3KW9A

X-ray structure of cathepsin k covalently bound to a triazine ligand
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kw9A00
1CVZA 2R9CA 3IEJA 2G6DA 2AYOA 2YJBA 3KSEA 1EF7A 1MHWA 5FPWA 4HWYA 2FQ9A 2FRQA 2E02A 3D6SA 1BQIA 3KFQA 1YALA 3OF8A 3N3KA 4CDEB 1BGOA 1PIPA 3ZUAA 3F75A 2XU3A 3S3QA 5JH3A 4DMXA 2GHUA 1CTEA 2HH5A 1O0EA 2PNSA 1TU6A 2DZYA 1YVBA 2YJ9A 3CH3X 2AUXA 4PP1A 2C0YA 3PNRA 2R9MA 2P7UA 2E01A 2FT2A 4YYUA 2OZ2A 1AYVA 1F2BA 3OF9A 2AYNA 1MDWA 4YVAA 1MEMA 2HHNA 1CSBB 3N4CA 1AYUA 3OVXA 4XUIA 4PI3A 3QJ3A 1JQPA 3K8UA 2BDLA 2PREA 3BC3A 3IOQA 4W5CA 1KHPA 3PBHA 2XU4A 1NQCA 4ZUXU 3KWZA 1BP4A 2YJCA 1QXPA 4YYVA 4FK5A 3WXGA 3KW9A 1U9VA 2XU5A 1SNKA 6PADA 1PCIA 1Y08A 3H89A 4DMYA 4YYRA 4K7CA 1ME3A 3KWBX 1F2AA 1CJLA 2R6NA 5CVNB 3MHHA 4OELA 1U5IA 3IUTA 4BPVA 3P5WA 1NPZA 3LFYA 1YK8A 4BSQA 2R9OA 5F02A 1MEGA 3I3TA 1QOLA 1YK7A 3H8CA 1DF0A 1KFUL 1PPDA 2B1NA 2H7JA 3RVXA 4Q8HA 5PADA 2NQGA 2WBFX 3QSDA 1CB5A 1KXRA 5K16A 2DC6A 2DCDA 3HHAA 5A24A 3WXFA 2G7YA 2XU1A 1TL9A 2G8JA 1A6RA 1ZIVA 3H7DA 1M6DA 2DZZA 2FYEA 3KKUA 1AU3A 4FIPA 1U9QX 2YJ8A 4BS6A 1KHQA 3P5VA 1GCBA 2NQAA 3B79A 2F7DA 4X6IA 3NHEA 4I04A 3V6EA 4YYWA 8PCHA 2IPPB 3PW3A 3I06A 1QMYA 4MZOA 2AIMA 1EWLA 1SP4B 3LXSA 1K3BB 3U8EA 2PADA 4AXLA 3M99A 3E1ZB 3IHPA 1ATKA 1STFE 2ATOA 3ERVA 3CH2X 1AU0A 4N4ZA 1F2CA 4XR7A 4YYQA 1EWMA 3KX1A 1DEUA 2OULA 1PADA 4W4UA 4WA6A 1FH0A 4CDCB 4X6HA 2DC8A 1GECE 3HHIA 5EF4A 1TLOA 1PE6A 4P6GA 2VHSA 2IBIA 3HD3A 3BPFA 3DF0A 4CDDB 1IWDA 1XKGA 1U9XA 1BY8A 7PCKA 1NB3A 1MS6A 3RVWA 2HD5A 2DJFB 4I05A 3S3RA 1THEA 3RVVA 3IMAA 1AECA 4KLBA 1PPPA 3K9MA 4BQVA 3MORA 4YYSA 4BS5A 1U9WA 3AI8A 1PXVA 2OP3A 5CHTA 5J94A 1YT7A 4G54A 3N3GA 3H6SA 1NL6A 1ZCMA 1NLJA 2E00A 4AXMA 4N8WA 4QBBA 4I07A 3O1GA 2DCBA 2HXZA 2NQDB 1HUCB 9PAPA 2ACTA 2GFOA 3MHSA 2B1MA 3H8BA 1GMYA 2YJ2A 3WXEA 3GCBA 4PADA 3BCNA 2PBHA 4QRXA 3TNXA 3HWNA 2DC7A 2AS8A 4P6EA 2FTDA 2E03A 4CZWA 4OEMA 2FO5A 3K24A 1Y4HA 1AU2A 2Y6EA 2VHFA 2R9NA 1ME4A 2AUZA 1CV8A 4QRVA 2P0RA 2JQGR 4X6JA 1PBHA 3OISA 3MTNA 4CDFB 3P5XA 3CBJA 3BPMA 5CHVA 4MZSA 1CQDA 2FRAA 3O0UA 4YV8A 2BDZA 2CIOA 1X9YA 3BWKA 3PDFA 1EWOA 1VJVA 2FUDA 2DCCA 1ICFA 1NB5A 1QDQA 4QRGA 1F29A 2DJGB 1KFXL 1AIMA 1Q6KA 3QT4A 5CVOB 5CVMA 2DCAA 1EWPA 3C9EA 4Q8GA 3CBKA 2Y5BA 1MIRA 4QH6A 3F5VA 4MSXA 4RY2A 1GLOA 2DC9A 4FJCA 3USVA 1AYWA 1AU4A 3IV2A 3P5UA 3BOWA 2NQIA 2ARYA 2AVWA 1ITOA 2JQFR 5EGWA 2R9FA 1CS8A 2P86A 1PPNA 1S4VA 4PP2E 3OVZA 2G8EA 3V6CA 1PPOA 2O6XA 4N79A 1CPJA 1VSNA 2AU1A 4W5BA 2F1GA 2CB5A 5JA7A 1POPA
