3HHIA

Crystal structure of cathepsin b from t. brucei in complex with ca074
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
SILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACGSCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVSDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCDYTCDDPTIPVVNYRSWTSYALQGEDDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKIANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin B-like cysteine protease
publication title Crystal Structures of TbCatB and rhodesain, potential chemotherapeutic targets and major cysteine proteases of Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hhiA00
2HH5A 4MZOA 4ZUXU 3V6EA 1POPA 3K9MA 5A24A 2PREA 3P5UA 3RVXA 4PP2E 3U8EA 2R9MA 4I07A 2E03A 1PIPA 1Y4HA 1MIRA 1FH0A 3K8UA 1ZIVA 1EWOA 1AU4A 2DC6A 4I04A 2DC8A 2E02A 3ZUAA 1YK8A 2XU4A 1U5IA 3MORA 3BOWA 1BGOA 3P5VA 2B1MA 1M6DA 1F2BA 1K3BB 2AU1A 3IUTA 2E00A 4CZWA 4BPVA 3KWBX 3E1ZB 4QRGA 1CVZA 3IEJA 4YYSA 2YJBA 1TL9A 3H8BA 3M99A 5CVOB 1ATKA 4X6IA 1EWMA 4QRVA 3CBJA 1KHQA 3OF9A 2F1GA 2NQDB 2OZ2A 4X6JA 2VHFA 9PAPA 2Y5BA 3HD3A 3CBKA 1Y08A 2DZZA 4N4ZA 1GMYA 3BPMA 2R6NA 3N3GA 4CDFB 2JQFR 1O0EA 2NQIA 1SNKA 4FIPA 4QH6A 4CDDB 2DCBA 3F5VA 1MHWA 4BS6A 2G8JA 1GCBA 4K7CA 2ACTA 2HD5A 3WXFA 2R9OA 2AVWA 1ME4A 2YJCA 3TNXA 4FK5A 4YYUA 4XR7A 1KFXL 3KSEA 2NQGA 2FRAA 2C0YA 3WXGA 4CDCB 1JQPA 3MTNA 4MZSA 3IOQA 1ME3A 1A6RA 2YJ8A 2PNSA 4BQVA 4CDEB 4AXLA 3C9EA 5CHVA 3CH3X 1NLJA 4RY2A 3KX1A 5K16A 3HWNA 1F2AA 2CB5A 3H8CA 1TLOA 2G7YA 1CQDA 1SP4B 4N79A 1DEUA 1THEA 1YVBA 3OVXA 1BQIA 1EWLA 3OISA 1MEGA 1IWDA 1CSBB 1MDWA 1CB5A 2P86A 4YVAA 3MHSA 4PP1A 1CS8A 1CTEA 1ICFA 1AYWA 2OP3A 2DJGB 4YYVA 5FPWA 2H7JA 3P5WA 1QMYA 3USVA 2G8EA 2YJ2A 3I3TA 1Q6KA 4P6GA 4P6EA 3P5XA 2WBFX 2DCDA 1BY8A 3KW9A 3OVZA 1S4VA 2R9NA 1YALA 2DC7A 3LXSA 3KFQA 2FRQA 1AU2A 3RVVA 3HHAA 4W5BA 3PBHA 5CHTA 2XU5A 5CVNB 3BWKA 6PADA 2E01A 2P7UA 3D6SA 1QOLA 5EGWA 1XKGA 3KWZA 1NPZA 3GCBA 1U9QX 2NQAA 2GFOA 2ARYA 3LFYA 2OULA 1NQCA 1ZCMA 1AYUA 4QBBA 3F75A 1F2CA 2DCCA 1MS6A 3N3KA 1PADA 2DZYA 2IPPB 2R9CA 1PPDA 2Y6EA 4HWYA 1PPOA 2XU1A 4YYRA 3O0UA 5JH3A 4OEMA 3ERVA 4Q8HA 4PI3A 2DJFB 2IBIA 3H6SA 3PNRA 2CIOA 1U9WA 5J94A 1KHPA 3HHIA 4AXMA 2AYOA 3BCNA 1BP4A 3IHPA 5PADA 1PPNA 3N4CA 4W4UA 3IMAA 5EF4A 4FJCA 1ITOA 3AI8A 1KFUL 3OF8A 1X9YA 2F7DA 2XU3A 1PPPA 1CV8A 4DMYA 2AUXA 1F29A 4BSQA 1VJVA 1PBHA 1MEMA 2AS8A 2GHUA 4BS5A 3CH2X 2BDLA 2AIMA 2FUDA 1CJLA 1AU3A 3KKUA 3K24A 4YV8A 4PADA 1AECA 3QT4A 1YT7A 1YK7A 1AYVA 1PE6A 2O6XA 2HHNA 