2FYEA

Mutant human cathepsin s with irreversible inhibitor cra-14013
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTKKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSAYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutant Human Cathepsin S with irreversible inhibitor CRA-14013
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S preproprotein
total genus 66
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fyeA00
1STFE 3N3GA 1SP4B 1O0EA 3HD3A 1CVZA 2YJ8A 1HUCB 1NL6A 3DF0A 3I06A 2G6DA 4QBBA 4RY2A 1EWOA 2FO5A 3KSEA 2P0RA 2VHSA 3USVA 3U8EA 1MDWA 4X6JA 4K7CA 1YT7A 1QMYA 2G8EA 1KFXL 3B79A 3BCNA 2FYEA 4YV8A 1BQIA 5CHTA 2E00A 1AYVA 1U9QX 4AXLA 2GHUA 3K24A 2FRAA 1QOLA 9PAPA 2BDZA 4BS5A 2FQ9A 2Y6EA 3IHPA 3WXGA 1ITOA 2PBHA 3OISA 2YJ9A 5CVNB 1K3BB 5JH3A 1ZCMA 2DC7A 2AYOA 1NLJA 4ZUXU 2B1MA 1GLOA 2HXZA 1F2BA 3M99A 1XKGA 1GECE 4BPVA 2NQAA 3S3QA 4PI3A 1ICFA 2F7DA 1EF7A 3PNRA 3KWBX 1KFUL 3PBHA 4BS6A 5CVOB 2Y5BA 1AYWA 1NB3A 4N79A 3QJ3A 1VSNA 3KX1A 3BWKA 1IWDA 4MSXA 1CJLA 1CSBB 3RVVA 3HWNA 1M6DA 2R6NA 1PPNA 2DZYA 3K8UA 8PCHA 2R9CA 1AU3A 2DCCA 3IEJA 3TNXA 2DC8A 2OZ2A 3LFYA 4CDCB 3OVZA 4N8WA 1TU6A 1CPJA 1CB5A 4CZWA 3PW3A 4AXMA 1KHPA 2OULA 3P5XA 4KLBA 4CDDB 4YYUA 1PIPA 2GFOA 1ATKA 2G7YA 3NHEA 1YALA 4YYSA 1U5IA 3S3RA 2FRQA 3IV2A 2FUDA 3N3KA 1BY8A 3BPMA 2YJ2A 3I3TA 1DF0A 1NPZA 4MZOA 2E02A 1TL9A 1YK7A 1YK8A 2CB5A 2R9FA 3E1ZB 1PE6A 4PP2E 3OF8A 2E01A 2G8JA 3OVXA 1SNKA 2ATOA 2BDLA 2DC9A 4MZSA 4XUIA 4QRVA 3BC3A 1TLOA 2NQDB 3C9EA 2DCBA 2DCAA 1U9VA 2P7UA 1CV8A 4X6HA 1ZIVA 2XU5A 2AS8A 2P86A 4W5CA 1PXVA 2AUZA 1AIMA 1AYUA 1ME3A 1NB5A 3MHSA 1MEGA 1PADA 1DEUA 1NQCA 1X9YA 2R9NA 4W4UA 1PPOA 2ACTA 3CH3X 3K9MA 4OEMA 5J94A 2DZZA 4HWYA 1THEA 3QSDA 2CIOA 3O0UA 3PDFA 3CH2X 1BGOA 3BPFA 3HHAA 4QRGA 4FIPA 1CS8A 2AUXA 1FH0A 2HHNA 