3KW9A

X-ray structure of cathepsin k covalently bound to a triazine ligand
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 64
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3kw9A00
2HH5A 1AU3A 3BPFA 5K16A 3O1GA 2PNSA 2CB5A 1GCBA 4YV8A 3PBHA 4W5CA 1BQIA 4QRVA 2AU1A 4N4ZA 1MS6A 3BCNA 1AU0A 1SNKA 2B1MA 2HD5A 1ITOA 1DF0A 5JA7A 3HHIA 3BWKA 3OF8A 1PPNA 1EF7A 1KXRA 1F2BA 1NPZA 2YJBA 1AU2A 3ZUAA 4YYUA 2OP3A 4W5BA 2FYEA 3E1ZB 1CVZA 2AVWA 3K24A 2R9FA 3WXFA 3RVXA 1GECE 4I05A 3AI8A 1EWMA 1K3BB 2E01A 5J94A 1F2AA 3KSEA 4P6EA 2H7JA 1Q6KA 3OVZA 3ERVA 3BPMA 1VSNA 2JQFR 1QDQA 3HHAA 3IMAA 2OULA 4QRXA 1Y4HA 2VHSA 1HUCB 1BY8A 1AU4A 3HWNA 2O6XA 3MHSA 1PE6A 2AYOA 1BGOA 1MDWA 4N8WA 1TLOA 4I07A 4OELA 3LFYA 1A6RA 1PPPA 3F5VA 3KKUA 2IBIA 3OISA 1Y08A 4CDFB 1PPDA 3CH2X 1NB5A 2XU5A 3DF0A 2DCCA 5EGWA 2FRQA 3PW3A 3N4CA 3IUTA 2R9OA 4CDEB 3P5UA 3PNRA 4YVAA 4XUIA 3N3GA 4HWYA 2F7DA 3O0UA 4YYSA 6PADA 3MTNA 5JH3A 4K7CA 2Y5BA 1CS8A 3OF9A 1XKGA 1CB5A 4QBBA 4W4UA 2DCAA 5CVNB 2E02A 4Q8HA 3WXEA 3V6EA 1CTEA 3USVA 2P0RA 2HXZA 2DJFB 1THEA 3IOQA 1YT7A 5EF4A 4AXMA 1KHPA 1U9VA 2ARYA 1ZCMA 2B1NA 2YJ2A 4FJCA 1SP4B 1U5IA 2G8JA 7PCKA 4PADA 4N79A 5F02A 1YVBA 4WA6A 1VJVA 9PAPA 3IHPA 1FH0A 2YJCA 3KWZA 4G54A 1ATKA 2IPPB 2R6NA 3KWBX 3I06A 4YYWA 4DMXA 3QT4A 3KX1A 3HD3A 1F29A 2G6DA 2FTDA 1QMYA 1AIMA 1IWDA 2AIMA 2FQ9A 5CVOB 1X9YA 3KW9A 1U9WA 1NL6A 3KFQA 3QJ3A 3U8EA 2NQGA 4CZWA 2CIOA 3H7DA 3RVVA 3H8BA 1AYUA 2DJGB 4X6HA 4MZOA 3P5WA 1KFXL 1DEUA 1BP4A 3K8UA 1PADA 3H89A 1PPOA 4XR7A 3IEJA 1CJLA 1O0EA 3CBKA 4BQVA 1PIPA 3MHHA 3QSDA 4AXLA 1ZIVA 2E03A 2DC7A 1TL9A 1CQDA 2ACTA 3H6SA 2GHUA 5FPWA 1PXVA 4OEMA 2BDLA 4PI3A 1GMYA 4PP1A 1AECA 2XU4A 1QXPA 2YJ8A 1QOLA 2ATOA 1ME3A 1PBHA 1GLOA 4P6GA 3H8CA 4YYRA 8PCHA 2PREA 3BC3A 1ME4A 2XU1A 4Q8GA 2OZ2A 1YALA 2PADA 4FK5A 3I3TA 3PDFA 1MIRA 2E00A 3CH3X 1NQCA 2R9CA 1MEMA 3D6SA 2R9NA 4YYVA 4MZSA 5A24A 5PADA 4MSXA 2FUDA 2C0YA 2AYNA 4BS6A 1AYVA 1JQPA 2Y6EA 2HHNA 2XU3A 2PBHA 3TNXA 4PP2E 3IV2A 3BOWA 4ZUXU 2NQIA 3NHEA 3V6CA 3C9EA 1M6DA 2DC9A 2BDZA 1EWOA 2G7YA 3CBJA 2DCDA 1CSBB 2AUXA 1YK8A 1ICFA 4CDDB 2DZZA 2DCBA 4FIPA 2WBFX 5CHVA 2P86A 4DMYA 1PCIA 1AYWA 1KHQA 3N3KA 3RVWA 5CVMA 2P7UA 1STFE 2FRAA 4QRGA 3LXSA 3K9MA 1F2CA 3OVXA 2YJ9A 5CHTA 4X6JA 1S4VA 1U9XA 1NLJA 2DC6A 3F75A 1MHWA 2DZYA 4KLBA 4BS5A 2G8EA 1NB3A 4CDCB 2FO5A 3MORA 4I04A 3S3QA 2GFOA 2FT2A 2NQAA 1KFUL 1CPJA 4QH6A 3S3RA 1EWPA 4X6IA 2JQGR 3M99A 1MEGA 2F1GA 3WXGA 1TU6A 1EWLA 4BPVA 2AS8A 3GCBA 3P5XA 1CV8A 1U9QX 2AUZA 1YK7A 2DC8A 2NQDB 3P5VA 4BSQA 2R9MA 3B79A 4RY2A 2VHFA 1POPA 4YYQA
