3HHIA

Crystal structure of cathepsin b from t. brucei in complex with ca074
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
SILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACGSCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVSDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCDYTCDDPTIPVVNYRSWTSYALQGEDDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKIANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of TbCatB and rhodesain, potential chemotherapeutic targets and major cysteine proteases of Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
molecule keywords Cathepsin B-like cysteine protease
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hhiA00
1ITOA 3S3QA 1U9XA 1ZIVA 4W4UA 1NPZA 3V6CA 2DC7A 3C9EA 1ZCMA 1QXPA 2P86A 1FH0A 1JQPA 3KSEA 3N3KA 2AS8A 1HUCB 2NQAA 3O1GA 4OELA 2ARYA 1K3BB 1MHWA 2DCCA 2Y5BA 3ERVA 3KKUA 1O0EA 3BWKA 2AYNA 3F75A 3QSDA 4X6HA 4MZSA 1EWLA 4CDEB 4I04A 1XKGA 2F1GA 3MHSA 4Q8GA 4YV8A 2AVWA 1AU0A 2DCDA 4YYSA 1A6RA 2XU1A 3GCBA 2OULA 3P5WA 2BDZA 1MS6A 2E02A 4DMYA 2E03A 1AECA 1PIPA 4X6IA 1SP4B 2WBFX 3HWNA 1F2AA 2DZZA 2YJ2A 3PW3A 1CS8A 3BOWA 1YT7A 1CB5A 2DJFB 2G8EA 2DC6A 3P5VA 3D6SA 1AYWA 4OEMA 3CBKA 2AYOA 2YJ8A 2H7JA 3E1ZB 4X6JA 4W5BA 3S3RA 2R6NA 3KWBX 3M99A 4FK5A 3PBHA 2NQIA 1MEGA 4BPVA 1U9WA 5CVNB 3BPMA 2DCAA 1KFUL 3CH2X 1STFE 2IPPB 2BDLA 3H89A 2R9NA 2R9OA 2R9MA 1YK7A 4BS6A 1EWOA 1CV8A 1U9QX 1ME3A 4I05A 5J94A 2G7YA 2NQDB 4CDDB 2XU5A 2AU1A 5EGWA 3QT4A 4P6EA 3CBJA 1BGOA 3HHAA 3I3TA 3IHPA 1ICFA 2XU3A 4HWYA 4YYQA 8PCHA 2AUXA 4BS5A 1NL6A 3MHHA 1NB5A 1X9YA 1AU2A 3MTNA 1GMYA 1KHQA 4CZWA 7PCKA 1IWDA 2OP3A 1U9VA 4G54A 4DMXA 3RVXA 4XR7A 1SNKA 4YYUA 3WXEA 4QRVA 3B79A 4K7CA 2FTDA 2HHNA 1PPNA 2JQFR 3K9MA 4YVAA 1U5IA 1VJVA 3TNXA 1BP4A 2C0YA 1PXVA 2G6DA 3HHIA 4W5CA 2NQGA 1Y08A 2FQ9A 3ZUAA 1Y4HA 3IOQA 2R9FA 4YYVA 2PBHA 2F7DA 5F02A 3RVVA 1PPPA 2FYEA 3BCNA 2DJGB 2DZYA 5CVOB 3IMAA 9PAPA 3HD3A 2YJBA 1DF0A 2XU4A 2FUDA 4Q8HA 3P5UA 4MZOA 3KX1A 4N8WA 4PADA 3AI8A 2HH5A 4KLBA 4QRGA 5JH3A 4BSQA 3OF8A 2HD5A 3OVZA 2B1NA 2R9CA 4QBBA 1EWMA 3IEJA 4PI3A 3V6EA 4BQVA 2E00A 1CQDA 2P7UA 1NQCA 3IUTA 3LXSA 3U8EA 1KXRA 3N3GA 1AYUA 3BC3A 1TL9A 2P0RA 1KHPA 1F2CA 1PCIA 4MSXA 3H7DA 4I07A 1CPJA 5CVMA 3H8CA 1ATKA 3MORA 3DF0A 5K16A 2Y6EA 5PADA 1AYVA 1QOLA 1MDWA 2GHUA 4QRXA 4AXLA 1VSNA 2ATOA 4QH6A 1YVBA 4YYWA 3LFYA 1PPOA 3P5XA 2CB5A 1AIMA 2FT2A 1MEMA 1CJLA 1POPA 2JQGR 1NB3A 3PDFA 1CTEA 3PNRA 2B1MA 2DC9A 1CSBB 3WXGA 1BY8A 1KFXL 3NHEA 2HXZA 4AXMA 1PADA 2E01A 5CHVA 2FRAA 