2VHFA 3V6EA 2AIMA 3P5UA 2F1GA 3RVXA 2DJFB 5F02A 4YYRA 1GMYA 3MTNA 4BSQA 3KKUA 3O1GA 3WXFA 2DC6A 2FT2A 1EWLA 4OELA 4I07A 3IUTA 2XU1A 2B1NA 1AECA 1Y08A 2O6XA 1KXRA 4N4ZA 1AU2A 2R9OA 4XR7A 5EGWA 4CDEB 4FK5A 3N4CA 1S4VA 3HHIA 1EWPA 1F2CA 3ZUAA 4YYVA 5A24A 3ERVA 1PCIA 2PREA 3BOWA 5PADA 1U9XA 3RVWA 4W5BA 2AVWA 4QRXA 4YYWA 5FPWA 2DCDA 4DMYA 1MEMA 1MHWA 3F75A 1CTEA 3KFQA 2DJGB 1CQDA 2JQFR 1PPPA 4I04A 1PBHA 3MHHA 1F2AA 3KW9A 3H6SA 2YJBA 5CHVA 3GCBA 2XU3A 4G54A 3H89A 1QXPA 3IOQA 7PCKA 2FTDA 1MS6A 2WBFX 2HH5A 4DMXA 4I05A 4WA6A 2AU1A 4X6IA 1AU0A 1GCBA 3KWZA 2OP3A 2C0YA 3IMAA 2IBIA 3H7DA 1POPA 1AU4A 5JA7A 2NQGA 5EF4A 4FJCA 3CBJA 4P6GA 5K16A 3WXEA 3CBKA 4Q8GA 3D6SA 6PADA 4P6EA 4CDFB 3H8BA 2JQGR 2XU4A 3OF9A 1YVBA 1Q6KA 3F5VA 2NQIA 4YVAA 1VJVA 4Q8HA 1Y4HA 1JQPA 1KHQA 3MORA 4QH6A 4PP1A 1PPDA 1MIRA 3LXSA 1BP4A 2YJCA 3QT4A 1A6RA 3V6CA 1F29A 3AI8A 3H8CA 2PADA 2ARYA 5CVMA 3P5WA 4BQVA 1U9WA 2IPPB 2R9MA 2H7JA 4YYQA 1QDQA 2PNSA 2E03A 2AYNA 4PADA 2HD5A 1EWMA 3P5VA 1ME4A
chains in the Genus database with same CATH superfamily
1STFE 3N3GA 3RNVA 2HWKA 1SP4B 1O0EA 3HD3A 1CVZA 2YJ8A 1HUCB 1NL6A 3DF0A 3I06A 2G6DA 4QBBA 4RY2A 4BOQA 1EWOA 2FO5A 3KSEA 2P0RA 2VHSA 3USVA 3U8EA 1MDWA 4X6JA 4K7CA 1YT7A 1QMYA 3W31A 2G8EA 1KFXL 3B79A 3BCNA 2FYEA 4YV8A 1BQIA 5CHTA 2E00A 1AYVA 1U9QX 4AXLA 2GHUA 3K24A 2FRAA 1QOLA 9PAPA 3IFUA 1PVJA 2BDZA 4BS5A 2FQ9A 2Y6EA 3IHPA 3WXGA 1ITOA 2J7QC 2PBHA 3OISA 5JZEA 2YJ9A 5CVNB 1K3BB 5JH3A 1ZCMA 2DC7A 2AYOA 2AGAA 1NLJA 3PHUA 2B1MA 4PT5A 4ZUXU 1GLOA 2HXZA 3PSEA 1F2BA 3M99A 1XKGA 1GECE 4BPVA 2NQAA 3S3QA 4PI3A 1ICFA 3BBAA 2F7DA 1EF7A 3PNRA 3KWBX 1KFUL 3PBHA 4MI7A 4BS6A 3OQCA 5CVOB 2Y5BA 1AYWA 1NB3A 4N79A 3QJ3A 1VSNA 3KX1A 3BWKA 1IWDA 4MSXA 1CJLA 4R3DA 1CSBB 3RVVA 3HWNA 1M6DA 5E6JA 2R6NA 1PPNA 2DZYA 3PHWA 3K8UA 8PCHA 2R9CA 