chains in the Genus database with same CATH superfamily
2HH5A 1AU3A 3BPFA 4XZXA 5K16A 3O1GA 2PNSA 2Z84A 2CB5A 2BU3A 1GCBA 4YV8A 3PBHA 4W5CA 1BQIA 4QRVA 2AU1A 4N4ZA 4REZA 1MS6A 3BCNA 1AU0A 1SNKA 2B1MA 2HD5A 1ITOA 1DF0A 2JRIA 5JA7A 3HHIA 3BWKA 4D8IA 3RNVA 3OF8A 1PPNA 1EF7A 1KXRA 1F2BA 2J7QC 3W30A 1NPZA 1PVJA 3BY4A 2YJBA 1AU2A 3ZUAA 4YYUA 2OP3A 4W5BA 2FYEA 3E1ZB 1CVZA 2AVWA 3K24A 2R9FA 3WXFA 3RVXA 1GECE 4I05A 3AI8A 1EWMA 1K3BB 2E01A 5J94A 4IP3A 4D8BA 1F2AA 3KSEA 4P6EA 2H7JA 1Q6KA 3OVZA 3ERVA 3BPMA 1VSNA 2JQFR 1QDQA 3HHAA 3IMAA 2OULA 4QRXA 4D8EA 1Y4HA 4MM3B 2VHSA 1HUCB 1BY8A 1AU4A 3HWNA 2O6XA 3MHSA 1PE6A 4RNAA 4M0WA 2AYOA 1BGOA 1MDWA 4N8WA 1TLOA 4I07A 4OELA 3LFYA 1A6RA 1PPPA 3F5VA 3KKUA 2IBIA 3OISA 1Y08A 4CDFB 1PPDA 3CH2X 3PHUA 1NB5A 2XU5A 3DF0A 2DCCA 5EGWA 2FRQA 3PW3A 3N4CA 3IUTA 2R9OA 4CDEB 3IFUA 3P5UA 3PNRA 2DOSA 4YVAA 4XUIA 3N3GA 4HWYA 3O0UA 2F7DA 2BTWA 4YYSA 6PADA 3MTNA 5JH3A 4K7CA 2Y5BA 1CS8A 3OF9A 1XKGA 1CB5A 4QBBA 4W4UA 2DCAA 3PRMA 5CVNB 2E02A 4Q8HA 3WXEA 3V6EA 5EZSA 1CTEA 3USVA 2P0RA 2HXZA 2DJFB 1THEA 3IOQA 1YT7A 3MJ5A 5EF4A 4AXMA 5E6JA 1KHPA 1U9VA 5JZEA 2ARYA 4OVZB 1ZCMA 3MP2A 2B1NA 2YJ2A 4FJCA 1SP4B 3PT2A 1U5IA 2G8JA 7PCKA 4PADA 4N79A 5F02A 1YVBA 4WA6A 1VJVA 3PSEA 3MTVA 4A5UA 9PAPA 3IHPA 1FH0A 2YJCA 4P16A 3KWZA 4G54A 4OW0A 4IUMA 1ATKA 2IPPB 1DKIA 2R6NA 3KWBX 3I06A 1YZBA 4YYWA 4DMXA 3QT4A 3KX1A 3HD3A 1F29A 2G6DA 3E9SA 2FTDA 1QMYA 1AIMA 1IWDA 2AIMA 2FQ9A 5CVOB 1X9YA 3KW9A 1U9WA 1NL6A 3KFQA 3QJ3A 3U8EA 2NQGA 4WURA 4CZWA 2CIOA 3H7DA 3RVVA 3H8BA 3W31A 1AYUA 2DJGB 4X6HA 4MZOA 3P5WA 1KFXL 1DEUA 1BP4A 3K8UA 4BOPA 1PADA 4OVZA 3H89A 1PPOA 4XR7A 3IEJA 1CJLA 1O0EA 3CBKA 4BQVA 1PIPA 3MHHA 3QSDA 4AXLA 1ZIVA 2E03A 2DC7A 1TL9A 1CQDA 2ACTA 3H6SA 2GHUA 2FE8A 5FPWA 1PXVA 4OEMA 5EZQA 2BDLA 4PI3A 3TRKA 1GMYA 4PP1A 1AECA 2XU4A 2AGAA 1QXPA 4PT5A 2YJ8A 1QOLA 2ATOA 1ME3A 3PHXA 1PBHA 1GLOA 4P6GA 3H8CA 4YYRA 8PCHA 2PREA 3BC3A 1ME4A 2XU1A 4Q8GA 4ZTBA 2OZ2A 1YALA 2PADA 4FK5A 3I3TA 3PDFA 1UKFA 1MIRA 4RF0A 2E00A 3CH3X 1NQCA 2R9CA 3PHWA 1MEMA 3TMPA 3D6SA 2R9NA 4YYVA 4MZSA 5A24A 5PADA 3O65A 4MSXA 2FUDA 2C0YA 2AYNA 4BS6A 1AYVA 1JQPA 2Y6EA 2JTCA 2HHNA 2XU3A 2PBHA 3TNXA 4PP2E 3IV2A 3BOWA 4HXDB 4ZUXU 2NQIA 3NHEA 3V6CA 3C9EA 1M6DA 2DC9A 2BDZA 4R3DA 3BB7A 1EWOA 4RF1A 2G7YA 3CBJA 2DCDA 1CSBB 5KO3A 2AUXA 1YK8A 1ICFA 3OQCA 4CDDB 2DZZA 2DCBA 4FIPA 2WBFX 