1NL6A 1PXVA 4MSXA 3V6CA 3BPFA 1U9VA 2G6DA 4KLBA 4OELA 4YYWA 8PCHA 2P0RA 1DF0A 1EWPA 2R9FA 1EF7A 1KXRA 2BDZA 5F02A 4N8WA 1AIMA 4YYQA 2DC9A 1NB3A 2FQ9A 1HUCB 1VSNA 3S3RA 3H7DA 4WA6A 4XUIA 2B1NA 2VHSA 1GECE 2AUZA 1QDQA 1GLOA 3PDFA 4W5CA 1QXPA 1U9XA 3O1GA 5JA7A 4QRXA 3WXEA 1CPJA 1TU6A 3IV2A 3MHHA 3QJ3A 2HXZA 2AYNA 3QSDA 3PW3A 1STFE 2PBHA 3H89A 3I06A 2JQGR 4X6HA 3B79A 3NHEA 2DCAA 1AU0A 2FT2A 4G54A 2FTDA 4DMXA 4Q8GA 2ATOA 4I05A 3S3QA 1NB5A 3BC3A 2FO5A 7PCKA 2YJ9A 1PCIA 3DF0A 5CVMA 3RVWA 2PADA 2FYEA
chains in the Genus database with same CATH superfamily
2HH5A 4MZOA 4A5UA 4ZUXU 3V6EA 1POPA 3K9MA 5A24A 2PREA 5E6JA 3P5UA 3RVXA 2DOSA 4PP2E 3U8EA 2R9MA 4I07A 2E03A 1PIPA 1Y4HA 3BB7A 4REZA 1MIRA 1FH0A 3K8UA 1ZIVA 1EWOA 1AU4A 4BOQA 2DC6A 5EZQA 4I04A 2DC8A 2E02A 3ZUAA 1YK8A 2XU4A 1U5IA 3PHUA 4P16A 3MORA 4OVZB 3BOWA 2BTWA 1BGOA 3P5VA 2B1MA 1M6DA 1F2BA 1K3BB 2AU1A 3IUTA 2E00A 2UZJA 4CZWA 5JZEA 4BPVA 3C0RA 3KWBX 3E1ZB 4QRGA 3TMPA 1CVZA 3IEJA 3O65A 4YYSA 2YJBA 1TL9A 3H8BA 3M99A 5CVOB 1ATKA 4X6IA 1EWMA 4QRVA 3CBJA 1KHQA 3OF9A 2F1GA 1UKFA 2NQDB 2OZ2A 4X6JA 4MM3B 2VHFA 4R3DA 3W31A 9PAPA 2Y5BA 3HD3A 3CBKA 1Y08A 2DZZA 4N4ZA 1GMYA 3BPMA 4RNAA 2R6NA 3N3GA 4CDFB 2JQFR 1O0EA 4XZXA 2NQIA 1SNKA 4BOUA 4FIPA 4QH6A 4CDDB 2DCBA 3F5VA 4BOPA 1MHWA 4BS6A 2FE8A 2G8JA 1GCBA 4D8BA 4K7CA 2ACTA 2HD5A 3WXFA 2R9OA 2AVWA 3RNVA 1ME4A 2YJCA 3TNXA 4FK5A 4BOZA 3MP2A 3ZNHA 4YYUA 4XR7A 1KFXL 3PT2A 3KSEA 2NQGA 2FRAA 4RF0A 2C0YA 3WXGA 4CDCB 1JQPA 3IFUA 3MTNA 4MZSA 3IOQA 1ME3A 1A6RA 4ZTBA 2YJ8A 2PNSA 4BQVA 3MTVA 4CDEB 4AXLA 3C9EA 5CHVA 3CH3X 3PRPA 1NLJA 4RY2A 3KX1A 5K16A 3HWNA 1F2AA 4HXDB 2CB5A 3H8CA 1TLOA 2G7YA 4D8EA 1CQDA 3MJ5A 1SP4B 1DKIA 4N79A 1DEUA 1THEA 1YVBA 3OVXA 1BQIA 1EWLA 3OISA 1MEGA 1IWDA 1CSBB 1MDWA 1CB5A 2P86A 4YVAA 3MHSA 4PP1A 5EZSA 1CS8A 1CTEA 1ICFA 1AYWA 2OP3A 2DJGB 4YYVA 3PSEA 5FPWA 2H7JA 3P5WA 1QMYA 3USVA 2G8EA 2YJ2A 2Z84A 3I3TA 1Q6KA 4P6GA 4P6EA 3P5XA 2WBFX 2DCDA 2HWKA 1BY8A 3KW9A 3OVZA 1S4VA 2J7QA 2R9NA 1YALA 2DC7A 3LXSA 3KFQA 2BTWB 2FRQA 1AU2A 3RVVA 3HHAA 4W5BA 3PBHA 4OW0A 5CHTA 4RF1A 2XU5A 5CVNB 3BWKA 6PADA 2E01A 2P7UA 3D6SA 1QOLA 5EGWA 1XKGA 3KWZA 1NPZA 3BY4A 2JRIA 3GCBA 1U9QX 2NQAA 2GFOA 2ARYA 3LFYA 2OULA 1NQCA 1ZCMA 1AYUA 4QBBA 3F75A 1F2CA 2DCCA 1MS6A 3N3KA 1PADA 2DZYA 2IPPB 3W30A 2R9CA 1PPDA 2Y6EA 4HWYA 1PPOA 2XU1A 4YYRA 3O0UA 5JH3A 4OEMA 3ERVA 4Q8HA 4PI3A 2DJFB 2IBIA 3H6SA 3PNRA 2CIOA 1U9WA 5J94A 1KHPA 3HHIA 2AGAA 4MI7A 4AXMA 2AYOA 3BCNA 1BP4A 3IHPA 5PADA 1PPNA 3N4CA 4W4UA 3IMAA 5EF4A 4FJCA 