1AU3A 2DCCA 4WURA 3IEJA 3TNXA 2DC8A 2OZ2A 3B21A 3LFYA 2BTWA 3PHXA 4CDCB 3OVZA 4N8WA 1TU6A 1CPJA 1CB5A 4CZWA 4M0WA 2DOSA 3PW3A 4AXMA 1KHPA 2OULA 3P5XA 4KLBA 4CDDB 4YYUA 1PIPA 2GFOA 4A5UA 1ATKA 2G7YA 3NHEA 1YALA 4YYSA 1U5IA 2FRQA 3IV2A 3S3RA 2FUDA 3N3KA 1BY8A 3BPMA 2YJ2A 3I3TA 1DF0A 1NPZA 4MZOA 2E02A 1TL9A 1YK7A 1YK8A 2CB5A 2R9FA 3E1ZB 1PE6A 4PP2E 2JTCA 3MTVA 3OF8A 2E01A 2G8JA 4BOUA 3OVXA 1SNKA 4IP3A 2ATOA 2BDLA 4IUMA 2DC9A 4MZSA 4XUIA 4QRVA 4XZXA 3BC3A 1DKIA 3E9SA 1TLOA 2NQDB 3C9EA 2DCBA 2DCAA 1U9VA 2P7UA 1CV8A 4X6HA 3TRKA 4BOZA 1ZIVA 2XU5A 2AS8A 2BTWB 2P86A 1PXVA 4W5CA 2AUZA 1AIMA 1YZBA 3W30A 1AYUA 1ME3A 1NB5A 3MHSA 4D8IA 1MEGA 1PADA 1DEUA 2J7QA 1NQCA 1X9YA 2R9NA 4W4UA 1PPOA 2ACTA 4D8BA 3CH3X 3K9MA 3PT2A 4OEMA 5J94A 2DZZA 4HWYA 1THEA 3TMPA 3QSDA 2CIOA 3O0UA 3PDFA 3CH2X 1BGOA 3BPFA 3HHAA 4QRGA 4FIPA 1CS8A 2AUXA 1FH0A 2HHNA 2VHFA 3BY4A 3V6EA 2AIMA 3P5UA 2F1GA 3RVXA 2DJFB 5F02A 3BB7A 4YYRA 1GMYA 3MTNA 4BSQA 3KKUA 3O1GA 3WXFA 2DC6A 2FT2A 1EWLA 4OELA 4I07A 3IUTA 2XU1A 2B1NA 1AECA 1UKFA 4P16A 1Y08A 2O6XA 1KXRA 4N4ZA 1AU2A 2R9OA 4MM3B 4XR7A 3ZNHA 5EGWA 4CDEB 4FK5A 3N4CA 1S4VA 2FE8A 3HHIA 1EWPA 1F2CA 3ZUAA 4YYVA 4OVZA 5A24A 3ERVA 1PCIA 2PREA 3BOWA 5PADA 4ZTBA 1U9XA 3RVWA 5EZSA 4W5BA 4BOPA 4RNAA 2AVWA 4QRXA 4YYWA 5FPWA 4REZA 2DCDA 4DMYA 5KO3A 1MEMA 1MHWA 3F75A 1CTEA 3KFQA 4OW0A 2DJGB 1CQDA 2JQFR 1PPPA 4I04A 1PBHA 3MHHA 1F2AA 3KW9A 3H6SA 2YJBA 5CHVA 3GCBA 2XU3A 2BU3A 4G54A 3H89A 1QXPA 3IOQA 7PCKA 2FTDA 1MS6A 2WBFX 2HH5A 4DMXA 4I05A 4WA6A 2AU1A 4X6IA 1AU0A 1GCBA 3KWZA 2OP3A 2C0YA 4RF0A 3IMAA 2IBIA 3MJ5A 3H7DA 1POPA 1AU4A 5JA7A 2NQGA 5EF4A 4FJCA 3CBJA 4P6GA 5K16A 3WXEA 3CBKA 4Q8GA 3D6SA 5EZQA 4OVZB 6PADA 4P6EA 4CDFB 3H8BA 4RKXA 2JQGR 2XU4A 3OF9A 1YVBA 1Q6KA 3F5VA 2NQIA 4YVAA 1VJVA 4Q8HA 3PRMA 3O65A 1Y4HA 1JQPA 1KHQA 3MORA 4QH6A 3C0RA 2JRIA 4PP1A 3MP2A 1PPDA 1MIRA 1BP4A 2YJCA 3LXSA 3QT4A 1A6RA 3V6CA 1F29A 3AI8A 3H8CA 4HXDB 2PADA 4BOSA 2ARYA 5CVMA 4RF1A 3PRPA 4D8EA 3P5WA 4BQVA 1U9WA 2IPPB 2R9MA 2Z84A 2H7JA 4GUAA 4YYQA 1QDQA 2PNSA 2E03A 2AYNA 2UZJA 4PADA 2HD5A 1EWMA 3P5VA 1ME4A