2AIMA 3H6SA 1BQIA 4N4ZA 3H8BA 3KFQA 2O6XA 4ZUXU 2PADA 3K8UA 3F5VA 2YJCA 2FO5A 3KW9A 4PP1A 4P6GA 2VHSA 4RY2A 5EF4A 3OISA 1F2BA 2DC8A 4XUIA 4WA6A 1TLOA 1S4VA 2AUZA 5A24A 2PREA 1QMYA 2ACTA 3N4CA 3CH3X 1NLJA 1F29A 3RVWA 1CVZA 1GECE 3I06A 2PNSA 1THEA 1M6DA 4CDFB 1MIRA 1QDQA 5CHTA 1GLOA 1TU6A 4CDCB 4FIPA 3K24A 1AU4A 3USVA 4YYRA 2YJ9A 4FJCA 4N79A 1EWPA 1YK8A 1GCBA 2G8JA 2VHFA 1YALA 3OVXA 5JA7A 3BPFA 1EF7A 1PPDA 2IBIA 1DEUA 2FRQA 2GFOA 3QJ3A 3KWZA 3WXFA 6PADA 4PP2E 1PBHA 2DCBA 3O0UA 3OF9A 1Q6KA 1PE6A 2OZ2A 1ME4A 3IV2A 2CIOA 5FPWA 1AU3A
chains in the Genus database with same CATH superfamily
3PSEA 1ITOA 3S3QA 1U9XA 1ZIVA 2J7QA 3PHXA 4W4UA 1NPZA 3V6CA 2DC7A 3C9EA 1ZCMA 1QXPA 4ZTBA 2P86A 1FH0A 1JQPA 3KSEA 3N3KA 2AS8A 1HUCB 2NQAA 3O1GA 3PHWA 4OELA 2ARYA 1K3BB 1MHWA 2DCCA 2Y5BA 3ERVA 3KKUA 1PVJA 1O0EA 3BWKA 2AYNA 3F75A 3QSDA 4RF0A 4XZXA 4X6HA 4MZSA 1EWLA 4CDEB 4I04A 1XKGA 3OQCA 2F1GA 3MHSA 4Q8GA 4YV8A 2AVWA 1AU0A 2DCDA 4YYSA 1A6RA 4BOSA 2XU1A 3GCBA 2OULA 3P5WA 2BDZA 1MS6A 4OW0A 5E6JA 2E02A 4DMYA 2E03A 1AECA 1PIPA 4X6IA 2AGAA 1SP4B 4P16A 2WBFX 3HWNA 4M0WA 5EZSA 1F2AA 2DZZA 2YJ2A 3PW3A 4RF1A 1CS8A 2UZJA 3BOWA 1YT7A 1CB5A 4BOUA 2DJFB 2G8EA 2DC6A 3P5VA 3D6SA 1AYWA 4OEMA 2J7QC 3CBKA 2AYOA 2YJ8A 2H7JA 4OVZA 3E1ZB 4X6JA 4W5BA 3S3RA 2R6NA 3KWBX 3M99A 4FK5A 3PBHA 2NQIA 1MEGA 4BPVA 1U9WA 4RKXA 5CVNB 3BPMA 2DCAA 2BU3A 1KFUL 3CH2X 1STFE 1UKFA 2IPPB 2BDLA 3H89A 3PT2A 4MM3B 2R9NA 2R9OA 2R9MA 1YK7A 4A5UA 4BS6A 1EWOA 1CV8A 1U9QX 1ME3A 4BOPA 4I05A 5J94A 3ZNHA 2G7YA 2NQDB 4CDDB 2XU5A 2AU1A 5EGWA 4OVZB 3QT4A 4P6EA 3CBJA 1BGOA 3HHAA 3I3TA 3IHPA 3BBAA 1ICFA 2XU3A 4HWYA 4YYQA 3BB7A 8PCHA 2AUXA 3E9SA 4BS5A 1NL6A 3MHHA 1NB5A 1X9YA 1AU2A 3MTNA 1GMYA 1KHQA 4CZWA 7PCKA 1IWDA 2OP3A 1U9VA 4G54A 4DMXA 2BTWA 3RVXA 4XR7A 1SNKA 4YYUA 4QRVA 3WXEA 3B79A 4K7CA 2FTDA 2HHNA 3B21A 1PPNA 2JQFR 3K9MA 4YVAA 1U5IA 1VJVA 3TNXA 4WURA 1BP4A 2C0YA 1PXVA 2G6DA 4HXDB 3HHIA 3MJ5A 4W5CA 2NQGA 1Y08A 2FQ9A 3ZUAA 1Y4HA 3IOQA 2R9FA 4YYVA 1YZBA 2PBHA 2F7DA 5F02A 3MTVA 3RVVA 1PPPA 2FYEA 4RNAA 3BCNA 2DJGB 2DZYA 5CVOB 3IMAA 4D8BA 9PAPA 3HD3A 2YJBA 1DF0A 2XU4A 2FUDA 4Q8HA 3P5UA 4MZOA 3KX1A 4N8WA 4PADA 3AI8A 2FE8A 2HH5A 4KLBA 4QRGA 5JH3A 4BSQA 3OF8A 2HD5A 3OVZA 2B1NA 2R9CA 4QBBA 1EWMA 4BOZA 3MP2A 3IEJA 4PI3A 3V6EA 4BQVA 2E00A 1CQDA 3PRPA 2P7UA 1NQCA 3IUTA 3LXSA 3U8EA 1KXRA 3N3GA 1AYUA 3O65A 1DKIA 3BC3A 1TL9A 2P0RA 1KHPA 1F2CA 1PCIA 4MSXA 3H7DA 4I07A 1CPJA 5CVMA 3H8CA 3PRMA 1ATKA 3MORA 4GUAA 3DF0A 5K16A 2Y6EA 5PADA 1AYVA 1QOLA 1MDWA 2GHUA 4QRXA 