3HHIA

Crystal structure of cathepsin b from t. brucei in complex with ca074
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
258
structure length
258
Chain Sequence
SILPKRRFTEEEARAPLPSSFDSAEAWPNCPTIPQIADQSACGSCWAVAAASAMSDRFCTMGGVQDVHISAGDLLACCSDCGDGCNGGDPDRAWAYFSSTGLVSDYCQPYPFPHCSHHSKSKNGYPPCSQFNFDTPKCDYTCDDPTIPVVNYRSWTSYALQGEDDYMRELFFRGPFEVAFDVYEDFIAYNSGVYHHVSGQYLGGHAVRLVGWGTSNGVPYWKIANSWNTEWGMDGYFLIRRGSSECGIEDGGSAGIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like cysteine protease
publication title Crystal Structures of TbCatB and rhodesain, potential chemotherapeutic targets and major cysteine proteases of Trypanosoma brucei
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
total genus 74
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3hhiA00
1PXVA 2AU1A 4MSXA 2HHNA 3E1ZB 1GMYA 2DCCA 3BCNA 2DCBA 1AU0A 3V6CA 4BS6A 1Q6KA 1AECA 1CVZA 7PCKA 3PDFA 2Y5BA 1CPJA 2WBFX 4BS5A 2YJ2A 3KWBX 2DZYA 3IOQA 3OISA 1NQCA 1YT7A 1SP4B 2G7YA 6PADA 3HHIA 3MTNA 3CH3X 2Y6EA 4N8WA 1PCIA 2XU5A 1ICFA 4DMYA 5JH3A 5K16A 1MDWA 2F7DA 3GCBA 1KHQA 1MIRA 5CVNB 3CH2X 1O0EA 1PPOA 4PADA 2H7JA 2XU3A 2O6XA 3K8UA 4N4ZA 1NPZA 1CJLA 1CV8A 4YYQA 2CB5A 4X6JA 3IV2A 1CTEA 1U9XA 2YJ8A 2R9OA 3H89A 1QOLA 2CIOA 3QJ3A 1DEUA 3O0UA 1AYUA 1U9VA 1IWDA 4YYRA 3F75A 2FRQA 4Q8HA 1GLOA 3D6SA 1QMYA 4MZOA 3LXSA 4RY2A 4KLBA 3K24A 5EF4A 2DCAA 4X6HA 4PP2E 4FJCA 4X6IA 1AU2A 2FT2A 3KWZA 1NL6A 1TLOA 4CDEB 3BOWA 3CBJA 3HHAA 1PPDA 3WXFA 2B1NA 4YYUA 2NQIA 1ZIVA 1NLJA 5A24A 3S3RA 1DF0A 2FUDA 4DMXA 1YK7A 2FYEA 2AUXA 5J94A 1MHWA 2E03A 1F2CA 2FTDA 4QRVA 3AI8A 4QH6A 2DZZA 4G54A 1CB5A 3P5XA 1MEGA 9PAPA 3OVZA 4HWYA 3PW3A 1FH0A 2R9MA 4BPVA 2BDLA 1BQIA 2YJBA 3TNXA 3P5UA 2E00A 2R9CA 4W5CA 2OZ2A 1VJVA 1NB5A 4P6GA 3QT4A 3BC3A 4I07A 4FK5A 1TL9A 5CHTA 3MHHA 1YK8A 2AS8A 1ITOA 2C0YA 2E01A 4P6EA 1K3BB 4YYVA 4PP1A 1PE6A 4I05A 4OELA 2DJGB 3BPFA 3IMAA 3OF9A 3M99A 3IUTA 1ZCMA 1EWMA 1TU6A 2GFOA 1PADA 1EWOA 3DF0A 2PBHA 2HD5A 5CHVA 2R6NA 3WXGA 3C9EA 2DC9A 3OVXA 3K9MA 3HWNA 1Y08A 2ARYA 2G8EA 1GECE 3IEJA 4YYWA 3B79A 2DC7A 4PI3A 1ATKA 1SNKA 3U8EA 4ZUXU 2R9NA 1AYWA 2DJFB 2PADA 2AVWA 3KFQA 4CDCB 2XU1A 2GHUA 5PADA 1AU4A 2ACTA 3KX1A 2OP3A 5JA7A 4FIPA 1ME3A 3ZUAA 2NQAA 1MEMA 1X9YA 1BP4A 2VHSA 1BGOA 3PNRA 4K7CA 1AIMA 1F2BA 1F2AA 3ERVA 2JQGR 2NQDB 1PIPA 3P5VA 3KSEA 4QRGA 2R9FA 1VSNA 3BPMA 4Q8GA 3RVWA 3IHPA 3N3KA 2NQGA 1EWLA 2FRAA 1PPPA 2DC8A 3MHSA 2B1MA 2AIMA 2P7UA 2F1GA 2DC6A 4XR7A 3H7DA 2AUZA 1MS6A 1BY8A 4BSQA 4XUIA 3LFYA 1U5IA 2JQFR 2AYOA 3KKUA 1ME4A 3CBKA 