1ITOA 3AI8A 1KFUL 4BOSA 3OF8A 1PVJA 4D8IA 1X9YA 2F7DA 2XU3A 1PPPA 1CV8A 4DMYA 4M0WA 2AUXA 1F29A 4BSQA 1VJVA 1PBHA 1MEMA 2AS8A 2GHUA 4OVZA 4BS5A 3CH2X 2BDLA 2AIMA 2FUDA 1CJLA 1AU3A 3E9SA 3KKUA 5KO3A 3K24A 4YV8A 4PADA 1AECA 3QT4A 1YT7A 1YK7A 1AYVA 1PE6A 2O6XA 2HHNA 1NL6A 1PXVA 4MSXA 3V6CA 4IUMA 3BPFA 1U9VA 2G6DA 4KLBA 4GUAA 4OELA 4YYWA 8PCHA 2JTCA 2P0RA 1DF0A 1EWPA 2R9FA 1EF7A 1KXRA 2BDZA 5F02A 4N8WA 2BU3A 1AIMA 4YYQA 2DC9A 1NB3A 2FQ9A 1HUCB 1VSNA 3S3RA 3PHWA 3H7DA 4WA6A 4XUIA 2B1NA 2VHSA 4WURA 1GECE 2J7QC 2AUZA 1QDQA 1GLOA 3PRMA 3PDFA 4W5CA 1QXPA 1U9XA 3O1GA 5JA7A 3BBAA 4QRXA 3WXEA 3PHXA 1CPJA 1TU6A 3IV2A 3MHHA 4RKXA 3QJ3A 2HXZA 2AYNA 3QSDA 3PW3A 1STFE 2PBHA 3H89A 3I06A 3B21A 2JQGR 4X6HA 3B79A 3NHEA 4IP3A 2DCAA 1YZBA 1AU0A 3TRKA 2FT2A 4G54A 2FTDA 4DMXA 4Q8GA 2ATOA 4I05A 4PT5A 3S3QA 1NB5A 3BC3A 2FO5A 7PCKA 2YJ9A 1PCIA 3DF0A 3OQCA 5CVMA 3RVWA 2PADA 2FYEA
chains in the Genus database with same CATH topology
2HH5A 4MZOA 4ZUXU 3V6EA 1POPA 3K9MA 5A24A 2PREA 3P5UA 3RVXA 4PP2E 3U8EA 2R9MA 4I07A 2E03A 1PIPA 1Y4HA 1MIRA 2VFBA 1FH0A 3K8UA 1ZIVA 1EWOA 1AU4A 3LTWA 2DC6A 4I04A 2DC8A 2E02A 3ZUAA 1YK8A 2XU4A 1U5IA 3MORA 3BOWA 1BGOA 3P5VA 2B1MA 1M6DA 1F2BA 1K3BB 2AU1A 3IUTA 2E00A 4CZWA 4BPVA 3KWBX 3E1ZB 4QRGA 1CVZA 3IEJA 4YYSA 2YJBA 1TL9A 3H8BA 3M99A 5CVOB 1W5RA 1ATKA 4X6IA 1EWMA 4QRVA 3CBJA 1KHQA 3OF9A 2F1GA 2NQDB 2OZ2A 4X6JA 2BSZA 2VHFA 9PAPA 2Y5BA 3HD3A 3CBKA 1Y08A 2DZZA 4N4ZA 1GMYA 3BPMA 2R6NA 3N3GA 4CDFB 2JQFR 1O0EA 2NQIA 1SNKA 4FIPA 4QH6A 4CDDB 2DCBA 3F5VA 1MHWA 4BS6A 2G8JA 1GCBA 4K7CA 2ACTA 2HD5A 3WXFA 2R9OA 2AVWA 1ME4A 2YJCA 3TNXA 4FK5A 4YYUA 4XR7A 1KFXL 3KSEA 2NQGA 2FRAA 2C0YA 3WXGA 4CDCB 1JQPA 3MTNA 4MZSA 3IOQA 1ME3A 1A6RA 2YJ8A 2PNSA 4BQVA 4CDEB 4AXLA 3C9EA 5CHVA 3CH3X 1NLJA 4RY2A 3KX1A 5K16A 3HWNA 1F2AA 2CB5A 3H8CA 1TLOA 2G7YA 1CQDA 1SP4B 4N79A 1DEUA 1THEA 1YVBA 3OVXA 1BQIA 4BGFA 1EWLA 3OISA 1MEGA 1IWDA 1CSBB 1MDWA 1CB5A 2P86A 4YVAA 4GUZA 3MHSA 4PP1A 1CS8A 1CTEA 1ICFA 1AYWA 2OP3A 2DJGB 4YYVA 2VFCA 5FPWA 2H7JA 3P5WA 1QMYA 3USVA 2G8EA 2YJ2A 3I3TA 1Q6KA 4P6GA 4P6EA 3P5XA 2WBFX 2DCDA 1BY8A 3KW9A 3OVZA 1S4VA 2R9NA 1YALA 2DC7A 3LXSA 3KFQA 2FRQA 1AU2A 3RVVA 3HHAA 4W5BA 3PBHA 5CHTA 2XU5A 5CVNB 3BWKA 6PADA 2E01A 2P7UA 3D6SA 1QOLA 5EGWA 1XKGA 3KWZA 1NPZA 3GCBA 1U9QX 4B55A 2NQAA 2GFOA 2ARYA 3LFYA 2OULA 1NQCA 1ZCMA 1AYUA 4QBBA 3F75A 1F2CA 2DCCA 1MS6A 3N3KA 1PADA 2DZYA 2IPPB 2R9CA 1PPDA 2Y6EA 4HWYA 4C5PA 1PPOA 2XU1A 4YYRA 3O0UA 5JH3A 4OEMA 3ERVA 4Q8HA 4PI3A 2DJFB 2IBIA 1W6FA 3H6SA 3PNRA 