chains in the Genus database with same CATH superfamily
1CVZA 2R9CA 3IEJA 2G6DA 2AYOA 2YJBA 3KSEA 1EF7A 1MHWA 5FPWA 4HWYA 2FQ9A 2FRQA 2E02A 3D6SA 1BQIA 3KFQA 1YALA 3OF8A 3N3KA 4CDEB 1BGOA 1PIPA 3ZUAA 3F75A 2XU3A 3S3QA 5JH3A 4DMXA 2GHUA 1CTEA 2HH5A 1O0EA 2HWKA 2PNSA 1TU6A 2DZYA 1YVBA 2YJ9A 3CH3X 2AUXA 4OVZB 4PP1A 2C0YA 3PNRA 2R9MA 2P7UA 3OQCA 2E01A 2FT2A 4YYUA 2OZ2A 1AYVA 1F2BA 3IFUA 3OF9A 3PHXA 2AYNA 1MDWA 4YVAA 1MEMA 2HHNA 1CSBB 3N4CA 1AYUA 3OVXA 4XUIA 4PI3A 5E6JA 3QJ3A 1JQPA 3K8UA 2BDLA 2PREA 3BC3A 3IOQA 4W5CA 1KHPA 4A5UA 3PBHA 2XU4A 1NQCA 4ZUXU 3KWZA 1BP4A 2YJCA 1QXPA 4YYVA 5KO3A 4GUAA 4FK5A 3PHUA 3WXGA 4BOSA 3KW9A 2FE8A 1U9VA 4BOUA 3C0RA 2XU5A 3PRMA 1SNKA 6PADA 1PCIA 1Y08A 3H89A 4DMYA 2AGAA 4YYRA 4K7CA 1ME3A 3KWBX 1F2AA 1CJLA 2R6NA 5CVNB 3MHHA 4OELA 1U5IA 3PT2A 4P16A 3IUTA 3RNVA 4BPVA 3ZNHA 3P5WA 1NPZA 4BOQA 3LFYA 1YK8A 4BSQA 2R9OA 5F02A 1MEGA 3I3TA 1QOLA 1YK7A 3H8CA 1DF0A 1KFUL 1PPDA 4RF1A 2B1NA 2H7JA 3RVXA 4Q8HA 5PADA 2NQGA 2WBFX 3QSDA 1CB5A 1KXRA 5K16A 2DC6A 2DCDA 3HHAA 5A24A 3WXFA 2G7YA 2J7QA 2XU1A 1TL9A 2G8JA 1A6RA 1ZIVA 3O65A 3H7DA 1M6DA 2DZZA 2FYEA 3KKUA 1AU3A 3MJ5A 4FIPA 1U9QX 4D8IA 2YJ8A 4BS6A 1KHQA 3P5VA 1GCBA 2NQAA 3B79A 2F7DA 4X6IA 3NHEA 4I04A 3V6EA 4YYWA 2BU3A 8PCHA 2IPPB 4WURA 3PW3A 4RKXA 3I06A 1QMYA 4MZOA 2AIMA 3PSEA 1EWLA 1SP4B 4OVZA 3LXSA 1K3BB 3U8EA 4OW0A 2PADA 4AXLA 3M99A 3E1ZB 3IHPA 1ATKA 1STFE 2ATOA 3ERVA 3CH2X 1AU0A 4N4ZA 1F2CA 4XR7A 4YYQA 1EWMA 4IUMA 3KX1A 1DEUA 2OULA 1PADA 4W4UA 4WA6A 1FH0A 4CDCB 2BTWB 4X6HA 2DC8A 1GECE 5EZQA 3TMPA 3HHIA 5EF4A 1TLOA 1PE6A 1PVJA 2BTWA 4P6GA 2VHSA 3BB7A 2IBIA 3HD3A 3BPFA 4RF0A 3DF0A 4ZTBA 4CDDB 1IWDA 1XKGA 3B21A 1U9XA 1BY8A 7PCKA 1NB3A 1MS6A 3RVWA 3W31A 2HD5A 2DJFB 4I05A 4R3DA 3S3RA 1THEA 3RVVA 3BY4A 3IMAA 2Z84A 1AECA 4KLBA 1PPPA 3K9MA 4BQVA 3MORA 4YYSA 4BOZA 1U9WA 4BS5A 3AI8A 1PXVA 2UZJA 2OP3A 5CHTA 5J94A 1YT7A 4G54A 1DKIA 3PRPA 3N3GA 3H6SA 1NL6A 1ZCMA 1NLJA 2E00A 4D8BA 4AXMA 4N8WA 4QBBA 4I07A 3O1GA 2DCBA 2HXZA 2NQDB 1HUCB 4D8EA 9PAPA 2ACTA 2GFOA 3MHSA 2B1MA 3H8BA 1GMYA 2YJ2A 3WXEA 3GCBA 4PADA 4MI7A 3BCNA 2PBHA 4QRXA 3TNXA 3HWNA 2DC7A 2AS8A 4P6EA 2FTDA 2E03A 4CZWA 4M0WA 4OEMA 2FO5A 3K24A 1Y4HA 1AU2A 2Y6EA 3TRKA 2VHFA 2R9NA 3W30A 1ME4A 2AUZA 1YZBA 1CV8A 4QRVA 2JRIA 2P0RA 5JZEA 2JQGR 2DOSA 4IP3A 4X6JA 1PBHA 3OISA 3MTNA 4XZXA 4CDFB 3P5XA 3CBJA 3BPMA 5CHVA 4MZSA 2JTCA 1CQDA 2FRAA 3O0UA 4YV8A 4HXDB 2BDZA 