4PT5A 4AXLA 1VSNA 2ATOA 4QH6A 1YVBA 4YYWA 3LFYA 1PPOA 3P5XA 2CB5A 1AIMA 2FT2A 1MEMA 1CJLA 1POPA 2JQGR 1NB3A 3PDFA 1CTEA 3PNRA 2B1MA 2DC9A 1CSBB 3WXGA 4D8IA 1BY8A 1KFXL 3NHEA 2JRIA 2HXZA 4AXMA 1PADA 2E01A 5CHVA 2FRAA 3PHUA 2AIMA 3H6SA 1BQIA 4N4ZA 3H8BA 3RNVA 3KFQA 2O6XA 4ZUXU 2PADA 3K8UA 3F5VA 2YJCA 2BTWB 2FO5A 3KW9A 4PP1A 3W31A 4P6GA 2VHSA 2Z84A 4RY2A 5EF4A 4BOQA 5EZQA 3OISA 1F2BA 2DC8A 4XUIA 4WA6A 1TLOA 3BY4A 1S4VA 2AUZA 5A24A 2PREA 1QMYA 2ACTA 3N4CA 4IUMA 3CH3X 1NLJA 2JTCA 1F29A 3RVWA 1CVZA 1GECE 4R3DA 3I06A 2PNSA 2DOSA 1THEA 1M6DA 4CDFB 1MIRA 5JZEA 1QDQA 5CHTA 3W30A 3TMPA 1GLOA 1TU6A 4CDCB 4FIPA 3K24A 1AU4A 4MI7A 5KO3A 3USVA 4YYRA 2YJ9A 4FJCA 4N79A 1EWPA 2HWKA 1YK8A 1GCBA 2G8JA 2VHFA 1YALA 3OVXA 5JA7A 3BPFA 1EF7A 1PPDA 2IBIA 1DEUA 2FRQA 2GFOA 4IP3A 3QJ3A 4D8EA 3KWZA 3WXFA 6PADA 4PP2E 3C0RA 1PBHA 2DCBA 3IFUA 3O0UA 4REZA 3OF9A 1Q6KA 1PE6A 3TRKA 2OZ2A 1ME4A 3IV2A 2CIOA 5FPWA 1AU3A
chains in the Genus database with same CATH topology
1ITOA 3S3QA 1U9XA 1ZIVA 4W4UA 1NPZA 3V6CA 2DC7A 3C9EA 1ZCMA 1QXPA 2P86A 1FH0A 1JQPA 3KSEA 3N3KA 2AS8A 1HUCB 2NQAA 3O1GA 4OELA 2ARYA 1K3BB 1MHWA 2DCCA 2Y5BA 3ERVA 3KKUA 1O0EA 3BWKA 2AYNA 3F75A 3QSDA 4X6HA 4MZSA 1EWLA 4CDEB 4I04A 1XKGA 2F1GA 3MHSA 4Q8GA 4YV8A 2AVWA 1AU0A 2DCDA 4YYSA 1A6RA 2XU1A 3GCBA 2OULA 3P5WA 2BDZA 1MS6A 2E02A 4DMYA 2E03A 1AECA 1PIPA 4X6IA 1SP4B 2WBFX 3HWNA 1F2AA 2DZZA 2YJ2A 3PW3A 1CS8A 3BOWA 1YT7A 1CB5A 3LTWA 2DJFB 2G8EA 2DC6A 3P5VA 3D6SA 1AYWA 4OEMA 3CBKA 2AYOA 2YJ8A 2H7JA 4BGFA 4C5PA 3E1ZB 4X6JA 4W5BA 3S3RA 2R6NA 3KWBX 3M99A 4FK5A 3PBHA 1W6FA 2NQIA 1MEGA 4BPVA 1U9WA 5CVNB 3BPMA 2DCAA 1KFUL 3CH2X 1STFE 2IPPB 2BDLA 3H89A 2R9NA 2R9OA 2R9MA 1YK7A 4BS6A 1EWOA 1CV8A 1U9QX 1ME3A 4I05A 5J94A 2G7YA 2NQDB 4CDDB 2XU5A 2AU1A 5EGWA 3QT4A 4P6EA 3CBJA 1BGOA 3HHAA 3I3TA 3IHPA 1ICFA 2XU3A 1GX3A 4HWYA 4YYQA 8PCHA 2AUXA 4BS5A 1NL6A 3MHHA 1NB5A 1X9YA 1AU2A 3MTNA 1GMYA 1KHQA 4CZWA 7PCKA 1IWDA 2OP3A 1U9VA 4G54A 4DMXA 4NV7A 3RVXA 4XR7A 1SNKA 4YYUA 4QRVA 3WXEA 3B79A 4K7CA 2FTDA 2HHNA 1PPNA 2JQFR 3K9MA 4YVAA 1U5IA 1VJVA 3TNXA 1BP4A 2C0YA 1PXVA 2VFCA 2G6DA 3D9WA 3HHIA 4W5CA 2NQGA 1Y08A 2FQ9A 3ZUAA 1Y4HA 3IOQA 2R9FA 4YYVA 2PBHA 2F7DA 5F02A 3RVVA 1PPPA 2FYEA 3BCNA 2DJGB 2DZYA 5CVOB 3IMAA 9PAPA 3HD3A 2YJBA 1DF0A 2XU4A 2FUDA 4Q8HA 3P5UA 4MZOA 3KX1A 4N8WA 4PADA 3AI8A 2HH5A 4KLBA 4QRGA 5JH3A 4BSQA 3OF8A 2HD5A 3OVZA 2B1NA 2R9CA 4QBBA 1EWMA 3IEJA 4PI3A 3V6EA 2BSZA 4BQVA 2E00A 1CQDA 2P7UA 1NQCA 3IUTA 3LXSA 3U8EA 1KXRA 3N3GA 1AYUA 3BC3A 1TL9A 2P0RA 1KHPA 1F2CA 