2CIOA 1U9WA 5J94A 1KHPA 3HHIA 4AXMA 2AYOA 3BCNA 1BP4A 3IHPA 5PADA 1PPNA 3N4CA 4W4UA 3IMAA 5EF4A 4FJCA 1ITOA 3AI8A 1KFUL 3OF8A 1X9YA 2F7DA 2XU3A 1PPPA 1CV8A 4DMYA 2AUXA 1F29A 4BSQA 1VJVA 1PBHA 1MEMA 2AS8A 2GHUA 4BS5A 3CH2X 2BDLA 2AIMA 2FUDA 1CJLA 1AU3A 4NV8A 3KKUA 3K24A 4YV8A 4PADA 1AECA 3QT4A 1YT7A 1YK7A 1AYVA 1PE6A 1W4TA 2HHNA 2O6XA 1NL6A 1PXVA 4MSXA 3V6CA 3BPFA 1U9VA 2G6DA 4KLBA 4NV7A 4OELA 4YYWA 8PCHA 1E2TA 2P0RA 1DF0A 1EWPA 2R9FA 1EF7A 1KXRA 2BDZA 5F02A 4N8WA 1AIMA 4YYQA 2DC9A 1NB3A 2FQ9A 1HUCB 1VSNA 3D9WA 3S3RA 3H7DA 4WA6A 4XUIA 2B1NA 2VHSA 1GECE 2AUZA 1QDQA 1GLOA 3PDFA 4W5CA 1QXPA 1U9XA 3O1GA 5JA7A 4QRXA 3WXEA 1CPJA 1TU6A 3IV2A 3MHHA 3QJ3A 2HXZA 2AYNA 3QSDA 3PW3A 1GX3A 1STFE 2PBHA 3H89A 3I06A 2JQGR 4X6HA 3B79A 3NHEA 2DCAA 1AU0A 2FT2A 4G54A 2FTDA 4DMXA 4Q8GA 2ATOA 4I05A 3S3QA 1NB5A 3BC3A 2FO5A 7PCKA 2YJ9A 1PCIA 3DF0A 5CVMA 3RVWA 2PADA 2FYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HH5 A;  4MZO A;  4ZUX U;  3V6E A;  1POP A;  3K9M A;  5A24 A;  2PRE A;  3P5U A;  3RVX A;  4PP2 E;  3U8E A;  2R9M A;  4I07 A;  2E03 A;  1PIP A;  1Y4H A;  1MIR A;  1FH0 A;  3K8U A;  1ZIV A;  1EWO A;  1AU4 A;  2DC6 A;  4I04 A;  2DC8 A;  2E02 A;  3ZUA A;  1YK8 A;  2XU4 A;  1U5I A;  3MOR A;  3BOW A;  1BGO A;  3P5V A;  2B1M A;  1M6D A;  1F2B A;  1K3B B;  2AU1 A;  3IUT A;  2E00 A;  4CZW A;  4BPV A;  3KWB X;  3E1Z B;  4QRG A;  1CVZ A;  3IEJ A;  4YYS A;  2YJB A;  1TL9 A;  3H8B A;  3M99 A;  5CVO B;  1ATK A;  4X6I A;  1EWM A;  4QRV A;  3CBJ A;  1KHQ A;  3OF9 A;  2F1G A;  2NQD B;  2OZ2 A;  4X6J A;  2VHF A;  9PAP A;  2Y5B A;  3HD3 A;  3CBK A;  1Y08 A;  2DZZ A;  4N4Z A;  1GMY A;  3BPM A;  2R6N A;  3N3G A;  4CDF B;  2JQF R;  1O0E A;  2NQI A;  1SNK A;  4FIP A;  4QH6 A;  4CDD B;  2DCB A;  3F5V A;  1MHW A;  4BS6 A;  2G8J A;  1GCB A;  4K7C A;  2ACT A;  2HD5 A;  3WXF A;  2R9O A;  2AVW A;  1ME4 A;  2YJC A;  3TNX A;  4FK5 A;  4YYU A;  4XR7 A;  1KFX L;  3KSE A;  2NQG A;  2FRA A;  2C0Y A;  3WXG A;  4CDC B;  1JQP A;  3MTN A;  4MZS A;  3IOQ A;  1ME3 A;  1A6R A;  2YJ8 A;  2PNS A;  4BQV A;  4CDE B;  4AXL A;  3C9E A;  5CHV A;  3CH3 X;  1NLJ A;  4RY2 A;  3KX1 A;  5K16 A;  3HWN A;  1F2A A;  2CB5 A;  3H8C A;  1TLO A;  2G7Y A;  1CQD A;  1SP4 B;  4N79 A;  1DEU A;  1THE A;  1YVB A;  3OVX A;  1BQI A;  1EWL A;  3OIS A;  1MEG A;  1IWD A;  1CSB B;  1MDW A;  1CB5 A;  2P86 A;  4YVA A;  3MHS A;  4PP1 A;  1CS8 A;  1CTE A;  1ICF A;  1AYW A;  2OP3 A;  2DJG B;  4YYV A;  5FPW A;  2H7J A;  3P5W A;  1QMY A;  3USV A;  2G8E A;  