2CIOA 3PHWA 1X9YA 3BWKA 3PDFA 1EWOA 1VJVA 2FUDA 2DCCA 1ICFA 3MP2A 1NB5A 1QDQA 4QRGA 1F29A 2DJGB 1KFXL 1AIMA 1Q6KA 3QT4A 5CVOB 5CVMA 2DCAA 1EWPA 3C9EA 4Q8GA 3CBKA 4BOPA 2Y5BA 1MIRA 4QH6A 3F5VA 4MSXA 5EZSA 4RY2A 1GLOA 2DC9A 1UKFA 4FJCA 2J7QC 3USVA 4RNAA 1AYWA 1AU4A 3IV2A 4REZA 3P5UA 3BOWA 2NQIA 2ARYA 2AVWA 1ITOA 2JQFR 5EGWA 2R9FA 1CS8A 3MTVA 2P86A 1PPNA 3E9SA 1S4VA 4PP2E 3OVZA 4MM3B 2G8EA 3V6CA 4PT5A 1PPOA 2O6XA 4N79A 1CPJA 1VSNA 2AU1A 4W5BA 2F1GA 3BBAA 2CB5A 5JA7A 1POPA
chains in the Genus database with same CATH topology
1CVZA 2R9CA 3IEJA 2G6DA 2AYOA 2YJBA 3KSEA 1EF7A 1MHWA 5FPWA 4HWYA 2FQ9A 2FRQA 2E02A 3D6SA 1BQIA 3KFQA 1YALA 4NV7A 3OF8A 3N3KA 4CDEB 1BGOA 1PIPA 3ZUAA 3F75A 2XU3A 3S3QA 5JH3A 4DMXA 2GHUA 1CTEA 2HH5A 1O0EA 2PNSA 1TU6A 2DZYA 1YVBA 2YJ9A 3CH3X 2AUXA 4PP1A 2C0YA 3PNRA 2R9MA 2P7UA 2E01A 2FT2A 4YYUA 2OZ2A 1AYVA 1F2BA 3OF9A 2AYNA 1MDWA 4YVAA 1MEMA 2HHNA 1CSBB 3N4CA 1AYUA 3OVXA 4XUIA 4PI3A 2VFCA 3QJ3A 1JQPA 3K8UA 2BDLA 2PREA 3BC3A 3IOQA 4W5CA 1KHPA 3PBHA 2XU4A 1NQCA 4ZUXU 3KWZA 1BP4A 2YJCA 1QXPA 4YYVA 3LTWA 4FK5A 3WXGA 3KW9A 1U9VA 2XU5A 1SNKA 6PADA 1PCIA 1Y08A 3H89A 4DMYA 4YYRA 4K7CA 1ME3A 3KWBX 1F2AA 1CJLA 2R6NA 5CVNB 3MHHA 4OELA 1U5IA 3IUTA 4BPVA 2BSZA 3P5WA 1NPZA 3LFYA 1YK8A 4BSQA 2R9OA 5F02A 1MEGA 3I3TA 1QOLA 1YK7A 3H8CA 1DF0A 1KFUL 1PPDA 4GUZA 2B1NA 2H7JA 3RVXA 4Q8HA 5PADA 2NQGA 2WBFX 3QSDA 1CB5A 1KXRA 5K16A 2DC6A 2DCDA 3HHAA 5A24A 3WXFA 2G7YA 2XU1A 1TL9A 2G8JA 1A6RA 1ZIVA 3H7DA 1M6DA 2DZZA 2FYEA 3KKUA 1AU3A 1W4TA 4FIPA 1U9QX 2YJ8A 4BS6A 1KHQA 3P5VA 2VFBA 1GCBA 2NQAA 3B79A 1GX3A 2F7DA 4X6IA 3NHEA 4I04A 3V6EA 4YYWA 8PCHA 2IPPB 3PW3A 3I06A 1QMYA 4MZOA 2AIMA 1EWLA 1SP4B 3LXSA 1K3BB 3U8EA 2PADA 4AXLA 3M99A 3E1ZB 3IHPA 1ATKA 1STFE 2ATOA 3ERVA 3CH2X 1AU0A 4N4ZA 1F2CA 4XR7A 4YYQA 1EWMA 3KX1A 1DEUA 2OULA 1PADA 4W4UA 4WA6A 1FH0A 4CDCB 4X6HA 2DC8A 1GECE 3HHIA 5EF4A 1TLOA 1PE6A 4P6GA 2VHSA 2IBIA 3HD3A 3BPFA 3DF0A 4CDDB 1IWDA 1XKGA 1U9XA 1BY8A 7PCKA 1NB3A 1MS6A 3RVWA 2HD5A 2DJFB 4I05A 3S3RA 1THEA 3RVVA 3IMAA 1AECA 4KLBA 1PPPA 3K9MA 4BQVA 3MORA 4YYSA 4BS5A 1U9WA 3AI8A 1PXVA 2OP3A 5CHTA 5J94A 1YT7A 4G54A 3N3GA 1E2TA 3H6SA 1NL6A 1ZCMA 1NLJA 2E00A 4AXMA 4N8WA 4QBBA 4I07A 3O1GA 2DCBA 2HXZA 2NQDB 1HUCB 9PAPA 2ACTA 2GFOA 3MHSA 2B1MA 3H8BA 1GMYA 2YJ2A 3WXEA 3GCBA 4PADA 3BCNA 2PBHA 4QRXA 3TNXA 3HWNA 2DC7A 2AS8A 4P6EA 2FTDA 2E03A 4CZWA 4OEMA 2FO5A 3K24A 1Y4HA 1AU2A 2Y6EA 2VHFA 2R9NA 4C5PA 1ME4A 2AUZA 1CV8A 4QRVA 