1GCBA 3KW9A 1KHPA 8PCHA 2IPPB 3WXEA 3F5VA 4QRXA 4I04A 4CDDB 3P5WA 1PPNA 3QSDA 5EGWA 4W4UA 2DCDA 3H8CA 3I06A 2FQ9A 2HH5A 1U9QX 4CZWA 2VHFA 1KFUL 1XKGA 4OEMA 3N3GA 2BDZA 3USVA 1CQDA 1JQPA 1YVBA 1A6RA 1NB3A 4AXMA 1Y4HA 2P0RA 1F29A 4AXLA 5FPWA 1KFXL 1CS8A 2IBIA 1AYVA 2PREA 2OULA 4WA6A 1EF7A 3V6EA 4CDFB 4YYSA 2HXZA 3MORA 1HUCB 3BWKA 4QBBA 3RVVA 3RVXA 1CSBB 2XU4A 4MZSA 5CVMA 4BQVA 2G8JA 1STFE 1AU3A 1EWPA 1THEA 1PBHA 4W5BA 3N4CA 1YALA 1M6DA 4YVAA 3O1GA 1KXRA 1QDQA 3H6SA 2ATOA 2FO5A 2PNSA 1U9WA 2E02A 2YJCA 1QXPA 2P86A 3S3QA 3PBHA 3OF8A 3I3TA 4N79A 2YJ9A 5F02A 1S4VA 1POPA 3HD3A 3H8BA 5CVOB 2AYNA 2G6DA 4YV8A 3NHEA
chains in the Genus database with same CATH superfamily
3W31A 1PXVA 2AU1A 4MSXA 2HHNA 3E1ZB 2J7QC 1GMYA 3MJ5A 2DCCA 3BCNA 2DCBA 1AU0A 3V6CA 4BS6A 1Q6KA 2JRIA 1AECA 1CVZA 7PCKA 3PDFA 2Y5BA 1CPJA 2WBFX 2HWKA 2YJ2A 3KWBX 2DZYA 3IOQA 3OISA 1NQCA 4RF0A 4BS5A 1YT7A 1SP4B 2G7YA 6PADA 3HHIA 3MTNA 3MP2A 3CH3X 2Y6EA 3C0RA 4N8WA 1PCIA 4MI7A 2XU5A 1ICFA 4DMYA 5JH3A 5K16A 1MDWA 2F7DA 3BBAA 3GCBA 1KHQA 1MIRA 5CVNB 3CH2X 1O0EA 1PPOA 4PADA 2H7JA 2XU3A 2O6XA 3K8UA 4N4ZA 1NPZA 1CJLA 1CV8A 4YYQA 2CB5A 4X6JA 3IV2A 1CTEA 1U9XA 2YJ8A 2DOSA 2R9OA 3H89A 2BTWB 1QOLA 2CIOA 3QJ3A 2JTCA 3TMPA 1DEUA 3O0UA 3BB7A 1AYUA 1U9VA 1IWDA 4YYRA 3F75A 2FRQA 4Q8HA 1GLOA 3D6SA 1QMYA 4MZOA 3LXSA 4RY2A 4KLBA 4ZTBA 4BOZA 3K24A 3PHUA 5EF4A 2DCAA 4X6HA 4PP2E 4FJCA 4X6IA 1AU2A 2FT2A 3KWZA 1NL6A 1TLOA 4BOUA 4CDEB 3BOWA 3CBJA 3HHAA 1PPDA 3WXFA 2B1NA 4YYUA 2NQIA 1ZIVA 2Z84A 1NLJA 4IUMA 5A24A 3S3RA 4D8BA 1DF0A 2FUDA 4DMXA 1YK7A 4IP3A 4RF1A 2FYEA 2AUXA 5J94A 4BOPA 1MHWA 2E03A 3IFUA 1F2CA 2FTDA 2BU3A 4QRVA 5KO3A 3AI8A 4QH6A 2DZZA 4G54A 1CB5A 3P5XA 1MEGA 9PAPA 3OVZA 4HWYA 3PW3A 1FH0A 2R9MA 4D8IA 4BPVA 2BDLA 1BQIA 2YJBA 4P16A 3TNXA 3P5UA 2E00A 2R9CA 4W5CA 2OZ2A 4GUAA 4OW0A 1VJVA 1NB5A 4P6GA 3QT4A 3BC3A 4I07A 4FK5A 5JZEA 1TL9A 3BY4A 5CHTA 3MHHA 1YK8A 2AS8A 1ITOA 2C0YA 2E01A 4P6EA 1K3BB 4YYVA 4PP1A 2FE8A 1PE6A 4I05A 4OELA 4MM3B 4BOSA 2DJGB 3BPFA 3IMAA 3OF9A 3M99A 3IUTA 2AGAA 1ZCMA 1EWMA 1TU6A 4BOQA 2GFOA 1PADA 1EWOA 5E6JA 3DF0A 2PBHA 2HD5A 4REZA 5CHVA 2R6NA 3WXGA 3C9EA 2DC9A 3OVXA 3K9MA 3HWNA 1Y08A 2ARYA 2G8EA 1GECE 3IEJA 4YYWA 3B79A 2DC7A 4HXDB 4PI3A 1ATKA 1SNKA 3U8EA 4ZUXU 2R9NA 1AYWA 2DJFB 2PADA 3TRKA 2AVWA 3KFQA 4XZXA 4RKXA 4CDCB 4M0WA 2XU1A 2GHUA 5PADA 1AU4A 3PHXA 2ACTA 3KX1A 2OP3A 5JA7A 4FIPA 1ME3A 3ZUAA 2NQAA 1MEMA 1X9YA 1BP4A 2VHSA 4D8EA 1BGOA 3PNRA 4K7CA 4OVZA 1AIMA 1F2BA 1F2AA 3ERVA 2JQGR 2NQDB 1PIPA 3P5VA 3KSEA 4QRGA 2R9FA 1VSNA 