1PCIA 4MSXA 3H7DA 4I07A 1CPJA 5CVMA 3H8CA 1ATKA 3MORA 3DF0A 5K16A 2Y6EA 5PADA 1AYVA 1QOLA 1MDWA 2GHUA 4QRXA 4AXLA 1VSNA 2ATOA 4QH6A 1YVBA 4YYWA 3LFYA 1PPOA 3P5XA 2CB5A 1AIMA 2FT2A 1MEMA 1CJLA 1POPA 2JQGR 1NB3A 3PDFA 1CTEA 3PNRA 1W5RA 2B1MA 2DC9A 1CSBB 3WXGA 1BY8A 1KFXL 3NHEA 2HXZA 4GUZA 1PADA 2E01A 4AXMA 5CHVA 2FRAA 2AIMA 3H6SA 1BQIA 4N4ZA 3H8BA 4NV8A 3KFQA 2O6XA 4ZUXU 2PADA 3K8UA 1W4TA 3F5VA 2YJCA 2FO5A 3KW9A 4PP1A 4P6GA 2VHSA 4RY2A 5EF4A 3OISA 1F2BA 2DC8A 4XUIA 4WA6A 1TLOA 1S4VA 2AUZA 5A24A 2PREA 1QMYA 2ACTA 3N4CA 1E2TA 3CH3X 1NLJA 1F29A 3RVWA 1CVZA 1GECE 3I06A 2PNSA 1THEA 1M6DA 4CDFB 1MIRA 1QDQA 5CHTA 1GLOA 1TU6A 4CDCB 4FIPA 3K24A 1AU4A 3USVA 4YYRA 2YJ9A 4FJCA 4N79A 1EWPA 1YK8A 1GCBA 2G8JA 4B55A 2VHFA 1YALA 3OVXA 5JA7A 3BPFA 1EF7A 1PPDA 2IBIA 1DEUA 2FRQA 2GFOA 3QJ3A 3KWZA 3WXFA 6PADA 4PP2E 2VFBA 1PBHA 2DCBA 3O0UA 3OF9A 1Q6KA 1PE6A 2OZ2A 1ME4A 3IV2A 2CIOA 5FPWA 1AU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITO A;  3S3Q A;  1U9X A;  1ZIV A;  4W4U A;  1NPZ A;  3V6C A;  2DC7 A;  3C9E A;  1ZCM A;  1QXP A;  2P86 A;  1FH0 A;  1JQP A;  3KSE A;  3N3K A;  2AS8 A;  1HUC B;  2NQA A;  3O1G A;  4OEL A;  2ARY A;  1K3B B;  1MHW A;  2DCC A;  2Y5B A;  3ERV A;  3KKU A;  1O0E A;  3BWK A;  2AYN A;  3F75 A;  3QSD A;  4X6H A;  4MZS A;  1EWL A;  4CDE B;  4I04 A;  1XKG A;  2F1G A;  3MHS A;  4Q8G A;  4YV8 A;  2AVW A;  1AU0 A;  2DCD A;  4YYS A;  1A6R A;  2XU1 A;  3GCB A;  2OUL A;  3P5W A;  2BDZ A;  1MS6 A;  2E02 A;  4DMY A;  2E03 A;  1AEC A;  1PIP A;  4X6I A;  1SP4 B;  2WBF X;  3HWN A;  1F2A A;  2DZZ A;  2YJ2 A;  3PW3 A;  1CS8 A;  3BOW A;  1YT7 A;  1CB5 A;  2DJF B;  2G8E A;  2DC6 A;  3P5V A;  3D6S A;  1AYW A;  4OEM A;  3CBK A;  2AYO A;  2YJ8 A;  2H7J A;  3E1Z B;  4X6J A;  4W5B A;  3S3R A;  2R6N A;  3KWB X;  3M99 A;  4FK5 A;  3PBH A;  2NQI A;  1MEG A;  4BPV A;  1U9W A;  5CVN B;  3BPM A;  2DCA A;  1KFU L;  3CH2 X;  1STF E;  2IPP B;  2BDL A;  3H89 A;  2R9N A;  2R9O A;  2R9M A;  1YK7 A;  4BS6 A;  1EWO A;  1CV8 A;  1U9Q X;  1ME3 A;  4I05 A;  5J94 A;  2G7Y A;  2NQD B;  4CDD B;  2XU5 A;  2AU1 A;  5EGW A;  3QT4 A;  4P6E A;  3CBJ A;  1BGO A;  3HHA A;  3I3T A;  3IHP A;  1ICF A;  2XU3 A;  4HWY A;  4YYQ A;  8PCH A;  2AUX A;  4BS5 A;  1NL6 A;  3MHH A;  1NB5 A;  1X9Y A;  1AU2 A;  3MTN A;  1GMY A;  1KHQ A;  4CZW A;  7PCK A;  1IWD A;  2OP3 A;  1U9V A;  4G54 A;  4DMX A;  3RVX A;  4XR7 A;  1SNK A;  4YYU A;  3WXE A;  4QRV A;  3B79 A;  4K7C A;  2FTD A;  2HHN A;  1PPN A;  2JQF R;  3K9M A;  4YVA A;  1U5I A;  