2P0RA 2JQGR 3D9WA 4X6JA 1PBHA 3OISA 3MTNA 4CDFB 3P5XA 3CBJA 3BPMA 5CHVA 4MZSA 1CQDA 2FRAA 3O0UA 4YV8A 4NV8A 2BDZA 2CIOA 1X9YA 3BWKA 3PDFA 1EWOA 1VJVA 2FUDA 2DCCA 1ICFA 1NB5A 1QDQA 4QRGA 1F29A 2DJGB 1KFXL 1AIMA 1Q6KA 3QT4A 5CVOB 5CVMA 2DCAA 1EWPA 3C9EA 4Q8GA 3CBKA 2Y5BA 1W5RA 1MIRA 4BGFA 4QH6A 3F5VA 4MSXA 4RY2A 1GLOA 2DC9A 4FJCA 3USVA 1AYWA 1AU4A 3IV2A 1W6FA 3P5UA 3BOWA 2NQIA 2ARYA 2AVWA 1ITOA 2JQFR 5EGWA 4B55A 2R9FA 1CS8A 2P86A 1PPNA 1S4VA 4PP2E 3OVZA 2G8EA 3V6CA 1PPOA 2O6XA 4N79A 1CPJA 1VSNA 2AU1A 4W5BA 2F1GA 2CB5A 5JA7A 1POPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CVZ A;  2R9C A;  3IEJ A;  2G6D A;  2AYO A;  2YJB A;  3KSE A;  1EF7 A;  1MHW A;  5FPW A;  4HWY A;  2FQ9 A;  2FRQ A;  2E02 A;  3D6S A;  1BQI A;  3KFQ A;  1YAL A;  3OF8 A;  3N3K A;  4CDE B;  1BGO A;  1PIP A;  3ZUA A;  3F75 A;  2XU3 A;  3S3Q A;  5JH3 A;  4DMX A;  2GHU A;  1CTE A;  2HH5 A;  1O0E A;  2PNS A;  1TU6 A;  2DZY A;  1YVB A;  2YJ9 A;  3CH3 X;  2AUX A;  4PP1 A;  2C0Y A;  3PNR A;  2R9M A;  2P7U A;  2E01 A;  2FT2 A;  4YYU A;  2OZ2 A;  1AYV A;  1F2B A;  3OF9 A;  2AYN A;  1MDW A;  4YVA A;  1MEM A;  2HHN A;  1CSB B;  3N4C A;  1AYU A;  3OVX A;  4XUI A;  4PI3 A;  3QJ3 A;  1JQP A;  3K8U A;  2BDL A;  2PRE A;  3BC3 A;  3IOQ A;  4W5C A;  1KHP A;  3PBH A;  2XU4 A;  1NQC A;  4ZUX U;  3KWZ A;  1BP4 A;  2YJC A;  1QXP A;  4YYV A;  4FK5 A;  3WXG A;  3KW9 A;  1U9V A;  2XU5 A;  1SNK A;  6PAD A;  1PCI A;  1Y08 A;  3H89 A;  4DMY A;  4YYR A;  4K7C A;  1ME3 A;  3KWB X;  1F2A A;  1CJL A;  2R6N A;  5CVN B;  3MHH A;  4OEL A;  1U5I A;  3IUT A;  4BPV A;  3P5W A;  1NPZ A;  3LFY A;  1YK8 A;  4BSQ A;  2R9O A;  5F02 A;  1MEG A;  3I3T A;  1QOL A;  1YK7 A;  3H8C A;  1DF0 A;  1KFU L;  1PPD A;  2B1N A;  2H7J A;  3RVX A;  4Q8H A;  5PAD A;  2NQG A;  2WBF X;  3QSD A;  1CB5 A;  1KXR A;  5K16 A;  2DC6 A;  2DCD A;  3HHA A;  5A24 A;  3WXF A;  2G7Y A;  2XU1 A;  1TL9 A;  2G8J A;  1A6R A;  1ZIV A;  3H7D A;  1M6D A;  2DZZ A;  2FYE A;  3KKU A;  1AU3 A;  4FIP A;  1U9Q X;  2YJ8 A;  4BS6 A;  1KHQ A;  3P5V A;  1GCB A;  2NQA A;  3B79 A;  2F7D A;  4X6I A;  3NHE A;  4I04 A;  3V6E A;  4YYW A;  8PCH A;  2IPP B;  3PW3 A;  3I06 A;  1QMY A;  4MZO A;  2AIM A;  1EWL A;  1SP4 B;  3LXS A;  1K3B B;  3U8E A;  2PAD A;  4AXL A;  3M99 A;  3E1Z B;  3IHP A;  1ATK A;  1STF E;  2ATO A;  3ERV A;  3CH2 X;  1AU0 A;  4N4Z A;  1F2C A;  4XR7 A;  4YYQ A;  1EWM A;  3KX1 A;  1DEU A;  2OUL A;  1PAD A;  4W4U A;  