chains in the Genus database with same CATH topology
1STFE 3N3GA 1SP4B 1O0EA 3HD3A 1CVZA 2YJ8A 1HUCB 1NL6A 3DF0A 3I06A 2G6DA 4QBBA 4RY2A 1W4TA 1EWOA 2FO5A 3KSEA 2P0RA 2VHSA 3USVA 3U8EA 1MDWA 4X6JA 4K7CA 1YT7A 1QMYA 2G8EA 1KFXL 3B79A 3BCNA 2FYEA 4YV8A 1BQIA 5CHTA 2E00A 1AYVA 1U9QX 4AXLA 2GHUA 3K24A 2FRAA 1QOLA 9PAPA 2BDZA 4BS5A 2FQ9A 2Y6EA 3IHPA 3WXGA 1ITOA 2PBHA 3OISA 2YJ9A 5CVNB 1K3BB 5JH3A 1ZCMA 2DC7A 2AYOA 1NLJA 4ZUXU 2B1MA 1GLOA 2HXZA 1F2BA 3M99A 1XKGA 1GECE 4BPVA 2NQAA 3S3QA 4PI3A 1ICFA 2F7DA 1EF7A 3PNRA 3KWBX 1KFUL 3PBHA 4BS6A 5CVOB 2Y5BA 1AYWA 1NB3A 4N79A 3QJ3A 1VSNA 2BSZA 3KX1A 3BWKA 1IWDA 4MSXA 1CJLA 1CSBB 3RVVA 3HWNA 1M6DA 2R6NA 1PPNA 2VFCA 2DZYA 3K8UA 8PCHA 2R9CA 1AU3A 2DCCA 3IEJA 3TNXA 2DC8A 2OZ2A 3LFYA 4CDCB 3OVZA 4N8WA 1TU6A 1CPJA 1CB5A 4CZWA 3PW3A 4AXMA 1KHPA 2OULA 3P5XA 1E2TA 4KLBA 4CDDB 4C5PA 1PIPA 2GFOA 4YYUA 1ATKA 2G7YA 3NHEA 1YALA 4YYSA 1U5IA 2FRQA 3IV2A 3S3RA 2FUDA 3N3KA 1BY8A 3BPMA 2YJ2A 3I3TA 1DF0A 1NPZA 4MZOA 2E02A 1TL9A 1YK7A 1YK8A 2CB5A 2R9FA 3E1ZB 1PE6A 2VFBA 4PP2E 4BGFA 3OF8A 2E01A 2G8JA 3OVXA 1SNKA 2ATOA 2BDLA 2DC9A 4MZSA 4XUIA 4QRVA 3BC3A 1TLOA 2NQDB 3C9EA 2DCBA 2DCAA 1U9VA 2P7UA 1CV8A 4X6HA 1ZIVA 2XU5A 2AS8A 4GUZA 2P86A 4W5CA 1PXVA 2AUZA 1AIMA 1AYUA 1ME3A 1NB5A 3MHSA 1MEGA 1PADA 1DEUA 1NQCA 1X9YA 2R9NA 4W4UA 1PPOA 2ACTA 3CH3X 3K9MA 4OEMA 5J94A 2DZZA 4HWYA 1THEA 3QSDA 2CIOA 3O0UA 3PDFA 3CH2X 1BGOA 3BPFA 3HHAA 4QRGA 4FIPA 1CS8A 2AUXA 1FH0A 2HHNA 2VHFA 3V6EA 2AIMA 3P5UA 1W6FA 2F1GA 3RVXA 2DJFB 5F02A 4YYRA 1GMYA 3MTNA 4BSQA 3KKUA 