2YJ2 A;  3I3T A;  1Q6K A;  4P6G A;  4P6E A;  3P5X A;  2WBF X;  2DCD A;  1BY8 A;  3KW9 A;  3OVZ A;  1S4V A;  2R9N A;  1YAL A;  2DC7 A;  3LXS A;  3KFQ A;  2FRQ A;  1AU2 A;  3RVV A;  3HHA A;  4W5B A;  3PBH A;  5CHT A;  2XU5 A;  5CVN B;  3BWK A;  6PAD A;  2E01 A;  2P7U A;  3D6S A;  1QOL A;  5EGW A;  1XKG A;  3KWZ A;  1NPZ A;  3GCB A;  1U9Q X;  2NQA A;  2GFO A;  2ARY A;  3LFY A;  2OUL A;  1NQC A;  1ZCM A;  1AYU A;  4QBB A;  3F75 A;  1F2C A;  2DCC A;  1MS6 A;  3N3K A;  1PAD A;  2DZY A;  2IPP B;  2R9C A;  1PPD A;  2Y6E A;  4HWY A;  1PPO A;  2XU1 A;  4YYR A;  3O0U A;  5JH3 A;  4OEM A;  3ERV A;  4Q8H A;  4PI3 A;  2DJF B;  2IBI A;  3H6S A;  3PNR A;  2CIO A;  1U9W A;  5J94 A;  1KHP A;  3HHI A;  4AXM A;  2AYO A;  3BCN A;  1BP4 A;  3IHP A;  5PAD A;  1PPN A;  3N4C A;  4W4U A;  3IMA A;  5EF4 A;  4FJC A;  1ITO A;  3AI8 A;  1KFU L;  3OF8 A;  1X9Y A;  2F7D A;  2XU3 A;  1PPP A;  1CV8 A;  4DMY A;  2AUX A;  1F29 A;  4BSQ A;  1VJV A;  1PBH A;  1MEM A;  2AS8 A;  2GHU A;  4BS5 A;  3CH2 X;  2BDL A;  2AIM A;  2FUD A;  1CJL A;  1AU3 A;  3KKU A;  3K24 A;  4YV8 A;  4PAD A;  1AEC A;  3QT4 A;  1YT7 A;  1YK7 A;  1AYV A;  1PE6 A;  2O6X A;  2HHN A;  1NL6 A;  1PXV A;  4MSX A;  3V6C A;  3BPF A;  1U9V A;  2G6D A;  4KLB A;  4OEL A;  4YYW A;  8PCH A;  2P0R A;  1DF0 A;  1EWP A;  2R9F A;  1EF7 A;  1KXR A;  2BDZ A;  5F02 A;  4N8W A;  1AIM A;  4YYQ A;  2DC9 A;  1NB3 A;  2FQ9 A;  1HUC B;  1VSN A;  3S3R A;  3H7D A;  4WA6 A;  4XUI A;  2B1N A;  2VHS A;  1GEC E;  2AUZ A;  1QDQ A;  1GLO A;  3PDF A;  4W5C A;  1QXP A;  1U9X A;  3O1G A;  5JA7 A;  4QRX A;  3WXE A;  1CPJ A;  1TU6 A;  3IV2 A;  3MHH A;  3QJ3 A;  2HXZ A;  2AYN A;  3QSD A;  3PW3 A;  1STF E;  2PBH A;  3H89 A;  3I06 A;  2JQG R;  4X6H A;  3B79 A;  3NHE A;  2DCA A;  1AU0 A;  2FT2 A;  4G54 A;  2FTD A;  4DMX A;  4Q8G A;  2ATO A;  4I05 A;  3S3Q A;  1NB5 A;  3BC3 A;  2FO5 A;  7PCK A;  2YJ9 A;  1PCI A;  3DF0 A;  5CVM A;  3RVW A;  2PAD A;  2FYE A; 
#chains in the Genus database with same CATH topology
 2HH5 A;  4MZO A;  4A5U A;  4ZUX U;  3V6E A;  1POP A;  3K9M A;  5A24 A;  2PRE A;  5E6J A;  3P5U A;  3RVX A;  2DOS A;  4PP2 E;  3U8E A;  2R9M A;  4I07 A;  2E03 A;  1PIP A;  1Y4H A;  3BB7 A;  4REZ A;  1MIR A;  1FH0 A;  3K8U A;  1ZIV A;  1EWO A;  1AU4 A;  4BOQ A;  2DC6 A;  5EZQ A;  4I04 A;  2DC8 A;  2E02 A;  3ZUA A;  1YK8 A;  2XU4 A;  1U5I A;  3PHU A;  4P16 A;  3MOR A;  4OVZ B;  3BOW A;  2BTW A;  1BGO A;  3P5V A;  2B1M A;  1M6D A;  1F2B A;  1K3B B;  2AU1 A;  3IUT A;  2E00 A;  