1VJV A;  3TNX A;  1BP4 A;  2C0Y A;  1PXV A;  2G6D A;  3HHI A;  4W5C A;  2NQG A;  1Y08 A;  2FQ9 A;  3ZUA A;  1Y4H A;  3IOQ A;  2R9F A;  4YYV A;  2PBH A;  2F7D A;  5F02 A;  3RVV A;  1PPP A;  2FYE A;  3BCN A;  2DJG B;  2DZY A;  5CVO B;  3IMA A;  9PAP A;  3HD3 A;  2YJB A;  1DF0 A;  2XU4 A;  2FUD A;  4Q8H A;  3P5U A;  4MZO A;  3KX1 A;  4N8W A;  4PAD A;  3AI8 A;  2HH5 A;  4KLB A;  4QRG A;  5JH3 A;  4BSQ A;  3OF8 A;  2HD5 A;  3OVZ A;  2B1N A;  2R9C A;  4QBB A;  1EWM A;  3IEJ A;  4PI3 A;  3V6E A;  4BQV A;  2E00 A;  1CQD A;  2P7U A;  1NQC A;  3IUT A;  3LXS A;  3U8E A;  1KXR A;  3N3G A;  1AYU A;  3BC3 A;  1TL9 A;  2P0R A;  1KHP A;  1F2C A;  1PCI A;  4MSX A;  3H7D A;  4I07 A;  1CPJ A;  5CVM A;  3H8C A;  1ATK A;  3MOR A;  3DF0 A;  5K16 A;  2Y6E A;  5PAD A;  1AYV A;  1QOL A;  1MDW A;  2GHU A;  4QRX A;  4AXL A;  1VSN A;  2ATO A;  4QH6 A;  1YVB A;  4YYW A;  3LFY A;  1PPO A;  3P5X A;  2CB5 A;  1AIM A;  2FT2 A;  1MEM A;  1CJL A;  1POP A;  2JQG R;  1NB3 A;  3PDF A;  1CTE A;  3PNR A;  2B1M A;  2DC9 A;  1CSB B;  3WXG A;  1BY8 A;  1KFX L;  3NHE A;  2HXZ A;  4AXM A;  1PAD A;  2E01 A;  5CHV A;  2FRA A;  2AIM A;  3H6S A;  1BQI A;  4N4Z A;  3H8B A;  3KFQ A;  2O6X A;  4ZUX U;  2PAD A;  3K8U A;  3F5V A;  2YJC A;  2FO5 A;  3KW9 A;  4PP1 A;  4P6G A;  2VHS A;  4RY2 A;  5EF4 A;  3OIS A;  1F2B A;  2DC8 A;  4XUI A;  4WA6 A;  1TLO A;  1S4V A;  2AUZ A;  5A24 A;  2PRE A;  1QMY A;  2ACT A;  3N4C A;  3CH3 X;  1NLJ A;  1F29 A;  3RVW A;  1CVZ A;  1GEC E;  3I06 A;  2PNS A;  1THE A;  1M6D A;  4CDF B;  1MIR A;  1QDQ A;  5CHT A;  1GLO A;  1TU6 A;  4CDC B;  4FIP A;  3K24 A;  1AU4 A;  3USV A;  4YYR A;  2YJ9 A;  4FJC A;  4N79 A;  1EWP A;  1YK8 A;  1GCB A;  2G8J A;  2VHF A;  1YAL A;  3OVX A;  5JA7 A;  3BPF A;  1EF7 A;  1PPD A;  2IBI A;  1DEU A;  2FRQ A;  2GFO A;  3QJ3 A;  3KWZ A;  3WXF A;  6PAD A;  4PP2 E;  1PBH A;  2DCB A;  3O0U A;  3OF9 A;  1Q6K A;  1PE6 A;  2OZ2 A;  1ME4 A;  3IV2 A;  2CIO A;  5FPW A;  1AU3 A; 
#chains in the Genus database with same CATH topology
 3PSE A;  1ITO A;  3S3Q A;  1U9X A;  1ZIV A;  2J7Q A;  3PHX A;  4W4U A;  1NPZ A;  3V6C A;  2DC7 A;  3C9E A;  1ZCM A;  1QXP A;  4ZTB A;  2P86 A;  1FH0 A;  1JQP A;  3KSE A;  3N3K A;  2AS8 A;  1HUC B;  2NQA A;  3O1G A;  3PHW A;  4OEL A;  2ARY A;  1K3B B;  1MHW A;  2DCC A;  2Y5B A;  3ERV A;  3KKU A;  1PVJ A;  1O0E A;  3BWK A;  2AYN A;  3F75 A;  3QSD A;  4RF0 A;  4XZX A;  4X6H A;  4MZS A;  1EWL A;  4CDE B;  4I04 A;  1XKG A;  3OQC A;  2F1G A;  3MHS A;  4Q8G A;  