3O1GA 3WXFA 2DC6A 2FT2A 1EWLA 4OELA 4I07A 3IUTA 2XU1A 2B1NA 1AECA 1Y08A 2O6XA 1KXRA 4N4ZA 1AU2A 2R9OA 4XR7A 5EGWA 4CDEB 4FK5A 3N4CA 1S4VA 3HHIA 1EWPA 1F2CA 3ZUAA 4YYVA 4NV7A 5A24A 3ERVA 1PCIA 2PREA 3BOWA 5PADA 1U9XA 3RVWA 4W5BA 2AVWA 4QRXA 4YYWA 5FPWA 2DCDA 4DMYA 3LTWA 1GX3A 1MEMA 1MHWA 3F75A 1CTEA 3KFQA 4B55A 2DJGB 1CQDA 2JQFR 1PPPA 4I04A 1PBHA 3MHHA 1F2AA 3KW9A 3H6SA 2YJBA 4NV8A 5CHVA 3GCBA 2XU3A 4G54A 3H89A 1QXPA 3IOQA 7PCKA 2FTDA 1MS6A 2WBFX 2HH5A 4DMXA 4I05A 4WA6A 2AU1A 4X6IA 1AU0A 1GCBA 3KWZA 2OP3A 2C0YA 3IMAA 2IBIA 3H7DA 1POPA 3D9WA 1AU4A 5JA7A 2NQGA 5EF4A 4FJCA 3CBJA 4P6GA 5K16A 3WXEA 3CBKA 4Q8GA 3D6SA 6PADA 4P6EA 4CDFB 3H8BA 2JQGR 2XU4A 3OF9A 1YVBA 1Q6KA 3F5VA 2NQIA 4YVAA 1VJVA 1W5RA 4Q8HA 1Y4HA 1JQPA 1KHQA 3MORA 4QH6A 4PP1A 1PPDA 1MIRA 3LXSA 1BP4A 2YJCA 3QT4A 1A6RA 3V6CA 1F29A 3AI8A 3H8CA 2PADA 2ARYA 5CVMA 3P5WA 4BQVA 1U9WA 2IPPB 2R9MA 2H7JA 4YYQA 1QDQA 2PNSA 2E03A 2AYNA 4PADA 2HD5A 1EWMA 3P5VA 1ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF E;  3N3G A;  1SP4 B;  1O0E A;  3HD3 A;  1CVZ A;  2YJ8 A;  1HUC B;  1NL6 A;  3DF0 A;  3I06 A;  2G6D A;  4QBB A;  4RY2 A;  1EWO A;  2FO5 A;  3KSE A;  2P0R A;  2VHS A;  3USV A;  3U8E A;  1MDW A;  4X6J A;  4K7C A;  1YT7 A;  1QMY A;  2G8E A;  1KFX L;  3B79 A;  3BCN A;  2FYE A;  4YV8 A;  1BQI A;  5CHT A;  2E00 A;  1AYV A;  1U9Q X;  4AXL A;  2GHU A;  3K24 A;  2FRA A;  1QOL A;  9PAP A;  2BDZ A;  4BS5 A;  2FQ9 A;  2Y6E A;  3IHP A;  3WXG A;  1ITO A;  2PBH A;  3OIS A;  2YJ9 A;  5CVN B;  1K3B B;  5JH3 A;  1ZCM A;  2DC7 A;  2AYO A;  1NLJ A;  4ZUX U;  2B1M A;  1GLO A;  2HXZ A;  1F2B A;  3M99 A;  1XKG A;  1GEC E;  4BPV A;  2NQA A;  3S3Q A;  4PI3 A;  1ICF A;  2F7D A;  1EF7 A;  3PNR A;  3KWB X;  1KFU L;  3PBH A;  4BS6 A;  5CVO B;  2Y5B A;  1AYW A;  1NB3 A;  4N79 A;  3QJ3 A;  1VSN A;  3KX1 A;  3BWK A;  1IWD A;  4MSX A;  1CJL A;  1CSB B;  3RVV A;  3HWN A;  1M6D A;  2R6N A;  1PPN A;  2DZY A;  3K8U A;  8PCH A;  2R9C A;  1AU3 A;  2DCC A;  3IEJ A;  3TNX A;  2DC8 A;  2OZ2 A;  3LFY A;  4CDC B;  3OVZ A;  4N8W A;  1TU6 A;  1CPJ A;  1CB5 A;  4CZW A;  3PW3 A;  4AXM A;  1KHP A;  2OUL A;  3P5X A;  4KLB A;  4CDD B;  4YYU A;  1PIP A;  2GFO A;  1ATK A;  2G7Y A;  3NHE A;  1YAL A;  4YYS A;  1U5I A;  3S3R A;  2FRQ A;  3IV2 A;  2FUD A;  3N3K A;  1BY8 A;  3BPM A;  2YJ2 A;  3I3T A;  1DF0 A;  1NPZ A;  4MZO A;  2E02 A;  1TL9 A;  1YK7 A;  1YK8 A;  2CB5 A;  2R9F A;  3E1Z B;  1PE6 A;  4PP2 E;  3OF8 A;  2E01 A;  2G8J A;  3OVX A;  1SNK A;  2ATO A;  2BDL A;  2DC9 A;  4MZS A;  4XUI A;  4QRV A;  3BC3 A;  1TLO A;  2NQD B;  3C9E A;  2DCB A;  2DCA A;  1U9V A;  2P7U A;  1CV8 A;  4X6H A;  1ZIV A;  2XU5 A;  2AS8 A;  2P86 A;  4W5C A;  1PXV A;  2AUZ A;  1AIM A;  1AYU A;  1ME3 A;  1NB5 A;  3MHS A;  1MEG A;  1PAD A;  1DEU A;  1NQC A;  1X9Y A;  2R9N A;  4W4U A;  1PPO A;  2ACT A;  3CH3 X;  3K9M A;  4OEM A;  5J94 A;  2DZZ A;  4HWY A;  1THE A;  3QSD A;  2CIO A;  3O0U A;  3PDF A;  3CH2 X;  1BGO A;  3BPF A;  3HHA A;  4QRG A;  4FIP A;  1CS8 A;  2AUX A;  1FH0 A;  2HHN A;  2VHF A;  3V6E A;  2AIM A;  3P5U A;  2F1G A;  3RVX A;  2DJF B;  5F02 A;  4YYR A;  1GMY A;  3MTN A;  4BSQ A;  3KKU A;  3O1G A;  3WXF A;  2DC6 A;  2FT2 A;  1EWL A;  4OEL A;  4I07 A;  3IUT A;  2XU1 A;  2B1N A;  1AEC A;  1Y08 A;  2O6X A;  1KXR A;  4N4Z A;  1AU2 A;  2R9O A;  4XR7 A;  5EGW A;  4CDE B;  4FK5 A;  3N4C A;  1S4V A;  3HHI A;  1EWP A;  1F2C A;  3ZUA A;  4YYV A;  5A24 A;  3ERV A;  1PCI A;  2PRE A;  3BOW A;  5PAD A;  1U9X A;  3RVW A;  4W5B A;  2AVW A;  4QRX A;  4YYW A;  5FPW A;  2DCD A;  4DMY A;  1MEM A;  1MHW A;  3F75 A;  1CTE A;  3KFQ A;  2DJG B;  1CQD