2UZJ A;  4CZW A;  5JZE A;  4BPV A;  3C0R A;  3KWB X;  3E1Z B;  4QRG A;  3TMP A;  1CVZ A;  3IEJ A;  3O65 A;  4YYS A;  2YJB A;  1TL9 A;  3H8B A;  3M99 A;  5CVO B;  1ATK A;  4X6I A;  1EWM A;  4QRV A;  3CBJ A;  1KHQ A;  3OF9 A;  2F1G A;  1UKF A;  2NQD B;  2OZ2 A;  4X6J A;  4MM3 B;  2VHF A;  4R3D A;  3W31 A;  9PAP A;  2Y5B A;  3HD3 A;  3CBK A;  1Y08 A;  2DZZ A;  4N4Z A;  1GMY A;  3BPM A;  4RNA A;  2R6N A;  3N3G A;  4CDF B;  2JQF R;  1O0E A;  4XZX A;  2NQI A;  1SNK A;  4BOU A;  4FIP A;  4QH6 A;  4CDD B;  2DCB A;  3F5V A;  4BOP A;  1MHW A;  4BS6 A;  2FE8 A;  2G8J A;  1GCB A;  4D8B A;  4K7C A;  2ACT A;  2HD5 A;  3WXF A;  2R9O A;  2AVW A;  3RNV A;  1ME4 A;  2YJC A;  3TNX A;  4FK5 A;  4BOZ A;  3MP2 A;  3ZNH A;  4YYU A;  4XR7 A;  1KFX L;  3PT2 A;  3KSE A;  2NQG A;  2FRA A;  4RF0 A;  2C0Y A;  3WXG A;  4CDC B;  1JQP A;  3IFU A;  3MTN A;  4MZS A;  3IOQ A;  1ME3 A;  1A6R A;  4ZTB A;  2YJ8 A;  2PNS A;  4BQV A;  3MTV A;  4CDE B;  4AXL A;  3C9E A;  5CHV A;  3CH3 X;  3PRP A;  1NLJ A;  4RY2 A;  3KX1 A;  5K16 A;  3HWN A;  1F2A A;  4HXD B;  2CB5 A;  3H8C A;  1TLO A;  2G7Y A;  4D8E A;  1CQD A;  3MJ5 A;  1SP4 B;  1DKI A;  4N79 A;  1DEU A;  1THE A;  1YVB A;  3OVX A;  1BQI A;  1EWL A;  3OIS A;  1MEG A;  1IWD A;  1CSB B;  1MDW A;  1CB5 A;  2P86 A;  4YVA A;  3MHS A;  4PP1 A;  5EZS A;  1CS8 A;  1CTE A;  1ICF A;  1AYW A;  2OP3 A;  2DJG B;  4YYV A;  3PSE A;  5FPW A;  2H7J A;  3P5W A;  1QMY A;  3USV A;  2G8E A;  2YJ2 A;  2Z84 A;  3I3T A;  1Q6K A;  4P6G A;  4P6E A;  3P5X A;  2WBF X;  2DCD A;  2HWK A;  1BY8 A;  3KW9 A;  3OVZ A;  1S4V A;  2J7Q A;  2R9N A;  1YAL A;  2DC7 A;  3LXS A;  3KFQ A;  2BTW B;  2FRQ A;  1AU2 A;  3RVV A;  3HHA A;  4W5B A;  3PBH A;  4OW0 A;  5CHT A;  4RF1 A;  2XU5 A;  5CVN B;  3BWK A;  6PAD A;  2E01 A;  2P7U A;  3D6S A;  1QOL A;  5EGW A;  1XKG A;  3KWZ A;  1NPZ A;  3BY4 A;  2JRI A;  3GCB A;  1U9Q X;  2NQA A;  2GFO A;  2ARY A;  3LFY A;  2OUL A;  1NQC A;  1ZCM A;  1AYU A;  4QBB A;  3F75 A;  1F2C A;  2DCC A;  1MS6 A;  3N3K A;  1PAD A;  2DZY A;  2IPP B;  3W30 A;  2R9C A;  1PPD A;  2Y6E A;  4HWY A;  1PPO A;  2XU1 A;  4YYR A;  3O0U A;  5JH3 A;  4OEM A;  3ERV A;  4Q8H A;  4PI3 A;  2DJF B;  2IBI A;  3H6S A;  3PNR A;  2CIO A;  1U9W A;  5J94 A;  1KHP A;  3HHI A;  2AGA A;  4MI7 A;  4AXM A;  2AYO A;  3BCN A;  1BP4 A;  3IHP A;  5PAD A;  1PPN A;  3N4C A;  4W4U A;  3IMA A;  5EF4 A;  4FJC A;  1ITO A;  3AI8 A;  1KFU L;  4BOS A;  3OF8 A;  1PVJ A;  4D8I A;  1X9Y A;  2F7D A;  2XU3 A;  1PPP A;  1CV8 A;  