4YV8 A;  2AVW A;  1AU0 A;  2DCD A;  4YYS A;  1A6R A;  4BOS A;  2XU1 A;  3GCB A;  2OUL A;  3P5W A;  2BDZ A;  1MS6 A;  4OW0 A;  5E6J A;  2E02 A;  4DMY A;  2E03 A;  1AEC A;  1PIP A;  4X6I A;  2AGA A;  1SP4 B;  4P16 A;  2WBF X;  3HWN A;  4M0W A;  5EZS A;  1F2A A;  2DZZ A;  2YJ2 A;  3PW3 A;  4RF1 A;  1CS8 A;  2UZJ A;  3BOW A;  1YT7 A;  1CB5 A;  4BOU A;  2DJF B;  2G8E A;  2DC6 A;  3P5V A;  3D6S A;  1AYW A;  4OEM A;  2J7Q C;  3CBK A;  2AYO A;  2YJ8 A;  2H7J A;  4OVZ A;  3E1Z B;  4X6J A;  4W5B A;  3S3R A;  2R6N A;  3KWB X;  3M99 A;  4FK5 A;  3PBH A;  2NQI A;  1MEG A;  4BPV A;  1U9W A;  4RKX A;  5CVN B;  3BPM A;  2DCA A;  2BU3 A;  1KFU L;  3CH2 X;  1STF E;  1UKF A;  2IPP B;  2BDL A;  3H89 A;  3PT2 A;  4MM3 B;  2R9N A;  2R9O A;  2R9M A;  1YK7 A;  4A5U A;  4BS6 A;  1EWO A;  1CV8 A;  1U9Q X;  1ME3 A;  4BOP A;  4I05 A;  5J94 A;  3ZNH A;  2G7Y A;  2NQD B;  4CDD B;  2XU5 A;  2AU1 A;  5EGW A;  4OVZ B;  3QT4 A;  4P6E A;  3CBJ A;  1BGO A;  3HHA A;  3I3T A;  3IHP A;  3BBA A;  1ICF A;  2XU3 A;  4HWY A;  4YYQ A;  3BB7 A;  8PCH A;  2AUX A;  3E9S A;  4BS5 A;  1NL6 A;  3MHH A;  1NB5 A;  1X9Y A;  1AU2 A;  3MTN A;  1GMY A;  1KHQ A;  4CZW A;  7PCK A;  1IWD A;  2OP3 A;  1U9V A;  4G54 A;  4DMX A;  2BTW A;  3RVX A;  4XR7 A;  1SNK A;  4YYU A;  4QRV A;  3WXE A;  3B79 A;  4K7C A;  2FTD A;  2HHN A;  3B21 A;  1PPN A;  2JQF R;  3K9M A;  4YVA A;  1U5I A;  1VJV A;  3TNX A;  4WUR A;  1BP4 A;  2C0Y A;  1PXV A;  2G6D A;  4HXD B;  3HHI A;  3MJ5 A;  4W5C A;  2NQG A;  1Y08 A;  2FQ9 A;  3ZUA A;  1Y4H A;  3IOQ A;  2R9F A;  4YYV A;  1YZB A;  2PBH A;  2F7D A;  5F02 A;  3MTV A;  3RVV A;  1PPP A;  2FYE A;  4RNA A;  3BCN A;  2DJG B;  2DZY A;  5CVO B;  3IMA A;  4D8B A;  9PAP A;  3HD3 A;  2YJB A;  1DF0 A;  2XU4 A;  2FUD A;  4Q8H A;  3P5U A;  4MZO A;  3KX1 A;  4N8W A;  4PAD A;  3AI8 A;  2FE8 A;  2HH5 A;  4KLB A;  4QRG A;  5JH3 A;  4BSQ A;  3OF8 A;  2HD5 A;  3OVZ A;  2B1N A;  2R9C A;  4QBB A;  1EWM A;  4BOZ A;  3MP2 A;  3IEJ A;  4PI3 A;  3V6E A;  4BQV A;  2E00 A;  1CQD A;  3PRP A;  2P7U A;  1NQC A;  3IUT A;  3LXS A;  3U8E A;  1KXR A;  3N3G A;  1AYU A;  3O65 A;  1DKI A;  3BC3 A;  1TL9 A;  2P0R A;  1KHP A;  1F2C A;  1PCI A;  4MSX A;  3H7D A;  4I07 A;  1CPJ A;  5CVM A;  3H8C A;  3PRM A;  1ATK A;  3MOR A;  4GUA A;  3DF0 A;  5K16 A;  2Y6E A;  5PAD A;  1AYV A;  1QOL A;  1MDW A;  2GHU A;  4QRX A;  4PT5 A;  4AXL A;  1VSN A;  2ATO A;  4QH6 A;  1YVB A;  4YYW A;  3LFY A;  1PPO A;  3P5X A;  2CB5 A;  1AIM A;  2FT2 A;  1MEM A;  1CJL A;  1POP