A;  1CSB B;  1NQC A;  3IOQ A;  4W5B A;  1W4T A;  4CDD B;  2NQI A;  2AS8 A;  1XKG A;  2Y5B A;  1E2T A;  1VSN A;  3PDF A;  1YVB A;  2DC6 A;  3AI8 A;  2DJF B;  1CB5 A;  1CV8 A;  3M99 A;  1Y08 A;  3USV A;  4W4U A;  3HHI A;  2HD5 A;  1U9V A;  1GLO A;  4KLB A;  4DMY A;  4N4Z A;  3RVX A;  1CPJ A;  3NHE A;  4K7C A;  2OUL A;  4QRV A;  8PCH A;  1ZIV A;  4BSQ A;  1QDQ A;  4GUZ A;  3WXG A;  3O1G A;  3S3Q A;  3BOW A;  3I3T A;  1QOL A;  1EWO A;  1MEM A;  2FRQ A;  3IMA A;  5JH3 A;  3H89 A;  3QSD A;  3DF0 A;  2AUX A;  4Q8G A;  2AUZ A;  1A6R A;  2BDZ A;  3N3G A;  2YJ2 A;  4OEM A;  4CDF B;  2HH5 A;  2R9O A;  2DC9 A;  1YAL A;  3TNX A;  5EF4 A;  2OP3 A;  3CBK A;  1ITO A;  4QRG A;  2FT2 A;  3N3K A;  4N79 A;  1ICF A;  1KFU L;  5JA7 A;  4X6I A;  1EF7 A;  4I07 A;  3KWZ A;  2YJ8 A;  2Y6E A;  2AYN A;  4QH6 A;  2DZY A;  1F2A A;  4BS6 A;  3MHS A;  3OVX A;  5F02 A;  4C5P A;  1AU2 A;  1AU4 A;  1M6D A;  1F2B A;  1ME3 A;  5CHT A;  2FQ9 A;  5CVM A;  2GFO A;  2GHU A;  1AIM A;  5EGW A;  2B1N A;  2DC8 A;  3KSE A;  1DEU A;  3OIS A;  4W5C A;  3S3R A;  3BC3 A;  1HUC B;  3ERV A;  2AIM A;  1QXP A;  2E01 A;  6PAD A;  2XU1 A;  2O6X A;  2OZ2 A;  2BDL A;  1MIR A;  1YK7 A;  1GMY A;  1POP A;  1CTE A;  2AYO A;  2E02 A;  4HWY A;  1ATK A;  3BPF A;  3H8B A;  9PAP A;  4PI3 A;  3B79 A;  1SP4 B;  1W5R A;  3WXE A;  1PCI A;  4BGF A;  4YV8 A;  1PAD A;  2DC7 A;  2FUD A;  2VFB A;  2H7J A;  3P5V A;  3H8C A;  1PPO A;  2R9C A;  2B1M A;  1NPZ A;  4FJC A;  4NV8 A;  3GCB A;  2NQG A;  3MTN A;  1GEC E;  1TLO A;  3PBH A;  1IWD A;  4YYS A;  3V6C A;  3LXS A;  3QT4 A;  2E00 A;  2JQG R;  3LTW A;  1GCB A;  3V6E A;  3BPM A;  4NV7 A;  2C0Y A;  4ZUX U;  4G54 A;  1PPN A;  4QRX A;  4P6G A;  3QJ3 A;  1AYU A;  3OF9 A;  1YT7 A;  4XUI A;  3D9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...