4WA6 A;  1FH0 A;  4CDC B;  4X6H A;  2DC8 A;  1GEC E;  3HHI A;  5EF4 A;  1TLO A;  1PE6 A;  4P6G A;  2VHS A;  2IBI A;  3HD3 A;  3BPF A;  3DF0 A;  4CDD B;  1IWD A;  1XKG A;  1U9X A;  1BY8 A;  7PCK A;  1NB3 A;  1MS6 A;  3RVW A;  2HD5 A;  2DJF B;  4I05 A;  3S3R A;  1THE A;  3RVV A;  3IMA A;  1AEC A;  4KLB A;  1PPP A;  3K9M A;  4BQV A;  3MOR A;  4YYS A;  4BS5 A;  1U9W A;  3AI8 A;  1PXV A;  2OP3 A;  5CHT A;  5J94 A;  1YT7 A;  4G54 A;  3N3G A;  3H6S A;  1NL6 A;  1ZCM A;  1NLJ A;  2E00 A;  4AXM A;  4N8W A;  4QBB A;  4I07 A;  3O1G A;  2DCB A;  2HXZ A;  2NQD B;  1HUC B;  9PAP A;  2ACT A;  2GFO A;  3MHS A;  2B1M A;  3H8B A;  1GMY A;  2YJ2 A;  3WXE A;  3GCB A;  4PAD A;  3BCN A;  2PBH A;  4QRX A;  3TNX A;  3HWN A;  2DC7 A;  2AS8 A;  4P6E A;  2FTD A;  2E03 A;  4CZW A;  4OEM A;  2FO5 A;  3K24 A;  1Y4H A;  1AU2 A;  2Y6E A;  2VHF A;  2R9N A;  1ME4 A;  2AUZ A;  1CV8 A;  4QRV A;  2P0R A;  2JQG R;  4X6J A;  1PBH A;  3OIS A;  3MTN A;  4CDF B;  3P5X A;  3CBJ A;  3BPM A;  5CHV A;  4MZS A;  1CQD A;  2FRA A;  3O0U A;  4YV8 A;  2BDZ A;  2CIO A;  1X9Y A;  3BWK A;  3PDF A;  1EWO A;  1VJV A;  2FUD A;  2DCC A;  1ICF A;  1NB5 A;  1QDQ A;  4QRG A;  1F29 A;  2DJG B;  1KFX L;  1AIM A;  1Q6K A;  3QT4 A;  5CVO B;  5CVM A;  2DCA A;  1EWP A;  3C9E A;  4Q8G A;  3CBK A;  2Y5B A;  1MIR A;  4QH6 A;  3F5V A;  4MSX A;  4RY2 A;  1GLO A;  2DC9 A;  4FJC A;  3USV A;  1AYW A;  1AU4 A;  3IV2 A;  3P5U A;  3BOW A;  2NQI A;  2ARY A;  2AVW A;  1ITO A;  2JQF R;  5EGW A;  2R9F A;  1CS8 A;  2P86 A;  1PPN A;  1S4V A;  4PP2 E;  3OVZ A;  2G8E A;  3V6C A;  1PPO A;  2O6X A;  4N79 A;  1CPJ A;  1VSN A;  2AU1 A;  4W5B A;  2F1G A;  2CB5 A;  5JA7 A;  1POP A; 
#chains in the Genus database with same CATH topology
 1CVZ A;  2R9C A;  3IEJ A;  2G6D A;  2AYO A;  2YJB A;  3KSE A;  1EF7 A;  1MHW A;  5FPW A;  4HWY A;  2FQ9 A;  2FRQ A;  2E02 A;  3D6S A;  1BQI A;  3KFQ A;  1YAL A;  3OF8 A;  3N3K A;  4CDE B;  1BGO A;  1PIP A;  3ZUA A;  3F75 A;  2XU3 A;  3S3Q A;  5JH3 A;  4DMX A;  2GHU A;  1CTE A;  2HH5 A;  1O0E A;  2HWK A;  2PNS A;  1TU6 A;  2DZY A;  1YVB A;  2YJ9 A;  3CH3 X;  2AUX A;  4OVZ B;  4PP1 A;  2C0Y A;  3PNR A;  2R9M A;  2P7U A;  3OQC A;  2E01 A;  2FT2 A;  4YYU A;  2OZ2 A;  1AYV A;  1F2B A;  3IFU A;  3OF9 A;  3PHX A;  2AYN A;  1MDW A;  4YVA A;  1MEM A;  2HHN A;  1CSB B;  3N4C A;  1AYU A;  3OVX A;  4XUI A;  4PI3 A;  5E6J A;  3QJ3 A;  1JQP A;  3K8U A;  2BDL A;  2PRE A;  3BC3 