A;  2JQG R;  1NB3 A;  3PDF A;  1CTE A;  3PNR A;  2B1M A;  2DC9 A;  1CSB B;  3WXG A;  4D8I A;  1BY8 A;  1KFX L;  3NHE A;  2JRI A;  2HXZ A;  4AXM A;  1PAD A;  2E01 A;  5CHV A;  2FRA A;  3PHU A;  2AIM A;  3H6S A;  1BQI A;  4N4Z A;  3H8B A;  3RNV A;  3KFQ A;  2O6X A;  4ZUX U;  2PAD A;  3K8U A;  3F5V A;  2YJC A;  2BTW B;  2FO5 A;  3KW9 A;  4PP1 A;  3W31 A;  4P6G A;  2VHS A;  2Z84 A;  4RY2 A;  5EF4 A;  4BOQ A;  5EZQ A;  3OIS A;  1F2B A;  2DC8 A;  4XUI A;  4WA6 A;  1TLO A;  3BY4 A;  1S4V A;  2AUZ A;  5A24 A;  2PRE A;  1QMY A;  2ACT A;  3N4C A;  4IUM A;  3CH3 X;  1NLJ A;  2JTC A;  1F29 A;  3RVW A;  1CVZ A;  1GEC E;  4R3D A;  3I06 A;  2PNS A;  2DOS A;  1THE A;  1M6D A;  4CDF B;  1MIR A;  5JZE A;  1QDQ A;  5CHT A;  3W30 A;  3TMP A;  1GLO A;  1TU6 A;  4CDC B;  4FIP A;  3K24 A;  1AU4 A;  4MI7 A;  5KO3 A;  3USV A;  4YYR A;  2YJ9 A;  4FJC A;  4N79 A;  1EWP A;  2HWK A;  1YK8 A;  1GCB A;  2G8J A;  2VHF A;  1YAL A;  3OVX A;  5JA7 A;  3BPF A;  1EF7 A;  1PPD A;  2IBI A;  1DEU A;  2FRQ A;  2GFO A;  4IP3 A;  3QJ3 A;  4D8E A;  3KWZ A;  3WXF A;  6PAD A;  4PP2 E;  3C0R A;  1PBH A;  2DCB A;  3IFU A;  3O0U A;  4REZ A;  3OF9 A;  1Q6K A;  1PE6 A;  3TRK A;  2OZ2 A;  1ME4 A;  3IV2 A;  2CIO A;  5FPW A;  1AU3 A; 
#chains in the Genus database with same CATH homology
 1ITO A;  3S3Q A;  1U9X A;  1ZIV A;  4W4U A;  1NPZ A;  3V6C A;  2DC7 A;  3C9E A;  1ZCM A;  1QXP A;  2P86 A;  1FH0 A;  1JQP A;  3KSE A;  3N3K A;  2AS8 A;  1HUC B;  2NQA A;  3O1G A;  4OEL A;  2ARY A;  1K3B B;  1MHW A;  2DCC A;  2Y5B A;  3ERV A;  3KKU A;  1O0E A;  3BWK A;  2AYN A;  3F75 A;  3QSD A;  4X6H A;  4MZS A;  1EWL A;  4CDE B;  4I04 A;  1XKG A;  2F1G A;  3MHS A;  4Q8G A;  4YV8 A;  2AVW A;  1AU0 A;  2DCD A;  4YYS A;  1A6R A;  2XU1 A;  3GCB A;  2OUL A;  3P5W A;  2BDZ A;  1MS6 A;  2E02 A;  4DMY A;  2E03 A;  1AEC A;  1PIP A;  4X6I A;  1SP4 B;  2WBF X;  3HWN A;  1F2A A;  2DZZ A;  2YJ2 A;  3PW3 A;  1CS8 A;  3BOW A;  1YT7 A;  1CB5 A;  3LTW A;  2DJF B;  2G8E A;  2DC6 A;  3P5V A;  3D6S A;  1AYW A;  4OEM A;  3CBK A;  2AYO A;  2YJ8 A;  2H7J A;  4BGF A;  4C5P A;  3E1Z B;  4X6J A;  4W5B A;  3S3R A;  2R6N A;  3KWB X;  3M99 A;  4FK5 A;  3PBH A;  1W6F A;  2NQI A;  1MEG A;  4BPV A;  1U9W A;  5CVN B;  3BPM A;  2DCA A;  1KFU L;  3CH2 X;  1STF E;  2IPP B;  2BDL A;  3H89 A;  2R9N A;  2R9O A;  2R9M A;  1YK7 A;  4BS6 A;  1EWO A;  1CV8 A;  1U9Q X;  1ME3 A;  4I05 A;  5J94 A;  2G7Y A;  2NQD B;  4CDD B;  2XU5 A;  2AU1 A;  5EGW A;  3QT4 A;  4P6E A;  3CBJ A;  1BGO A;  