4BOUA 5CHVA 2P86A 4DMYA 1PCIA 4BOQA 1AYWA 1KHQA 3N3KA 4GUAA 2BTWB 3RVWA 5CVMA 2P7UA 1STFE 2FRAA 4QRGA 4BOZA 3LXSA 3K9MA 3B21A 1F2CA 2J7QA 3OVXA 2YJ9A 5CHTA 4X6JA 1S4VA 1U9XA 1NLJA 2DC6A 3F75A 1MHWA 3PRPA 2DZYA 3BBAA 4KLBA 4BS5A 2G8EA 1NB3A 4CDCB 2FO5A 3MORA 4I04A 3S3QA 2GFOA 2HWKA 2FT2A 2NQAA 1KFUL 1CPJA 4RKXA 4QH6A 3S3RA 1EWPA 4X6IA 2JQGR 3M99A 3ZNHA 1MEGA 2F1GA 3WXGA 4BOSA 1TU6A 1EWLA 4BPVA 2AS8A 3GCBA 3P5XA 1CV8A 1U9QX 2AUZA 1YK7A 2DC8A 2NQDB 3P5VA 3C0RA 4BSQA 2R9MA 3B79A 4MI7A 4RY2A 2VHFA 2UZJA 1POPA 4YYQA
chains in the Genus database with same CATH topology
2HH5A 1AU3A 3BPFA 5K16A 3O1GA 2PNSA 2CB5A 4NV8A 1GCBA 4YV8A 3PBHA 4W5CA 1BQIA 4QRVA 2AU1A 4N4ZA 1E2TA 4NV7A 4C5PA 1MS6A 3BCNA 1AU0A 1SNKA 2B1MA 2HD5A 1ITOA 1DF0A 5JA7A 3HHIA 3BWKA 3OF8A 1PPNA 1EF7A 1KXRA 1F2BA 1NPZA 2YJBA 1AU2A 3ZUAA 4YYUA 2OP3A 4W5BA 2FYEA 3E1ZB 1CVZA 2AVWA 3K24A 2R9FA 3WXFA 3RVXA 1GECE 4I05A 3AI8A 1EWMA 1K3BB 2E01A 5J94A 1F2AA 3KSEA 4P6EA 2H7JA 1Q6KA 3OVZA 3ERVA 3BPMA 1VSNA 2JQFR 1QDQA 1W4TA 3HHAA 3IMAA 2OULA 4QRXA 1Y4HA 2VHSA 1HUCB 1BY8A 1AU4A 3HWNA 2O6XA 3MHSA 1PE6A 1GX3A 2AYOA 1BGOA 1MDWA 4N8WA 1TLOA 4I07A 4OELA 3LFYA 1A6RA 1PPPA 3F5VA 3KKUA 2IBIA 3OISA 1Y08A 4CDFB 1PPDA 3CH2X 1NB5A 2XU5A 3DF0A 2DCCA 5EGWA 2FRQA 3PW3A 3N4CA 3IUTA 2R9OA 4CDEB 3P5UA 3PNRA 4YVAA 4XUIA 3N3GA 4HWYA 2F7DA 3O0UA 4YYSA 6PADA 3MTNA 5JH3A 4K7CA 2Y5BA 1CS8A 3LTWA 3OF9A 1XKGA 1CB5A 4QBBA 4W4UA 2DCAA 5CVNB 2E02A 4Q8HA 3WXEA 3V6EA 1CTEA 3USVA 2P0RA 2HXZA 2DJFB 1THEA 3IOQA 1YT7A 5EF4A 4AXMA 1KHPA 1U9VA 2VFCA 2ARYA 1ZCMA 1W6FA 2B1NA 2YJ2A 4FJCA 1SP4B 1U5IA 2G8JA 7PCKA 4PADA 4N79A 5F02A 1YVBA 4WA6A 1VJVA 9PAPA 3IHPA 1FH0A 2YJCA 3KWZA 4G54A 1ATKA 2IPPB 2R6NA 3KWBX 3I06A 4YYWA 4DMXA 3QT4A 3KX1A 3HD3A 1F29A 2G6DA 2FTDA 1QMYA 1AIMA 1IWDA 2AIMA 2FQ9A 5CVOB 1X9YA 3KW9A 1U9WA 1NL6A 3KFQA 3QJ3A 3U8EA 2NQGA 4CZWA 2CIOA 3H7DA 3RVVA 3H8BA 1AYUA 2DJGB 4X6HA 4MZOA 3P5WA 1KFXL 1DEUA 1BP4A 3K8UA 1PADA 3H89A 1PPOA 4XR7A 3IEJA 1CJLA 1O0EA 3CBKA 4BQVA 1PIPA 3MHHA 3QSDA 4AXLA 1ZIVA 4BGFA 2E03A 2DC7A 1TL9A 1CQDA 2ACTA 3H6SA 2GHUA 5FPWA 1PXVA 4OEMA 2BDLA 4PI3A 1GMYA 4PP1A 1AECA 2XU4A 1QXPA 2YJ8A 1QOLA 2ATOA 1ME3A 1PBHA 1GLOA 4P6GA 3H8CA 4YYRA 8PCHA 2PREA 3BC3A 1ME4A 2XU1A 4Q8GA 2OZ2A 1YALA 2PADA 4FK5A 3I3TA 3PDFA 1MIRA 2E00A 3CH3X 1NQCA 2R9CA 1MEMA 3D6SA 2R9NA 4YYVA 4MZSA 5A24A 5PADA 4MSXA 2FUDA 2C0YA 2AYNA 4BS6A 1AYVA 1JQPA 2Y6EA 2HHNA 2XU3A 2PBHA 3TNXA 4PP2E 3IV2A 3BOWA 3D9WA 4ZUXU 