A;  3IOQ A;  4W5C A;  1KHP A;  4A5U A;  3PBH A;  2XU4 A;  1NQC A;  4ZUX U;  3KWZ A;  1BP4 A;  2YJC A;  1QXP A;  4YYV A;  5KO3 A;  4GUA A;  4FK5 A;  3PHU A;  3WXG A;  4BOS A;  3KW9 A;  2FE8 A;  1U9V A;  4BOU A;  3C0R A;  2XU5 A;  3PRM A;  1SNK A;  6PAD A;  1PCI A;  1Y08 A;  3H89 A;  4DMY A;  2AGA A;  4YYR A;  4K7C A;  1ME3 A;  3KWB X;  1F2A A;  1CJL A;  2R6N A;  5CVN B;  3MHH A;  4OEL A;  1U5I A;  3PT2 A;  4P16 A;  3IUT A;  3RNV A;  4BPV A;  3ZNH A;  3P5W A;  1NPZ A;  4BOQ A;  3LFY A;  1YK8 A;  4BSQ A;  2R9O A;  5F02 A;  1MEG A;  3I3T A;  1QOL A;  1YK7 A;  3H8C A;  1DF0 A;  1KFU L;  1PPD A;  4RF1 A;  2B1N A;  2H7J A;  3RVX A;  4Q8H A;  5PAD A;  2NQG A;  2WBF X;  3QSD A;  1CB5 A;  1KXR A;  5K16 A;  2DC6 A;  2DCD A;  3HHA A;  5A24 A;  3WXF A;  2G7Y A;  2J7Q A;  2XU1 A;  1TL9 A;  2G8J A;  1A6R A;  1ZIV A;  3O65 A;  3H7D A;  1M6D A;  2DZZ A;  2FYE A;  3KKU A;  1AU3 A;  3MJ5 A;  4FIP A;  1U9Q X;  4D8I A;  2YJ8 A;  4BS6 A;  1KHQ A;  3P5V A;  1GCB A;  2NQA A;  3B79 A;  2F7D A;  4X6I A;  3NHE A;  4I04 A;  3V6E A;  4YYW A;  2BU3 A;  8PCH A;  2IPP B;  4WUR A;  3PW3 A;  4RKX A;  3I06 A;  1QMY A;  4MZO A;  2AIM A;  3PSE A;  1EWL A;  1SP4 B;  4OVZ A;  3LXS A;  1K3B B;  3U8E A;  4OW0 A;  2PAD A;  4AXL A;  3M99 A;  3E1Z B;  3IHP A;  1ATK A;  1STF E;  2ATO A;  3ERV A;  3CH2 X;  1AU0 A;  4N4Z A;  1F2C A;  4XR7 A;  4YYQ A;  1EWM A;  4IUM A;  3KX1 A;  1DEU A;  2OUL A;  1PAD A;  4W4U A;  4WA6 A;  1FH0 A;  4CDC B;  2BTW B;  4X6H A;  2DC8 A;  1GEC E;  5EZQ A;  3TMP A;  3HHI A;  5EF4 A;  1TLO A;  1PE6 A;  1PVJ A;  2BTW A;  4P6G A;  2VHS A;  3BB7 A;  2IBI A;  3HD3 A;  3BPF A;  4RF0 A;  3DF0 A;  4ZTB A;  4CDD B;  1IWD A;  1XKG A;  3B21 A;  1U9X A;  1BY8 A;  7PCK A;  1NB3 A;  1MS6 A;  3RVW A;  3W31 A;  2HD5 A;  2DJF B;  4I05 A;  4R3D A;  3S3R A;  1THE A;  3RVV A;  3BY4 A;  3IMA A;  2Z84 A;  1AEC A;  4KLB A;  1PPP A;  3K9M A;  4BQV A;  3MOR A;  4YYS A;  4BOZ A;  1U9W A;  4BS5 A;  3AI8 A;  1PXV A;  2UZJ A;  2OP3 A;  5CHT A;  5J94 A;  1YT7 A;  4G54 A;  1DKI A;  3PRP A;  3N3G A;  3H6S A;  1NL6 A;  1ZCM A;  1NLJ A;  2E00 A;  4D8B A;  4AXM A;  4N8W A;  4QBB A;  4I07 A;  3O1G A;  2DCB A;  2HXZ A;  2NQD B;  1HUC B;  4D8E A;  9PAP A;  2ACT A;  2GFO A;  3MHS A;  2B1M A;  3H8B A;  1GMY A;  2YJ2 A;  3WXE A;  3GCB A;  4PAD A;  4MI7 A;  3BCN A;  2PBH A;  4QRX A;  3TNX A;  3HWN A;  2DC7 A;  2AS8 A;  4P6E A;  2FTD A;  2E03 A;  4CZW A;  4M0W A;  4OEM