3BPMA 4Q8GA 3PHWA 3RVWA 1UKFA 3IHPA 3N3KA 4PT5A 2NQGA 1EWLA 2FRAA 3B21A 1PPPA 2DC8A 3MHSA 2B1MA 3ZNHA 2AIMA 2P7UA 2F1GA 2DC6A 4XR7A 3H7DA 1DKIA 4R3DA 2AUZA 1MS6A 5EZSA 1BY8A 4BSQA 4XUIA 3LFYA 4RNAA 1U5IA 2JQFR 2AYOA 3KKUA 1ME4A 3CBKA 1GCBA 3KW9A 1KHPA 8PCHA 2IPPB 3WXEA 3F5VA 4QRXA 3W30A 3MTVA 4I04A 4CDDB 3P5WA 1PPNA 3QSDA 5EGWA 4W4UA 2DCDA 3H8CA 3I06A 4WURA 2FQ9A 2HH5A 4A5UA 1U9QX 4CZWA 3PRMA 2VHFA 1KFUL 1PVJA 3RNVA 1XKGA 4OEMA 3N3GA 2BDZA 3USVA 1CQDA 1JQPA 1YVBA 1A6RA 1NB3A 4AXMA 1Y4HA 5EZQA 2P0RA 1F29A 4AXLA 5FPWA 1KFXL 1CS8A 2IBIA 1AYVA 3PT2A 2PREA 2OULA 4WA6A 1EF7A 3V6EA 4CDFB 4YYSA 2HXZA 3OQCA 3MORA 1HUCB 3BWKA 4QBBA 3RVVA 3RVXA 1CSBB 2XU4A 2BTWA 4MZSA 3PSEA 5CVMA 4BQVA 4OVZB 2G8JA 1STFE 1AU3A 1EWPA 1THEA 1PBHA 4W5BA 3N4CA 1YALA 1M6DA 2J7QA 2UZJA 4YVAA 3O1GA 1KXRA 1QDQA 3H6SA 1YZBA 2ATOA 2FO5A 2PNSA 1U9WA 2E02A 2YJCA 1QXPA 2P86A 3S3QA 3PBHA 3PRPA 3OF8A 3I3TA 3E9SA 4N79A 2YJ9A 5F02A 1S4VA 1POPA 3HD3A 3H8BA 5CVOB 3O65A 2AYNA 2G6DA 4YV8A 3NHEA
chains in the Genus database with same CATH topology
1PXVA 2AU1A 4MSXA 2HHNA 3E1ZB 1GMYA 2DCCA 3BCNA 2DCBA 1AU0A 3V6CA 4BS6A 1Q6KA 1AECA 1CVZA 7PCKA 3PDFA 2Y5BA 1CPJA 2WBFX 4BS5A 2YJ2A 3KWBX 2DZYA 3IOQA 3OISA 1NQCA 1YT7A 1SP4B 2G7YA 6PADA 3HHIA 3MTNA 3CH3X 2Y6EA 4N8WA 1PCIA 2XU5A 1ICFA 4DMYA 5JH3A 5K16A 1MDWA 2F7DA 3GCBA 1KHQA 1MIRA 1W6FA 5CVNB 3CH2X 1O0EA 1PPOA 4PADA 2H7JA 2XU3A 2O6XA 3K8UA 4N4ZA 1NPZA 1CJLA 1CV8A 4YYQA 2CB5A 4X6JA 3IV2A 1GX3A 1CTEA 1U9XA 2YJ8A 2R9OA 3H89A 1QOLA 2CIOA 3QJ3A 1DEUA 1W5RA 3O0UA 1AYUA 1U9VA 1IWDA 4YYRA 3F75A 2FRQA 4Q8HA 1GLOA 3D6SA 1QMYA 4MZOA 3LXSA 4RY2A 4KLBA 3K24A 5EF4A 2DCAA 4X6HA 4PP2E 4FJCA 4X6IA 1AU2A 2FT2A 3KWZA 1NL6A 1TLOA 4CDEB 3BOWA 3CBJA 3HHAA 1PPDA 3WXFA 2B1NA 4YYUA 2NQIA 1ZIVA 1NLJA 5A24A 3S3RA 1DF0A 2FUDA 4DMXA 1YK7A 4GUZA 2FYEA 2AUXA 5J94A 1MHWA 2E03A 1F2CA 2FTDA 4QRVA 3AI8A 4QH6A 2DZZA 4G54A 1CB5A 3P5XA 1MEGA 9PAPA 3LTWA 3OVZA 4HWYA 3PW3A 1FH0A 2R9MA 4BPVA 2BDLA 1BQIA 2YJBA 3TNXA 3P5UA 2E00A 2R9CA 4W5CA 2OZ2A 1VJVA 1NB5A 4P6GA 3QT4A 3BC3A 4I07A 4FK5A 1TL9A 5CHTA 3MHHA 1YK8A 2AS8A 1ITOA 1E2TA 2C0YA 2E01A 4P6EA 1K3BB 4YYVA 4PP1A 1PE6A 4I05A 4OELA 2DJGB 3BPFA 3IMAA 3OF9A 3M99A 3IUTA 1ZCMA 1EWMA 1TU6A 2GFOA 1PADA 1EWOA 3DF0A 2PBHA 2HD5A 5CHVA 2R6NA 3WXGA 3C9EA 2DC9A 3OVXA 3K9MA 3HWNA 1Y08A 2ARYA 2G8EA 1GECE 3IEJA 4YYWA 3B79A 2DC7A 4PI3A 1ATKA 1SNKA 3U8EA 4ZUXU 2R9NA 1AYWA 2DJFB 2PADA 2AVWA 3KFQA 4CDCB 2XU1A 2GHUA 5PADA 1AU4A 2ACTA 3KX1A 2OP3A 5JA7A 4B55A 4FIPA 1ME3A 3ZUAA 2NQAA 1MEMA 1X9YA 1BP4A 2VHSA 