2NQIA 3NHEA 3V6CA 3C9EA 1M6DA 2DC9A 2BDZA 1EWOA 2G7YA 3CBJA 4GUZA 2DCDA 1CSBB 2AUXA 1YK8A 2VFBA 1ICFA 4CDDB 2DZZA 2DCBA 4FIPA 2WBFX 5CHVA 2P86A 4DMYA 1PCIA 1AYWA 1KHQA 3N3KA 3RVWA 5CVMA 2P7UA 1STFE 2FRAA 4QRGA 3LXSA 3K9MA 1F2CA 3OVXA 2YJ9A 5CHTA 4X6JA 1S4VA 1U9XA 1NLJA 2DC6A 3F75A 1MHWA 2DZYA 4KLBA 4BS5A 2G8EA 1NB3A 4CDCB 2FO5A 3MORA 4I04A 3S3QA 2GFOA 2FT2A 2NQAA 1KFUL 1CPJA 4QH6A 3S3RA 1EWPA 4X6IA 2JQGR 3M99A 1MEGA 2F1GA 3WXGA 2BSZA 1TU6A 1EWLA 4B55A 4BPVA 2AS8A 3GCBA 3P5XA 1CV8A 1U9QX 2AUZA 1YK7A 2DC8A 2NQDB 3P5VA 4BSQA 2R9MA 3B79A 4RY2A 1W5RA 2VHFA 1POPA 4YYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH5 A;  1AU3 A;  3BPF A;  5K16 A;  3O1G A;  2PNS A;  2CB5 A;  1GCB A;  4YV8 A;  3PBH A;  4W5C A;  1BQI A;  4QRV A;  2AU1 A;  4N4Z A;  1MS6 A;  3BCN A;  1AU0 A;  1SNK A;  2B1M A;  2HD5 A;  1ITO A;  1DF0 A;  5JA7 A;  3HHI A;  3BWK A;  3OF8 A;  1PPN A;  1EF7 A;  1KXR A;  1F2B A;  1NPZ A;  2YJB A;  1AU2 A;  3ZUA A;  4YYU A;  2OP3 A;  4W5B A;  2FYE A;  3E1Z B;  1CVZ A;  2AVW A;  3K24 A;  2R9F A;  3WXF A;  3RVX A;  1GEC E;  4I05 A;  3AI8 A;  1EWM A;  1K3B B;  2E01 A;  5J94 A;  1F2A A;  3KSE A;  4P6E A;  2H7J A;  1Q6K A;  3OVZ A;  3ERV A;  3BPM A;  1VSN A;  2JQF R;  1QDQ A;  3HHA A;  3IMA A;  2OUL A;  4QRX A;  1Y4H A;  2VHS A;  1HUC B;  1BY8 A;  1AU4 A;  3HWN A;  2O6X A;  3MHS A;  1PE6 A;  2AYO A;  1BGO A;  1MDW A;  4N8W A;  1TLO A;  4I07 A;  4OEL A;  3LFY A;  1A6R A;  1PPP A;  3F5V A;  3KKU A;  2IBI A;  3OIS A;  1Y08 A;  4CDF B;  1PPD A;  3CH2 X;  1NB5 A;  2XU5 A;  3DF0 A;  2DCC A;  5EGW A;  2FRQ A;  3PW3 A;  3N4C A;  3IUT A;  2R9O A;  4CDE B;  3P5U A;  3PNR A;  4YVA A;  4XUI A;  3N3G A;  4HWY A;  2F7D A;  3O0U A;  4YYS A;  6PAD A;  3MTN A;  5JH3 A;  4K7C A;  2Y5B A;  1CS8 A;  3OF9 A;  1XKG A;  1CB5 A;  4QBB A;  4W4U A;  2DCA A;  5CVN B;  2E02 A;  4Q8H A;  3WXE A;  3V6E A;  1CTE A;  3USV A;  2P0R A;  2HXZ A;  2DJF B;  1THE A;  3IOQ A;  1YT7 A;  5EF4 A;  4AXM A;  1KHP A;  1U9V A;  2ARY A;  1ZCM A;  2B1N A;  2YJ2 A;  4FJC A;  1SP4 B;  1U5I A;  2G8J A;  7PCK A;  4PAD A;  4N79 A;  5F02 A;  1YVB A;  4WA6 A;  1VJV A;  9PAP A;  3IHP A;  1FH0 A;  2YJC A;  3KWZ A;  4G54 A;  1ATK A;  2IPP B;  2R6N A;  3KWB X;  3I06 A;  4YYW A;  4DMX A;  3QT4 A;  3KX1 A;  3HD3 A;  1F29 A;  2G6D A;  2FTD A;  1QMY A;  1AIM A;  1IWD A;  2AIM A;  2FQ9 A;  5CVO B;  1X9Y A;  3KW9 A;  1U9W A;  1NL6 A;  3KFQ A;  3QJ3 A;  3U8E A;  2NQG A;  4CZW A;  