A;  2FO5 A;  3K24 A;  1Y4H A;  1AU2 A;  2Y6E A;  3TRK A;  2VHF A;  2R9N A;  3W30 A;  1ME4 A;  2AUZ A;  1YZB A;  1CV8 A;  4QRV A;  2JRI A;  2P0R A;  5JZE A;  2JQG R;  2DOS A;  4IP3 A;  4X6J A;  1PBH A;  3OIS A;  3MTN A;  4XZX A;  4CDF B;  3P5X A;  3CBJ A;  3BPM A;  5CHV A;  4MZS A;  2JTC A;  1CQD A;  2FRA A;  3O0U A;  4YV8 A;  4HXD B;  2BDZ A;  2CIO A;  3PHW A;  1X9Y A;  3BWK A;  3PDF A;  1EWO A;  1VJV A;  2FUD A;  2DCC A;  1ICF A;  3MP2 A;  1NB5 A;  1QDQ A;  4QRG A;  1F29 A;  2DJG B;  1KFX L;  1AIM A;  1Q6K A;  3QT4 A;  5CVO B;  5CVM A;  2DCA A;  1EWP A;  3C9E A;  4Q8G A;  3CBK A;  4BOP A;  2Y5B A;  1MIR A;  4QH6 A;  3F5V A;  4MSX A;  5EZS A;  4RY2 A;  1GLO A;  2DC9 A;  1UKF A;  4FJC A;  2J7Q C;  3USV A;  4RNA A;  1AYW A;  1AU4 A;  3IV2 A;  4REZ A;  3P5U A;  3BOW A;  2NQI A;  2ARY A;  2AVW A;  1ITO A;  2JQF R;  5EGW A;  2R9F A;  1CS8 A;  3MTV A;  2P86 A;  1PPN A;  3E9S A;  1S4V A;  4PP2 E;  3OVZ A;  4MM3 B;  2G8E A;  3V6C A;  4PT5 A;  1PPO A;  2O6X A;  4N79 A;  1CPJ A;  1VSN A;  2AU1 A;  4W5B A;  2F1G A;  3BBA A;  2CB5 A;  5JA7 A;  1POP A; 
#chains in the Genus database with same CATH homology
 1CVZ A;  2R9C A;  3IEJ A;  2G6D A;  2AYO A;  2YJB A;  3KSE A;  1EF7 A;  1MHW A;  5FPW A;  4HWY A;  2FQ9 A;  2FRQ A;  2E02 A;  3D6S A;  1BQI A;  3KFQ A;  1YAL A;  4NV7 A;  3OF8 A;  3N3K A;  4CDE B;  1BGO A;  1PIP A;  3ZUA A;  3F75 A;  2XU3 A;  3S3Q A;  5JH3 A;  4DMX A;  2GHU A;  1CTE A;  2HH5 A;  1O0E A;  2PNS A;  1TU6 A;  2DZY A;  1YVB A;  2YJ9 A;  3CH3 X;  2AUX A;  4PP1 A;  2C0Y A;  3PNR A;  2R9M A;  2P7U A;  2E01 A;  2FT2 A;  4YYU A;  2OZ2 A;  1AYV A;  1F2B A;  3OF9 A;  2AYN A;  1MDW A;  4YVA A;  1MEM A;  2HHN A;  1CSB B;  3N4C A;  1AYU A;  3OVX A;  4XUI A;  4PI3 A;  2VFC A;  3QJ3 A;  1JQP A;  3K8U A;  2BDL A;  2PRE A;  3BC3 A;  3IOQ A;  4W5C A;  1KHP A;  3PBH A;  2XU4 A;  1NQC A;  4ZUX U;  3KWZ A;  1BP4 A;  2YJC A;  1QXP A;  4YYV A;  3LTW A;  4FK5 A;  3WXG A;  3KW9 A;  1U9V A;  2XU5 A;  1SNK A;  6PAD A;  1PCI A;  1Y08 A;  3H89 A;  4DMY A;  4YYR A;  4K7C A;  1ME3 A;  3KWB X;  1F2A A;  1CJL A;  2R6N A;  5CVN B;  3MHH A;  4OEL A;  1U5I A;  3IUT A;  4BPV A;  2BSZ A;  3P5W A;  1NPZ A;  3LFY A;  1YK8 A;  4BSQ A;  2R9O A;  5F02 A;  1MEG A;  3I3T A;  1QOL A;  1YK7 A;  3H8C A;  1DF0 A;  1KFU L;  1PPD A;  4GUZ A;  2B1N A;  2H7J A;  3RVX A;  4Q8H A;  5PAD A;  2NQG A;  2WBF X;  3QSD A;  1CB5 A;  1KXR A;  5K16 A;  2DC6 A;  