3HHA A;  3I3T A;  3IHP A;  1ICF A;  2XU3 A;  1GX3 A;  4HWY A;  4YYQ A;  8PCH A;  2AUX A;  4BS5 A;  1NL6 A;  3MHH A;  1NB5 A;  1X9Y A;  1AU2 A;  3MTN A;  1GMY A;  1KHQ A;  4CZW A;  7PCK A;  1IWD A;  2OP3 A;  1U9V A;  4G54 A;  4DMX A;  4NV7 A;  3RVX A;  4XR7 A;  1SNK A;  4YYU A;  4QRV A;  3WXE A;  3B79 A;  4K7C A;  2FTD A;  2HHN A;  1PPN A;  2JQF R;  3K9M A;  4YVA A;  1U5I A;  1VJV A;  3TNX A;  1BP4 A;  2C0Y A;  1PXV A;  2VFC A;  2G6D A;  3D9W A;  3HHI A;  4W5C A;  2NQG A;  1Y08 A;  2FQ9 A;  3ZUA A;  1Y4H A;  3IOQ A;  2R9F A;  4YYV A;  2PBH A;  2F7D A;  5F02 A;  3RVV A;  1PPP A;  2FYE A;  3BCN A;  2DJG B;  2DZY A;  5CVO B;  3IMA A;  9PAP A;  3HD3 A;  2YJB A;  1DF0 A;  2XU4 A;  2FUD A;  4Q8H A;  3P5U A;  4MZO A;  3KX1 A;  4N8W A;  4PAD A;  3AI8 A;  2HH5 A;  4KLB A;  4QRG A;  5JH3 A;  4BSQ A;  3OF8 A;  2HD5 A;  3OVZ A;  2B1N A;  2R9C A;  4QBB A;  1EWM A;  3IEJ A;  4PI3 A;  3V6E A;  2BSZ A;  4BQV A;  2E00 A;  1CQD A;  2P7U A;  1NQC A;  3IUT A;  3LXS A;  3U8E A;  1KXR A;  3N3G A;  1AYU A;  3BC3 A;  1TL9 A;  2P0R A;  1KHP A;  1F2C A;  1PCI A;  4MSX A;  3H7D A;  4I07 A;  1CPJ A;  5CVM A;  3H8C A;  1ATK A;  3MOR A;  3DF0 A;  5K16 A;  2Y6E A;  5PAD A;  1AYV A;  1QOL A;  1MDW A;  2GHU A;  4QRX A;  4AXL A;  1VSN A;  2ATO A;  4QH6 A;  1YVB A;  4YYW A;  3LFY A;  1PPO A;  3P5X A;  2CB5 A;  1AIM A;  2FT2 A;  1MEM A;  1CJL A;  1POP A;  2JQG R;  1NB3 A;  3PDF A;  1CTE A;  3PNR A;  1W5R A;  2B1M A;  2DC9 A;  1CSB B;  3WXG A;  1BY8 A;  1KFX L;  3NHE A;  2HXZ A;  4GUZ A;  1PAD A;  2E01 A;  4AXM A;  5CHV A;  2FRA A;  2AIM A;  3H6S A;  1BQI A;  4N4Z A;  3H8B A;  4NV8 A;  3KFQ A;  2O6X A;  4ZUX U;  2PAD A;  3K8U A;  1W4T A;  3F5V A;  2YJC A;  2FO5 A;  3KW9 A;  4PP1 A;  4P6G A;  2VHS A;  4RY2 A;  5EF4 A;  3OIS A;  1F2B A;  2DC8 A;  4XUI A;  4WA6 A;  1TLO A;  1S4V A;  2AUZ A;  5A24 A;  2PRE A;  1QMY A;  2ACT A;  3N4C A;  1E2T A;  3CH3 X;  1NLJ A;  1F29 A;  3RVW A;  1CVZ A;  1GEC E;  3I06 A;  2PNS A;  1THE A;  1M6D A;  4CDF B;  1MIR A;  1QDQ A;  5CHT A;  1GLO A;  1TU6 A;  4CDC B;  4FIP A;  3K24 A;  1AU4 A;  3USV A;  4YYR A;  2YJ9 A;  4FJC A;  4N79 A;  1EWP A;  1YK8 A;  1GCB A;  2G8J A;  4B55 A;  2VHF A;  1YAL A;  3OVX A;  5JA7 A;  3BPF A;  1EF7 A;  1PPD A;  2IBI A;  1DEU A;  2FRQ A;  2GFO A;  3QJ3 A;  3KWZ A;  3WXF A;  6PAD A;  4PP2 E;  2VFB A;  1PBH A;  2DCB A;  3O0U A;  3OF9 A;  1Q6K A;  1PE6 A;  2OZ2 A;  1ME4 A;  3IV2 A;  2CIO A;  5FPW A;  1AU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...