2CIO A;  3H7D A;  3RVV A;  3H8B A;  1AYU A;  2DJG B;  4X6H A;  4MZO A;  3P5W A;  1KFX L;  1DEU A;  1BP4 A;  3K8U A;  1PAD A;  3H89 A;  1PPO A;  4XR7 A;  3IEJ A;  1CJL A;  1O0E A;  3CBK A;  4BQV A;  1PIP A;  3MHH A;  3QSD A;  4AXL A;  1ZIV A;  2E03 A;  2DC7 A;  1TL9 A;  1CQD A;  2ACT A;  3H6S A;  2GHU A;  5FPW A;  1PXV A;  4OEM A;  2BDL A;  4PI3 A;  1GMY A;  4PP1 A;  1AEC A;  2XU4 A;  1QXP A;  2YJ8 A;  1QOL A;  2ATO A;  1ME3 A;  1PBH A;  1GLO A;  4P6G A;  3H8C A;  4YYR A;  8PCH A;  2PRE A;  3BC3 A;  1ME4 A;  2XU1 A;  4Q8G A;  2OZ2 A;  1YAL A;  2PAD A;  4FK5 A;  3I3T A;  3PDF A;  1MIR A;  2E00 A;  3CH3 X;  1NQC A;  2R9C A;  1MEM A;  3D6S A;  2R9N A;  4YYV A;  4MZS A;  5A24 A;  5PAD A;  4MSX A;  2FUD A;  2C0Y A;  2AYN A;  4BS6 A;  1AYV A;  1JQP A;  2Y6E A;  2HHN A;  2XU3 A;  2PBH A;  3TNX A;  4PP2 E;  3IV2 A;  3BOW A;  4ZUX U;  2NQI A;  3NHE A;  3V6C A;  3C9E A;  1M6D A;  2DC9 A;  2BDZ A;  1EWO A;  2G7Y A;  3CBJ A;  2DCD A;  1CSB B;  2AUX A;  1YK8 A;  1ICF A;  4CDD B;  2DZZ A;  2DCB A;  4FIP A;  2WBF X;  5CHV A;  2P86 A;  4DMY A;  1PCI A;  1AYW A;  1KHQ A;  3N3K A;  3RVW A;  5CVM A;  2P7U A;  1STF E;  2FRA A;  4QRG A;  3LXS A;  3K9M A;  1F2C A;  3OVX A;  2YJ9 A;  5CHT A;  4X6J A;  1S4V A;  1U9X A;  1NLJ A;  2DC6 A;  3F75 A;  1MHW A;  2DZY A;  4KLB A;  4BS5 A;  2G8E A;  1NB3 A;  4CDC B;  2FO5 A;  3MOR A;  4I04 A;  3S3Q A;  2GFO A;  2FT2 A;  2NQA A;  1KFU L;  1CPJ A;  4QH6 A;  3S3R A;  1EWP A;  4X6I A;  2JQG R;  3M99 A;  1MEG A;  2F1G A;  3WXG A;  1TU6 A;  1EWL A;  4BPV A;  2AS8 A;  3GCB A;  3P5X A;  1CV8 A;  1U9Q X;  2AUZ A;  1YK7 A;  2DC8 A;  2NQD B;  3P5V A;  4BSQ A;  2R9M A;  3B79 A;  4RY2 A;  2VHF A;  1POP A;  4YYQ A; 
#chains in the Genus database with same CATH topology
 2HH5 A;  1AU3 A;  3BPF A;  4XZX A;  5K16 A;  3O1G A;  2PNS A;  2Z84 A;  2CB5 A;  2BU3 A;  1GCB A;  4YV8 A;  3PBH A;  4W5C A;  1BQI A;  4QRV A;  2AU1 A;  4N4Z A;  4REZ A;  1MS6 A;  3BCN A;  1AU0 A;  1SNK A;  2B1M A;  2HD5 A;  1ITO A;  1DF0 A;  2JRI A;  5JA7 A;  3HHI A;  3BWK A;  4D8I A;  3RNV A;  3OF8 A;  1PPN A;  1EF7 A;  1KXR A;  1F2B A;  2J7Q C;  3W30 A;  1NPZ A;  1PVJ A;  3BY4 A;  2YJB A;  1AU2 A;  3ZUA A;  4YYU A;  2OP3 A;  4W5B A;  2FYE A;  3E1Z B;  1CVZ A;  2AVW A;  3K24 A;  2R9F A;  3WXF A;  3RVX A;  1GEC E;  4I05 A;  3AI8 A;  1EWM A;  1K3B B;  2E01 A;  5J94 A;  4IP3 A;  4D8B A;  1F2A A;  3KSE A;  4P6E A;  2H7J A;  1Q6K A;  3OVZ A;  