1W4TA 1BGOA 3PNRA 4K7CA 1AIMA 4NV8A 1F2BA 3D9WA 1F2AA 3ERVA 2JQGR 2NQDB 1PIPA 3P5VA 3KSEA 4NV7A 4QRGA 2R9FA 1VSNA 3BPMA 4Q8GA 3RVWA 3IHPA 3N3KA 2VFCA 2NQGA 1EWLA 2FRAA 1PPPA 2DC8A 3MHSA 2B1MA 2AIMA 2P7UA 2F1GA 2DC6A 4XR7A 2BSZA 3H7DA 2AUZA 1MS6A 1BY8A 4BSQA 4XUIA 3LFYA 1U5IA 2JQFR 2AYOA 3KKUA 1ME4A 3CBKA 1GCBA 3KW9A 1KHPA 8PCHA 2IPPB 3WXEA 3F5VA 4QRXA 4I04A 4CDDB 3P5WA 1PPNA 3QSDA 5EGWA 4W4UA 2DCDA 3H8CA 3I06A 2FQ9A 2HH5A 1U9QX 4CZWA 2VHFA 1KFUL 1XKGA 4OEMA 3N3GA 2BDZA 3USVA 1CQDA 1JQPA 1YVBA 2VFBA 1A6RA 1NB3A 4AXMA 1Y4HA 2P0RA 1F29A 4AXLA 5FPWA 1KFXL 1CS8A 2IBIA 1AYVA 2PREA 2OULA 4WA6A 1EF7A 3V6EA 4CDFB 4YYSA 2HXZA 3MORA 1HUCB 3BWKA 4QBBA 3RVVA 3RVXA 1CSBB 4BGFA 2XU4A 4MZSA 5CVMA 4BQVA 2G8JA 1STFE 1AU3A 1EWPA 1THEA 1PBHA 4W5BA 3N4CA 1YALA 1M6DA 4YVAA 3O1GA 1KXRA 1QDQA 3H6SA 2ATOA 2FO5A 2PNSA 1U9WA 2E02A 2YJCA 1QXPA 2P86A 3S3QA 3PBHA 3OF8A 3I3TA 4N79A 2YJ9A 5F02A 1S4VA 1POPA 3HD3A 3H8BA 5CVOB 4C5PA 2AYNA 2G6DA 4YV8A 3NHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXV A;  2AU1 A;  4MSX A;  2HHN A;  3E1Z B;  1GMY A;  2DCC A;  3BCN A;  2DCB A;  1AU0 A;  3V6C A;  4BS6 A;  1Q6K A;  1AEC A;  1CVZ A;  7PCK A;  3PDF A;  2Y5B A;  1CPJ A;  2WBF X;  4BS5 A;  2YJ2 A;  3KWB X;  2DZY A;  3IOQ A;  3OIS A;  1NQC A;  1YT7 A;  1SP4 B;  2G7Y A;  6PAD A;  3HHI A;  3MTN A;  3CH3 X;  2Y6E A;  4N8W A;  1PCI A;  2XU5 A;  1ICF A;  4DMY A;  5JH3 A;  5K16 A;  1MDW A;  2F7D A;  3GCB A;  1KHQ A;  1MIR A;  5CVN B;  3CH2 X;  1O0E A;  1PPO A;  4PAD A;  2H7J A;  2XU3 A;  2O6X A;  3K8U A;  4N4Z A;  1NPZ A;  1CJL A;  1CV8 A;  4YYQ A;  2CB5 A;  4X6J A;  3IV2 A;  1CTE A;  1U9X A;  2YJ8 A;  2R9O A;  3H89 A;  1QOL A;  2CIO A;  3QJ3 A;  1DEU A;  3O0U A;  1AYU A;  1U9V A;  1IWD A;  4YYR A;  3F75 A;  2FRQ A;  4Q8H A;  1GLO A;  3D6S A;  1QMY A;  4MZO A;  3LXS A;  4RY2 A;  4KLB A;  3K24 A;  5EF4 A;  2DCA A;  4X6H A;  4PP2 E;  4FJC A;  4X6I A;  1AU2 A;  2FT2 A;  3KWZ A;  1NL6 A;  1TLO A;  4CDE B;  3BOW A;  3CBJ A;  3HHA A;  1PPD A;  3WXF A;  2B1N A;  4YYU A;  2NQI A;  1ZIV A;  1NLJ A;  5A24 A;  3S3R A;  1DF0 A;  2FUD A;  4DMX A;  1YK7 A;  2FYE A;  2AUX A;  5J94 A;  1MHW A;  2E03 A;  1F2C A;  2FTD A;  4QRV A;  3AI8 A;  4QH6 A;  2DZZ A;  4G54 A;  1CB5 A;  3P5X A;  1MEG A;  9PAP A;  3OVZ A;  4HWY A;  3PW3 A;  1FH0 A;  2R9M A;  4BPV A;  2BDL A;  1BQI A;  2YJB A;  3TNX A;  3P5U A;  2E00 A;  2R9C A;  4W5C A;  2OZ2 A;  1VJV A;  1NB5 A;  4P6G A;  3QT4 A;  3BC3 A;  4I07 A;  4FK5 A;  1TL9 A;  5CHT A;  3MHH A;  1YK8 A;  2AS8 A;  