4DMY A;  4M0W A;  2AUX A;  1F29 A;  4BSQ A;  1VJV A;  1PBH A;  1MEM A;  2AS8 A;  2GHU A;  4OVZ A;  4BS5 A;  3CH2 X;  2BDL A;  2AIM A;  2FUD A;  1CJL A;  1AU3 A;  3E9S A;  3KKU A;  5KO3 A;  3K24 A;  4YV8 A;  4PAD A;  1AEC A;  3QT4 A;  1YT7 A;  1YK7 A;  1AYV A;  1PE6 A;  2O6X A;  2HHN A;  1NL6 A;  1PXV A;  4MSX A;  3V6C A;  4IUM A;  3BPF A;  1U9V A;  2G6D A;  4KLB A;  4GUA A;  4OEL A;  4YYW A;  8PCH A;  2JTC A;  2P0R A;  1DF0 A;  1EWP A;  2R9F A;  1EF7 A;  1KXR A;  2BDZ A;  5F02 A;  4N8W A;  2BU3 A;  1AIM A;  4YYQ A;  2DC9 A;  1NB3 A;  2FQ9 A;  1HUC B;  1VSN A;  3S3R A;  3PHW A;  3H7D A;  4WA6 A;  4XUI A;  2B1N A;  2VHS A;  4WUR A;  1GEC E;  2J7Q C;  2AUZ A;  1QDQ A;  1GLO A;  3PRM A;  3PDF A;  4W5C A;  1QXP A;  1U9X A;  3O1G A;  5JA7 A;  3BBA A;  4QRX A;  3WXE A;  3PHX A;  1CPJ A;  1TU6 A;  3IV2 A;  3MHH A;  4RKX A;  3QJ3 A;  2HXZ A;  2AYN A;  3QSD A;  3PW3 A;  1STF E;  2PBH A;  3H89 A;  3I06 A;  3B21 A;  2JQG R;  4X6H A;  3B79 A;  3NHE A;  4IP3 A;  2DCA A;  1YZB A;  1AU0 A;  3TRK A;  2FT2 A;  4G54 A;  2FTD A;  4DMX A;  4Q8G A;  2ATO A;  4I05 A;  4PT5 A;  3S3Q A;  1NB5 A;  3BC3 A;  2FO5 A;  7PCK A;  2YJ9 A;  1PCI A;  3DF0 A;  3OQC A;  5CVM A;  3RVW A;  2PAD A;  2FYE A; 
#chains in the Genus database with same CATH homology
 2HH5 A;  4MZO A;  4ZUX U;  3V6E A;  1POP A;  3K9M A;  5A24 A;  2PRE A;  3P5U A;  3RVX A;  4PP2 E;  3U8E A;  2R9M A;  4I07 A;  2E03 A;  1PIP A;  1Y4H A;  1MIR A;  2VFB A;  1FH0 A;  3K8U A;  1ZIV A;  1EWO A;  1AU4 A;  3LTW A;  2DC6 A;  4I04 A;  2DC8 A;  2E02 A;  3ZUA A;  1YK8 A;  2XU4 A;  1U5I A;  3MOR A;  3BOW A;  1BGO A;  3P5V A;  2B1M A;  1M6D A;  1F2B A;  1K3B B;  2AU1 A;  3IUT A;  2E00 A;  4CZW A;  4BPV A;  3KWB X;  3E1Z B;  4QRG A;  1CVZ A;  3IEJ A;  4YYS A;  2YJB A;  1TL9 A;  3H8B A;  3M99 A;  5CVO B;  1W5R A;  1ATK A;  4X6I A;  1EWM A;  4QRV A;  3CBJ A;  1KHQ A;  3OF9 A;  2F1G A;  2NQD B;  2OZ2 A;  4X6J A;  2BSZ A;  2VHF A;  9PAP A;  2Y5B A;  3HD3 A;  3CBK A;  1Y08 A;  2DZZ A;  4N4Z A;  1GMY A;  3BPM A;  2R6N A;  3N3G A;  4CDF B;  2JQF R;  1O0E A;  2NQI A;  1SNK A;  4FIP A;  4QH6 A;  4CDD B;  2DCB A;  3F5V A;  1MHW A;  4BS6 A;  2G8J A;  1GCB A;  4K7C A;  2ACT A;  2HD5 A;  3WXF A;  2R9O A;  2AVW A;  1ME4 A;  2YJC A;  3TNX A;  4FK5 A;  4YYU A;  4XR7 A;  1KFX L;  3KSE A;  2NQG A;  2FRA A;  2C0Y A;  3WXG A;  4CDC B;  1JQP A;  3MTN A;  4MZS A;  3IOQ A;  1ME3 A;  1A6R A;  2YJ8 A;  2PNS A;  4BQV A;  4CDE B;  4AXL A;  3C9E A;  5CHV A;  3CH3 X;  1NLJ A;  4RY2 A;  3KX1 A;  5K16 A;  3HWN A;  1F2A A;  2CB5 A;  3H8C A;  1TLO A;  2G7Y A;  1CQD A;  1SP4 B;  4N79 A;  1DEU A;  1THE A;  1YVB A;  3OVX A;  1BQI A;  4BGF A;  1EWL A;  3OIS A;  1MEG A;  1IWD A;  1CSB B;  1MDW A;  1CB5 A;  2P86 A;  4YVA A;  4GUZ A;  3MHS A;  4PP1 A;  1CS8 A;  1CTE A;  1ICF A;  1AYW A;  2OP3 A;  2DJG B;  4YYV A;  2VFC A;  5FPW A;  2H7J A;  3P5W A;  1QMY A;  3USV A;  2G8E A;  2YJ2 A;  3I3T A;  1Q6K A;  4P6G A;  4P6E A;  3P5X A;  2WBF X;  2DCD A;  1BY8 A;  3KW9 A;  3OVZ A;  1S4V A;  2R9N A;  1YAL A;  2DC7 A;  3LXS A;  3KFQ A;  2FRQ A;  1AU2 A;  3RVV A;  3HHA A;  4W5B A;  3PBH A;  5CHT A;  2XU5 A;  5CVN B;  3BWK A;  6PAD A;  2E01 A;  2P7U A;  3D6S A;  1QOL A;  5EGW A;  1XKG A;  3KWZ A;  1NPZ A;  3GCB A;  1U9Q X;  4B55 A;  2NQA A;  2GFO A;  2ARY A;  3LFY A;  2OUL A;  1NQC A;  1ZCM A;  1AYU A;  4QBB A;  3F75 A;  1F2C A;  2DCC A;  1MS6 A;  3N3K A;  1PAD A;  2DZY A;  2IPP B;  2R9C A;  1PPD A;  2Y6E A;  4HWY A;  4C5P A;  1PPO A;  2XU1 A;  4YYR A;  3O0U A;  5JH3 A;  4OEM A;  3ERV A;  4Q8H A;  4PI3 A;  2DJF B;  2IBI A;  1W6F A;  3H6S A;  3PNR A;  2CIO A;  1U9W A;  5J94 A;  1KHP A;  3HHI A;  4AXM A;  2AYO A;  3BCN A;  1BP4 A;  3IHP A;  5PAD A;  1PPN A;  3N4C A;  4W4U A;  3IMA A;  5EF4 A;  4FJC A;  1ITO A;  3AI8 A;  1KFU L;  3OF8 A;  1X9Y A;  2F7D A;  2XU3 A;  1PPP A;  1CV8 A;  4DMY A;  2AUX A;  1F29 A;  4BSQ A;  1VJV A;  1PBH A;  1MEM A;  2AS8 A;  2GHU A;  4BS5 A;  3CH2 X;  2BDL A;  2AIM A;  2FUD A;  1CJL A;  1AU3 A;  4NV8 A;  3KKU A;  3K24 A;  4YV8 A;  4PAD A;  1AEC A;  3QT4 A;  1YT7 A;  1YK7 A;  1AYV A;  1PE6 A;  1W4T A;  2HHN A;  2O6X A;  1NL6 A;  1PXV A;  4MSX A;  3V6C A;  3BPF A;  1U9V A;  2G6D A;  4KLB A;  4NV7 A;  4OEL A;  4YYW A;  8PCH A;  1E2T A;  2P0R A;  1DF0 A;  1EWP A;  2R9F A;  1EF7 A;  1KXR A;  2BDZ A;  5F02 A;  4N8W A;  1AIM A;  4YYQ A;  2DC9 A;  1NB3 A;  2FQ9 A;  1HUC B;  1VSN A;  3D9W A;  3S3R A;  3H7D A;  4WA6 A;  4XUI A;  2B1N A;  2VHS A;  1GEC E;  2AUZ A;  1QDQ A;  1GLO A;  3PDF A;  4W5C A;  1QXP A;  1U9X A;  3O1G A;  5JA7 A;  4QRX A;  3WXE A;  1CPJ A;  1TU6 A;  3IV2 A;  3MHH A;  3QJ3 A;  2HXZ A;  2AYN A;  3QSD A;  3PW3 A;  1GX3 A;  1STF E;  2PBH A;  3H89 A;  3I06 A;  2JQG R;  4X6H A;  3B79 A;  3NHE A;  2DCA A;  1AU0 A;  2FT2 A;  4G54 A;  2FTD A;  4DMX A;  4Q8G A;  2ATO A;  4I05 A;  3S3Q A;  1NB5 A;  3BC3 A;  2FO5 A;  7PCK A;  2YJ9 A;  1PCI A;  3DF0 A;  5CVM A;  3RVW A;  2PAD A;  2FYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...