3ERV A;  3BPM A;  1VSN A;  2JQF R;  1QDQ A;  3HHA A;  3IMA A;  2OUL A;  4QRX A;  4D8E A;  1Y4H A;  4MM3 B;  2VHS A;  1HUC B;  1BY8 A;  1AU4 A;  3HWN A;  2O6X A;  3MHS A;  1PE6 A;  4RNA A;  4M0W A;  2AYO A;  1BGO A;  1MDW A;  4N8W A;  1TLO A;  4I07 A;  4OEL A;  3LFY A;  1A6R A;  1PPP A;  3F5V A;  3KKU A;  2IBI A;  3OIS A;  1Y08 A;  4CDF B;  1PPD A;  3CH2 X;  3PHU A;  1NB5 A;  2XU5 A;  3DF0 A;  2DCC A;  5EGW A;  2FRQ A;  3PW3 A;  3N4C A;  3IUT A;  2R9O A;  4CDE B;  3IFU A;  3P5U A;  3PNR A;  2DOS A;  4YVA A;  4XUI A;  3N3G A;  4HWY A;  3O0U A;  2F7D A;  2BTW A;  4YYS A;  6PAD A;  3MTN A;  5JH3 A;  4K7C A;  2Y5B A;  1CS8 A;  3OF9 A;  1XKG A;  1CB5 A;  4QBB A;  4W4U A;  2DCA A;  3PRM A;  5CVN B;  2E02 A;  4Q8H A;  3WXE A;  3V6E A;  5EZS A;  1CTE A;  3USV A;  2P0R A;  2HXZ A;  2DJF B;  1THE A;  3IOQ A;  1YT7 A;  3MJ5 A;  5EF4 A;  4AXM A;  5E6J A;  1KHP A;  1U9V A;  5JZE A;  2ARY A;  4OVZ B;  1ZCM A;  3MP2 A;  2B1N A;  2YJ2 A;  4FJC A;  1SP4 B;  3PT2 A;  1U5I A;  2G8J A;  7PCK A;  4PAD A;  4N79 A;  5F02 A;  1YVB A;  4WA6 A;  1VJV A;  3PSE A;  3MTV A;  4A5U A;  9PAP A;  3IHP A;  1FH0 A;  2YJC A;  4P16 A;  3KWZ A;  4G54 A;  4OW0 A;  4IUM A;  1ATK A;  2IPP B;  1DKI A;  2R6N A;  3KWB X;  3I06 A;  1YZB A;  4YYW A;  4DMX A;  3QT4 A;  3KX1 A;  3HD3 A;  1F29 A;  2G6D A;  3E9S A;  2FTD A;  1QMY A;  1AIM A;  1IWD A;  2AIM A;  2FQ9 A;  5CVO B;  1X9Y A;  3KW9 A;  1U9W A;  1NL6 A;  3KFQ A;  3QJ3 A;  3U8E A;  2NQG A;  4WUR A;  4CZW A;  2CIO A;  3H7D A;  3RVV A;  3H8B A;  3W31 A;  1AYU A;  2DJG B;  4X6H A;  4MZO A;  3P5W A;  1KFX L;  1DEU A;  1BP4 A;  3K8U A;  4BOP A;  1PAD A;  4OVZ A;  3H89 A;  1PPO A;  4XR7 A;  3IEJ A;  1CJL A;  1O0E A;  3CBK A;  4BQV A;  1PIP A;  3MHH A;  3QSD A;  4AXL A;  1ZIV A;  2E03 A;  2DC7 A;  1TL9 A;  1CQD A;  2ACT A;  3H6S A;  2GHU A;  2FE8 A;  5FPW A;  1PXV A;  4OEM A;  5EZQ A;  2BDL A;  4PI3 A;  3TRK A;  1GMY A;  4PP1 A;  1AEC A;  2XU4 A;  2AGA A;  1QXP A;  4PT5 A;  2YJ8 A;  1QOL A;  2ATO A;  1ME3 A;  3PHX A;  1PBH A;  1GLO A;  4P6G A;  3H8C A;  4YYR A;  8PCH A;  2PRE A;  3BC3 A;  1ME4 A;  2XU1 A;  4Q8G A;  4ZTB A;  2OZ2 A;  1YAL A;  2PAD A;  4FK5 A;  3I3T A;  3PDF A;  1UKF A;  1MIR A;  4RF0 A;  2E00 A;  3CH3 X;  1NQC A;  2R9C A;  3PHW A;  1MEM A;  3TMP A;  3D6S A;  2R9N A;  4YYV A;  4MZS A;  5A24 A;  5PAD A;  3O65 A;  4MSX A;  2FUD A;  2C0Y A;  2AYN A;  4BS6 A;  1AYV A;  1JQP A;  2Y6E A;  2JTC A;  2HHN