1ITO A;  2C0Y A;  2E01 A;  4P6E A;  1K3B B;  4YYV A;  4PP1 A;  1PE6 A;  4I05 A;  4OEL A;  2DJG B;  3BPF A;  3IMA A;  3OF9 A;  3M99 A;  3IUT A;  1ZCM A;  1EWM A;  1TU6 A;  2GFO A;  1PAD A;  1EWO A;  3DF0 A;  2PBH A;  2HD5 A;  5CHV A;  2R6N A;  3WXG A;  3C9E A;  2DC9 A;  3OVX A;  3K9M A;  3HWN A;  1Y08 A;  2ARY A;  2G8E A;  1GEC E;  3IEJ A;  4YYW A;  3B79 A;  2DC7 A;  4PI3 A;  1ATK A;  1SNK A;  3U8E A;  4ZUX U;  2R9N A;  1AYW A;  2DJF B;  2PAD A;  2AVW A;  3KFQ A;  4CDC B;  2XU1 A;  2GHU A;  5PAD A;  1AU4 A;  2ACT A;  3KX1 A;  2OP3 A;  5JA7 A;  4FIP A;  1ME3 A;  3ZUA A;  2NQA A;  1MEM A;  1X9Y A;  1BP4 A;  2VHS A;  1BGO A;  3PNR A;  4K7C A;  1AIM A;  1F2B A;  1F2A A;  3ERV A;  2JQG R;  2NQD B;  1PIP A;  3P5V A;  3KSE A;  4QRG A;  2R9F A;  1VSN A;  3BPM A;  4Q8G A;  3RVW A;  3IHP A;  3N3K A;  2NQG A;  1EWL A;  2FRA A;  1PPP A;  2DC8 A;  3MHS A;  2B1M A;  2AIM A;  2P7U A;  2F1G A;  2DC6 A;  4XR7 A;  3H7D A;  2AUZ A;  1MS6 A;  1BY8 A;  4BSQ A;  4XUI A;  3LFY A;  1U5I A;  2JQF R;  2AYO A;  3KKU A;  1ME4 A;  3CBK A;  1GCB A;  3KW9 A;  1KHP A;  8PCH A;  2IPP B;  3WXE A;  3F5V A;  4QRX A;  4I04 A;  4CDD B;  3P5W A;  1PPN A;  3QSD A;  5EGW A;  4W4U A;  2DCD A;  3H8C A;  3I06 A;  2FQ9 A;  2HH5 A;  1U9Q X;  4CZW A;  2VHF A;  1KFU L;  1XKG A;  4OEM A;  3N3G A;  2BDZ A;  3USV A;  1CQD A;  1JQP A;  1YVB A;  1A6R A;  1NB3 A;  4AXM A;  1Y4H A;  2P0R A;  1F29 A;  4AXL A;  5FPW A;  1KFX L;  1CS8 A;  2IBI A;  1AYV A;  2PRE A;  2OUL A;  4WA6 A;  1EF7 A;  3V6E A;  4CDF B;  4YYS A;  2HXZ A;  3MOR A;  1HUC B;  3BWK A;  4QBB A;  3RVV A;  3RVX A;  1CSB B;  2XU4 A;  4MZS A;  5CVM A;  4BQV A;  2G8J A;  1STF E;  1AU3 A;  1EWP A;  1THE A;  1PBH A;  4W5B A;  3N4C A;  1YAL A;  1M6D A;  4YVA A;  3O1G A;  1KXR A;  1QDQ A;  3H6S A;  2ATO A;  2FO5 A;  2PNS A;  1U9W A;  2E02 A;  2YJC A;  1QXP A;  2P86 A;  3S3Q A;  3PBH A;  3OF8 A;  3I3T A;  4N79 A;  2YJ9 A;  5F02 A;  1S4V A;  1POP A;  3HD3 A;  3H8B A;  5CVO B;  2AYN A;  2G6D A;  4YV8 A;  3NHE A; 
#chains in the Genus database with same CATH topology
 3W31 A;  1PXV A;  2AU1 A;  4MSX A;  2HHN A;  3E1Z B;  2J7Q C;  1GMY A;  3MJ5 A;  2DCC A;  3BCN A;  2DCB A;  1AU0 A;  3V6C A;  4BS6 A;  1Q6K A;  2JRI A;  1AEC A;  1CVZ A;  7PCK A;  3PDF A;  2Y5B A;  1CPJ A;  2WBF X;  2HWK A;  2YJ2 A;  3KWB X;  2DZY A;  3IOQ A;  3OIS A;  1NQC A;  4RF0 A;  4BS5 A;  1YT7 A;  1SP4 B;  2G7Y A;  6PAD A;  3HHI A;  3MTN A;  3MP2 A;  3CH3 X;  2Y6E A;  3C0R A;  4N8W A;  1PCI A;  4MI7 A;  2XU5 A;  1ICF A;  