2DCD A;  3HHA A;  5A24 A;  3WXF A;  2G7Y A;  2XU1 A;  1TL9 A;  2G8J A;  1A6R A;  1ZIV A;  3H7D A;  1M6D A;  2DZZ A;  2FYE A;  3KKU A;  1AU3 A;  1W4T A;  4FIP A;  1U9Q X;  2YJ8 A;  4BS6 A;  1KHQ A;  3P5V A;  2VFB A;  1GCB A;  2NQA A;  3B79 A;  1GX3 A;  2F7D A;  4X6I A;  3NHE A;  4I04 A;  3V6E A;  4YYW A;  8PCH A;  2IPP B;  3PW3 A;  3I06 A;  1QMY A;  4MZO A;  2AIM A;  1EWL A;  1SP4 B;  3LXS A;  1K3B B;  3U8E A;  2PAD A;  4AXL A;  3M99 A;  3E1Z B;  3IHP A;  1ATK A;  1STF E;  2ATO A;  3ERV A;  3CH2 X;  1AU0 A;  4N4Z A;  1F2C A;  4XR7 A;  4YYQ A;  1EWM A;  3KX1 A;  1DEU A;  2OUL A;  1PAD A;  4W4U A;  4WA6 A;  1FH0 A;  4CDC B;  4X6H A;  2DC8 A;  1GEC E;  3HHI A;  5EF4 A;  1TLO A;  1PE6 A;  4P6G A;  2VHS A;  2IBI A;  3HD3 A;  3BPF A;  3DF0 A;  4CDD B;  1IWD A;  1XKG A;  1U9X A;  1BY8 A;  7PCK A;  1NB3 A;  1MS6 A;  3RVW A;  2HD5 A;  2DJF B;  4I05 A;  3S3R A;  1THE A;  3RVV A;  3IMA A;  1AEC A;  4KLB A;  1PPP A;  3K9M A;  4BQV A;  3MOR A;  4YYS A;  4BS5 A;  1U9W A;  3AI8 A;  1PXV A;  2OP3 A;  5CHT A;  5J94 A;  1YT7 A;  4G54 A;  3N3G A;  1E2T A;  3H6S A;  1NL6 A;  1ZCM A;  1NLJ A;  2E00 A;  4AXM A;  4N8W A;  4QBB A;  4I07 A;  3O1G A;  2DCB A;  2HXZ A;  2NQD B;  1HUC B;  9PAP A;  2ACT A;  2GFO A;  3MHS A;  2B1M A;  3H8B A;  1GMY A;  2YJ2 A;  3WXE A;  3GCB A;  4PAD A;  3BCN A;  2PBH A;  4QRX A;  3TNX A;  3HWN A;  2DC7 A;  2AS8 A;  4P6E A;  2FTD A;  2E03 A;  4CZW A;  4OEM A;  2FO5 A;  3K24 A;  1Y4H A;  1AU2 A;  2Y6E A;  2VHF A;  2R9N A;  4C5P A;  1ME4 A;  2AUZ A;  1CV8 A;  4QRV A;  2P0R A;  2JQG R;  3D9W A;  4X6J A;  1PBH A;  3OIS A;  3MTN A;  4CDF B;  3P5X A;  3CBJ A;  3BPM A;  5CHV A;  4MZS A;  1CQD A;  2FRA A;  3O0U A;  4YV8 A;  4NV8 A;  2BDZ A;  2CIO A;  1X9Y A;  3BWK A;  3PDF A;  1EWO A;  1VJV A;  2FUD A;  2DCC A;  1ICF A;  1NB5 A;  1QDQ A;  4QRG A;  1F29 A;  2DJG B;  1KFX L;  1AIM A;  1Q6K A;  3QT4 A;  5CVO B;  5CVM A;  2DCA A;  1EWP A;  3C9E A;  4Q8G A;  3CBK A;  2Y5B A;  1W5R A;  1MIR A;  4BGF A;  4QH6 A;  3F5V A;  4MSX A;  4RY2 A;  1GLO A;  2DC9 A;  4FJC A;  3USV A;  1AYW A;  1AU4 A;  3IV2 A;  1W6F A;  3P5U A;  3BOW A;  2NQI A;  2ARY A;  2AVW A;  1ITO A;  2JQF R;  5EGW A;  4B55 A;  2R9F A;  1CS8 A;  2P86 A;  1PPN A;  1S4V A;  4PP2 E;  3OVZ A;  2G8E A;  3V6C A;  1PPO A;  2O6X A;  4N79 A;  1CPJ A;  1VSN A;  2AU1 A;  4W5B A;  2F1G A;  2CB5 A;  5JA7 A;  1POP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...