A;  2XU3 A;  2PBH A;  3TNX A;  4PP2 E;  3IV2 A;  3BOW A;  4HXD B;  4ZUX U;  2NQI A;  3NHE A;  3V6C A;  3C9E A;  1M6D A;  2DC9 A;  2BDZ A;  4R3D A;  3BB7 A;  1EWO A;  4RF1 A;  2G7Y A;  3CBJ A;  2DCD A;  1CSB B;  5KO3 A;  2AUX A;  1YK8 A;  1ICF A;  3OQC A;  4CDD B;  2DZZ A;  2DCB A;  4FIP A;  2WBF X;  4BOU A;  5CHV A;  2P86 A;  4DMY A;  1PCI A;  4BOQ A;  1AYW A;  1KHQ A;  3N3K A;  4GUA A;  2BTW B;  3RVW A;  5CVM A;  2P7U A;  1STF E;  2FRA A;  4QRG A;  4BOZ A;  3LXS A;  3K9M A;  3B21 A;  1F2C A;  2J7Q A;  3OVX A;  2YJ9 A;  5CHT A;  4X6J A;  1S4V A;  1U9X A;  1NLJ A;  2DC6 A;  3F75 A;  1MHW A;  3PRP A;  2DZY A;  3BBA A;  4KLB A;  4BS5 A;  2G8E A;  1NB3 A;  4CDC B;  2FO5 A;  3MOR A;  4I04 A;  3S3Q A;  2GFO A;  2HWK A;  2FT2 A;  2NQA A;  1KFU L;  1CPJ A;  4RKX A;  4QH6 A;  3S3R A;  1EWP A;  4X6I A;  2JQG R;  3M99 A;  3ZNH A;  1MEG A;  2F1G A;  3WXG A;  4BOS A;  1TU6 A;  1EWL A;  4BPV A;  2AS8 A;  3GCB A;  3P5X A;  1CV8 A;  1U9Q X;  2AUZ A;  1YK7 A;  2DC8 A;  2NQD B;  3P5V A;  3C0R A;  4BSQ A;  2R9M A;  3B79 A;  4MI7 A;  4RY2 A;  2VHF A;  2UZJ A;  1POP A;  4YYQ A; 
#chains in the Genus database with same CATH homology
 2HH5 A;  1AU3 A;  3BPF A;  5K16 A;  3O1G A;  2PNS A;  2CB5 A;  4NV8 A;  1GCB A;  4YV8 A;  3PBH A;  4W5C A;  1BQI A;  4QRV A;  2AU1 A;  4N4Z A;  1E2T A;  4NV7 A;  4C5P A;  1MS6 A;  3BCN A;  1AU0 A;  1SNK A;  2B1M A;  2HD5 A;  1ITO A;  1DF0 A;  5JA7 A;  3HHI A;  3BWK A;  3OF8 A;  1PPN A;  1EF7 A;  1KXR A;  1F2B A;  1NPZ A;  2YJB A;  1AU2 A;  3ZUA A;  4YYU A;  2OP3 A;  4W5B A;  2FYE A;  3E1Z B;  1CVZ A;  2AVW A;  3K24 A;  2R9F A;  3WXF A;  3RVX A;  1GEC E;  4I05 A;  3AI8 A;  1EWM A;  1K3B B;  2E01 A;  5J94 A;  1F2A A;  3KSE A;  4P6E A;  2H7J A;  1Q6K A;  3OVZ A;  3ERV A;  3BPM A;  1VSN A;  2JQF R;  1QDQ A;  1W4T A;  3HHA A;  3IMA A;  2OUL A;  4QRX A;  1Y4H A;  2VHS A;  1HUC B;  1BY8 A;  1AU4 A;  3HWN A;  2O6X A;  3MHS A;  1PE6 A;  1GX3 A;  2AYO A;  1BGO A;  1MDW A;  4N8W A;  1TLO A;  4I07 A;  4OEL A;  3LFY A;  1A6R A;  1PPP A;  3F5V A;  3KKU A;  2IBI A;  3OIS A;  1Y08 A;  4CDF B;  1PPD A;  3CH2 X;  1NB5 A;  2XU5 A;  3DF0 A;  2DCC A;  5EGW A;  2FRQ A;  3PW3 A;  3N4C A;  3IUT A;  2R9O A;  4CDE B;  3P5U A;  3PNR A;  4YVA A;  4XUI A;  3N3G A;  4HWY A;  2F7D A;  3O0U A;  4YYS A;  6PAD A;  3MTN A;  5JH3 A;  4K7C A;  2Y5B A;  1CS8 A;  3LTW A;  3OF9 A;  1XKG A;  1CB5 A;  4QBB A;  4W4U A;  2DCA A;  5CVN B;  2E02 A;  