4DMY A;  5JH3 A;  5K16 A;  1MDW A;  2F7D A;  3BBA A;  3GCB A;  1KHQ A;  1MIR A;  5CVN B;  3CH2 X;  1O0E A;  1PPO A;  4PAD A;  2H7J A;  2XU3 A;  2O6X A;  3K8U A;  4N4Z A;  1NPZ A;  1CJL A;  1CV8 A;  4YYQ A;  2CB5 A;  4X6J A;  3IV2 A;  1CTE A;  1U9X A;  2YJ8 A;  2DOS A;  2R9O A;  3H89 A;  2BTW B;  1QOL A;  2CIO A;  3QJ3 A;  2JTC A;  3TMP A;  1DEU A;  3O0U A;  3BB7 A;  1AYU A;  1U9V A;  1IWD A;  4YYR A;  3F75 A;  2FRQ A;  4Q8H A;  1GLO A;  3D6S A;  1QMY A;  4MZO A;  3LXS A;  4RY2 A;  4KLB A;  4ZTB A;  4BOZ A;  3K24 A;  3PHU A;  5EF4 A;  2DCA A;  4X6H A;  4PP2 E;  4FJC A;  4X6I A;  1AU2 A;  2FT2 A;  3KWZ A;  1NL6 A;  1TLO A;  4BOU A;  4CDE B;  3BOW A;  3CBJ A;  3HHA A;  1PPD A;  3WXF A;  2B1N A;  4YYU A;  2NQI A;  1ZIV A;  2Z84 A;  1NLJ A;  4IUM A;  5A24 A;  3S3R A;  4D8B A;  1DF0 A;  2FUD A;  4DMX A;  1YK7 A;  4IP3 A;  4RF1 A;  2FYE A;  2AUX A;  5J94 A;  4BOP A;  1MHW A;  2E03 A;  3IFU A;  1F2C A;  2FTD A;  2BU3 A;  4QRV A;  5KO3 A;  3AI8 A;  4QH6 A;  2DZZ A;  4G54 A;  1CB5 A;  3P5X A;  1MEG A;  9PAP A;  3OVZ A;  4HWY A;  3PW3 A;  1FH0 A;  2R9M A;  4D8I A;  4BPV A;  2BDL A;  1BQI A;  2YJB A;  4P16 A;  3TNX A;  3P5U A;  2E00 A;  2R9C A;  4W5C A;  2OZ2 A;  4GUA A;  4OW0 A;  1VJV A;  1NB5 A;  4P6G A;  3QT4 A;  3BC3 A;  4I07 A;  4FK5 A;  5JZE A;  1TL9 A;  3BY4 A;  5CHT A;  3MHH A;  1YK8 A;  2AS8 A;  1ITO A;  2C0Y A;  2E01 A;  4P6E A;  1K3B B;  4YYV A;  4PP1 A;  2FE8 A;  1PE6 A;  4I05 A;  4OEL A;  4MM3 B;  4BOS A;  2DJG B;  3BPF A;  3IMA A;  3OF9 A;  3M99 A;  3IUT A;  2AGA A;  1ZCM A;  1EWM A;  1TU6 A;  4BOQ A;  2GFO A;  1PAD A;  1EWO A;  5E6J A;  3DF0 A;  2PBH A;  2HD5 A;  4REZ A;  5CHV A;  2R6N A;  3WXG A;  3C9E A;  2DC9 A;  3OVX A;  3K9M A;  3HWN A;  1Y08 A;  2ARY A;  2G8E A;  1GEC E;  3IEJ A;  4YYW A;  3B79 A;  2DC7 A;  4HXD B;  4PI3 A;  1ATK A;  1SNK A;  3U8E A;  4ZUX U;  2R9N A;  1AYW A;  2DJF B;  2PAD A;  3TRK A;  2AVW A;  3KFQ A;  4XZX A;  4RKX A;  4CDC B;  4M0W A;  2XU1 A;  2GHU A;  5PAD A;  1AU4 A;  3PHX A;  2ACT A;  3KX1 A;  2OP3 A;  5JA7 A;  4FIP A;  1ME3 A;  3ZUA A;  2NQA A;  1MEM A;  1X9Y A;  1BP4 A;  2VHS A;  4D8E A;  1BGO A;  3PNR A;  4K7C A;  4OVZ A;  1AIM A;  1F2B A;  1F2A A;  3ERV A;  2JQG R;  2NQD B;  1PIP A;  3P5V A;  3KSE A;  4QRG A;  2R9F A;  1VSN A;  3BPM A;  4Q8G A;  3PHW A;  3RVW A;  1UKF A;  3IHP A;  3N3K A;  4PT5 A;  2NQG A;  1EWL A;  2FRA A;  3B21 A;  1PPP A;  2DC8 A;  3MHS A;  2B1M A;  3ZNH A;  2AIM A;  2P7U A;  2F1G A;  2DC6 A;  4XR7 A;  3H7D A;  1DKI A;  4R3D A;  2AUZ A;  1MS6 A;  5EZS A;  1BY8 A;  4BSQ A;  4XUI A;  3LFY A;  4RNA A;  1U5I A;  2JQF R;  2AYO A;  3KKU A;  1ME4 A;  3CBK A;  1GCB A;  3KW9 A;  1KHP A;  8PCH A;  2IPP B;  3WXE A;  3F5V A;  4QRX A;  3W30 A;  3MTV A;  4I04 A;  4CDD B;  3P5W A;  1PPN A;  3QSD A;  5EGW A;  4W4U A;  2DCD A;  3H8C A;  3I06 A;  4WUR A;  2FQ9 A;  2HH5 A;  4A5U A;  1U9Q X;  4CZW A;  3PRM A;  2VHF A;  1KFU L;  1PVJ A;  3RNV A;  1XKG A;  4OEM A;  3N3G A;  2BDZ A;  3USV A;  1CQD A;  1JQP A;  1YVB A;  1A6R A;  1NB3 A;  4AXM A;  1Y4H A;  5EZQ A;  2P0R A;  1F29 A;  4AXL A;  5FPW A;  1KFX L;  1CS8 A;  2IBI A;  1AYV A;  3PT2 A;  2PRE A;  2OUL A;  4WA6 A;  1EF7 A;  3V6E A;  4CDF B;  4YYS A;  2HXZ A;  3OQC A;  3MOR A;  1HUC B;  3BWK A;  4QBB A;  3RVV A;  3RVX A;  1CSB B;  2XU4 A;  2BTW A;  4MZS A;  3PSE A;  5CVM A;  4BQV A;  4OVZ B;  2G8J A;  1STF E;  1AU3 A;  1EWP A;  1THE A;  1PBH A;  4W5B A;  3N4C A;  1YAL A;  1M6D A;  2J7Q A;  2UZJ A;  4YVA A;  3O1G A;  1KXR A;  1QDQ A;  3H6S A;  1YZB A;  2ATO A;  2FO5 A;  2PNS A;  1U9W A;  2E02 A;  2YJC A;  1QXP A;  2P86 A;  3S3Q A;  3PBH A;  3PRP A;  3OF8 A;  3I3T A;  3E9S A;  4N79 A;  2YJ9 A;  5F02 A;  1S4V A;  1POP A;  3HD3 A;  3H8B A;  5CVO B;  3O65 A;  2AYN A;  2G6D A;  4YV8 A;  3NHE A; 
#chains in the Genus database with same CATH homology
 1PXV A;  2AU1 A;  4MSX A;  2HHN A;  3E1Z B;  1GMY A;  2DCC A;  3BCN A;  2DCB A;  1AU0 A;  3V6C A;  4BS6 A;  1Q6K A;  1AEC A;  1CVZ A;  7PCK A;  3PDF A;  2Y5B A;  1CPJ A;  2WBF X;  4BS5 A;  2YJ2 A;  3KWB X;  2DZY A;  3IOQ A;  3OIS A;  1NQC A;  1YT7 A;  1SP4 B;  2G7Y A;  6PAD A;  3HHI A;  3MTN A;  3CH3 X;  2Y6E A;  4N8W A;  1PCI A;  2XU5 A;  1ICF A;  4DMY A;  5JH3 A;  5K16 A;  1MDW A;  2F7D A;  3GCB A;  1KHQ A;  1MIR A;  1W6F A;  5CVN B;  3CH2 X;  1O0E A;  1PPO A;  4PAD A;  2H7J A;  2XU3 A;  2O6X A;  3K8U A;  4N4Z A;  1NPZ A;  1CJL A;  1CV8 A;  4YYQ A;  2CB5 A;  4X6J A;  3IV2 A;  1GX3 A;  1CTE A;  1U9X A;  2YJ8 A;  2R9O A;  3H89 A;  1QOL A;  2CIO A;  3QJ3 A;  1DEU A;  1W5R A;  3O0U A;  1AYU A;  1U9V A;  1IWD A;  4YYR A;  3F75 A;  2FRQ A;  4Q8H A;  1GLO A;  3D6S A;  1QMY A;  4MZO A;  3LXS A;  4RY2 A;  4KLB A;  3K24 A;  5EF4 A;  2DCA A;  4X6H A;  4PP2 E;  4FJC A;  4X6I A;  1AU2 A;  2FT2 A;  3KWZ A;  1NL6 A;  1TLO A;  4CDE B;  3BOW A;  3CBJ A;  3HHA A;  1PPD A;  3WXF A;  2B1N A;  4YYU A;  2NQI A;  1ZIV A;  1NLJ A;  5A24 A;  3S3R A;  1DF0 A;  2FUD A;  4DMX A;  1YK7 A;  4GUZ A;  2FYE A;  2AUX A;  5J94 A;  1MHW A;  2E03 A;  1F2C A;  2FTD A;  