4Q8H A;  3WXE A;  3V6E A;  1CTE A;  3USV A;  2P0R A;  2HXZ A;  2DJF B;  1THE A;  3IOQ A;  1YT7 A;  5EF4 A;  4AXM A;  1KHP A;  1U9V A;  2VFC A;  2ARY A;  1ZCM A;  1W6F A;  2B1N A;  2YJ2 A;  4FJC A;  1SP4 B;  1U5I A;  2G8J A;  7PCK A;  4PAD A;  4N79 A;  5F02 A;  1YVB A;  4WA6 A;  1VJV A;  9PAP A;  3IHP A;  1FH0 A;  2YJC A;  3KWZ A;  4G54 A;  1ATK A;  2IPP B;  2R6N A;  3KWB X;  3I06 A;  4YYW A;  4DMX A;  3QT4 A;  3KX1 A;  3HD3 A;  1F29 A;  2G6D A;  2FTD A;  1QMY A;  1AIM A;  1IWD A;  2AIM A;  2FQ9 A;  5CVO B;  1X9Y A;  3KW9 A;  1U9W A;  1NL6 A;  3KFQ A;  3QJ3 A;  3U8E A;  2NQG A;  4CZW A;  2CIO A;  3H7D A;  3RVV A;  3H8B A;  1AYU A;  2DJG B;  4X6H A;  4MZO A;  3P5W A;  1KFX L;  1DEU A;  1BP4 A;  3K8U A;  1PAD A;  3H89 A;  1PPO A;  4XR7 A;  3IEJ A;  1CJL A;  1O0E A;  3CBK A;  4BQV A;  1PIP A;  3MHH A;  3QSD A;  4AXL A;  1ZIV A;  4BGF A;  2E03 A;  2DC7 A;  1TL9 A;  1CQD A;  2ACT A;  3H6S A;  2GHU A;  5FPW A;  1PXV A;  4OEM A;  2BDL A;  4PI3 A;  1GMY A;  4PP1 A;  1AEC A;  2XU4 A;  1QXP A;  2YJ8 A;  1QOL A;  2ATO A;  1ME3 A;  1PBH A;  1GLO A;  4P6G A;  3H8C A;  4YYR A;  8PCH A;  2PRE A;  3BC3 A;  1ME4 A;  2XU1 A;  4Q8G A;  2OZ2 A;  1YAL A;  2PAD A;  4FK5 A;  3I3T A;  3PDF A;  1MIR A;  2E00 A;  3CH3 X;  1NQC A;  2R9C A;  1MEM A;  3D6S A;  2R9N A;  4YYV A;  4MZS A;  5A24 A;  5PAD A;  4MSX A;  2FUD A;  2C0Y A;  2AYN A;  4BS6 A;  1AYV A;  1JQP A;  2Y6E A;  2HHN A;  2XU3 A;  2PBH A;  3TNX A;  4PP2 E;  3IV2 A;  3BOW A;  3D9W A;  4ZUX U;  2NQI A;  3NHE A;  3V6C A;  3C9E A;  1M6D A;  2DC9 A;  2BDZ A;  1EWO A;  2G7Y A;  3CBJ A;  4GUZ A;  2DCD A;  1CSB B;  2AUX A;  1YK8 A;  2VFB A;  1ICF A;  4CDD B;  2DZZ A;  2DCB A;  4FIP A;  2WBF X;  5CHV A;  2P86 A;  4DMY A;  1PCI A;  1AYW A;  1KHQ A;  3N3K A;  3RVW A;  5CVM A;  2P7U A;  1STF E;  2FRA A;  4QRG A;  3LXS A;  3K9M A;  1F2C A;  3OVX A;  2YJ9 A;  5CHT A;  4X6J A;  1S4V A;  1U9X A;  1NLJ A;  2DC6 A;  3F75 A;  1MHW A;  2DZY A;  4KLB A;  4BS5 A;  2G8E A;  1NB3 A;  4CDC B;  2FO5 A;  3MOR A;  4I04 A;  3S3Q A;  2GFO A;  2FT2 A;  2NQA A;  1KFU L;  1CPJ A;  4QH6 A;  3S3R A;  1EWP A;  4X6I A;  2JQG R;  3M99 A;  1MEG A;  2F1G A;  3WXG A;  2BSZ A;  1TU6 A;  1EWL A;  4B55 A;  4BPV A;  2AS8 A;  3GCB A;  3P5X A;  1CV8 A;  1U9Q X;  2AUZ A;  1YK7 A;  2DC8 A;  2NQD B;  3P5V A;  4BSQ A;  2R9M A;  3B79 A;  4RY2 A;  1W5R A;  2VHF A;  1POP A;  4YYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...