4QRV A;  3AI8 A;  4QH6 A;  2DZZ A;  4G54 A;  1CB5 A;  3P5X A;  1MEG A;  9PAP A;  3LTW A;  3OVZ A;  4HWY A;  3PW3 A;  1FH0 A;  2R9M A;  4BPV A;  2BDL A;  1BQI A;  2YJB A;  3TNX A;  3P5U A;  2E00 A;  2R9C A;  4W5C A;  2OZ2 A;  1VJV A;  1NB5 A;  4P6G A;  3QT4 A;  3BC3 A;  4I07 A;  4FK5 A;  1TL9 A;  5CHT A;  3MHH A;  1YK8 A;  2AS8 A;  1ITO A;  1E2T A;  2C0Y A;  2E01 A;  4P6E A;  1K3B B;  4YYV A;  4PP1 A;  1PE6 A;  4I05 A;  4OEL A;  2DJG B;  3BPF A;  3IMA A;  3OF9 A;  3M99 A;  3IUT A;  1ZCM A;  1EWM A;  1TU6 A;  2GFO A;  1PAD A;  1EWO A;  3DF0 A;  2PBH A;  2HD5 A;  5CHV A;  2R6N A;  3WXG A;  3C9E A;  2DC9 A;  3OVX A;  3K9M A;  3HWN A;  1Y08 A;  2ARY A;  2G8E A;  1GEC E;  3IEJ A;  4YYW A;  3B79 A;  2DC7 A;  4PI3 A;  1ATK A;  1SNK A;  3U8E A;  4ZUX U;  2R9N A;  1AYW A;  2DJF B;  2PAD A;  2AVW A;  3KFQ A;  4CDC B;  2XU1 A;  2GHU A;  5PAD A;  1AU4 A;  2ACT A;  3KX1 A;  2OP3 A;  5JA7 A;  4B55 A;  4FIP A;  1ME3 A;  3ZUA A;  2NQA A;  1MEM A;  1X9Y A;  1BP4 A;  2VHS A;  1W4T A;  1BGO A;  3PNR A;  4K7C A;  1AIM A;  4NV8 A;  1F2B A;  3D9W A;  1F2A A;  3ERV A;  2JQG R;  2NQD B;  1PIP A;  3P5V A;  3KSE A;  4NV7 A;  4QRG A;  2R9F A;  1VSN A;  3BPM A;  4Q8G A;  3RVW A;  3IHP A;  3N3K A;  2VFC A;  2NQG A;  1EWL A;  2FRA A;  1PPP A;  2DC8 A;  3MHS A;  2B1M A;  2AIM A;  2P7U A;  2F1G A;  2DC6 A;  4XR7 A;  2BSZ A;  3H7D A;  2AUZ A;  1MS6 A;  1BY8 A;  4BSQ A;  4XUI A;  3LFY A;  1U5I A;  2JQF R;  2AYO A;  3KKU A;  1ME4 A;  3CBK A;  1GCB A;  3KW9 A;  1KHP A;  8PCH A;  2IPP B;  3WXE A;  3F5V A;  4QRX A;  4I04 A;  4CDD B;  3P5W A;  1PPN A;  3QSD A;  5EGW A;  4W4U A;  2DCD A;  3H8C A;  3I06 A;  2FQ9 A;  2HH5 A;  1U9Q X;  4CZW A;  2VHF A;  1KFU L;  1XKG A;  4OEM A;  3N3G A;  2BDZ A;  3USV A;  1CQD A;  1JQP A;  1YVB A;  2VFB A;  1A6R A;  1NB3 A;  4AXM A;  1Y4H A;  2P0R A;  1F29 A;  4AXL A;  5FPW A;  1KFX L;  1CS8 A;  2IBI A;  1AYV A;  2PRE A;  2OUL A;  4WA6 A;  1EF7 A;  3V6E A;  4CDF B;  4YYS A;  2HXZ A;  3MOR A;  1HUC B;  3BWK A;  4QBB A;  3RVV A;  3RVX A;  1CSB B;  4BGF A;  2XU4 A;  4MZS A;  5CVM A;  4BQV A;  2G8J A;  1STF E;  1AU3 A;  1EWP A;  1THE A;  1PBH A;  4W5B A;  3N4C A;  1YAL A;  1M6D A;  4YVA A;  3O1G A;  1KXR A;  1QDQ A;  3H6S A;  2ATO A;  2FO5 A;  2PNS A;  1U9W A;  2E02 A;  2YJC A;  1QXP A;  2P86 A;  3S3Q A;  3PBH A;  3OF8 A;  3I3T A;  4N79 A;  2YJ9 A;  5F02 A;  1S4V A;  1POP A;  3HD3 A;  3H8B A;  5CVO B;  4C5P A;  2AYN A;  2G6D A;  4YV8 A;  3NHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...