A;  2JQF R;  1PPP A;  4I04 A;  1PBH A;  3MHH A;  1F2A A;  3KW9 A;  3H6S A;  2YJB A;  5CHV A;  3GCB A;  2XU3 A;  4G54 A;  3H89 A;  1QXP A;  3IOQ A;  7PCK A;  2FTD A;  1MS6 A;  2WBF X;  2HH5 A;  4DMX A;  4I05 A;  4WA6 A;  2AU1 A;  4X6I A;  1AU0 A;  1GCB A;  3KWZ A;  2OP3 A;  2C0Y A;  3IMA A;  2IBI A;  3H7D A;  1POP A;  1AU4 A;  5JA7 A;  2NQG A;  5EF4 A;  4FJC A;  3CBJ A;  4P6G A;  5K16 A;  3WXE A;  3CBK A;  4Q8G A;  3D6S A;  6PAD A;  4P6E A;  4CDF B;  3H8B A;  2JQG R;  2XU4 A;  3OF9 A;  1YVB A;  1Q6K A;  3F5V A;  2NQI A;  4YVA A;  1VJV A;  4Q8H A;  1Y4H A;  1JQP A;  1KHQ A;  3MOR A;  4QH6 A;  4PP1 A;  1PPD A;  1MIR A;  3LXS A;  1BP4 A;  2YJC A;  3QT4 A;  1A6R A;  3V6C A;  1F29 A;  3AI8 A;  3H8C A;  2PAD A;  2ARY A;  5CVM A;  3P5W A;  4BQV A;  1U9W A;  2IPP B;  2R9M A;  2H7J A;  4YYQ A;  1QDQ A;  2PNS A;  2E03 A;  2AYN A;  4PAD A;  2HD5 A;  1EWM A;  3P5V A;  1ME4 A; 
#chains in the Genus database with same CATH topology
 1STF E;  3N3G A;  3RNV A;  2HWK A;  1SP4 B;  1O0E A;  3HD3 A;  1CVZ A;  2YJ8 A;  1HUC B;  1NL6 A;  3DF0 A;  3I06 A;  2G6D A;  4QBB A;  4RY2 A;  4BOQ A;  1EWO A;  2FO5 A;  3KSE A;  2P0R A;  2VHS A;  3USV A;  3U8E A;  1MDW A;  4X6J A;  4K7C A;  1YT7 A;  1QMY A;  3W31 A;  2G8E A;  1KFX L;  3B79 A;  3BCN A;  2FYE A;  4YV8 A;  1BQI A;  5CHT A;  2E00 A;  1AYV A;  1U9Q X;  4AXL A;  2GHU A;  3K24 A;  2FRA A;  1QOL A;  9PAP A;  3IFU A;  1PVJ A;  2BDZ A;  4BS5 A;  2FQ9 A;  2Y6E A;  3IHP A;  3WXG A;  1ITO A;  2J7Q C;  2PBH A;  3OIS A;  5JZE A;  2YJ9 A;  5CVN B;  1K3B B;  5JH3 A;  1ZCM A;  2DC7 A;  2AYO A;  2AGA A;  1NLJ A;  3PHU A;  2B1M A;  4PT5 A;  4ZUX U;  1GLO A;  2HXZ A;  3PSE A;  1F2B A;  3M99 A;  1XKG A;  1GEC E;  4BPV A;  2NQA A;  3S3Q A;  4PI3 A;  1ICF A;  3BBA A;  2F7D A;  1EF7 A;  3PNR A;  3KWB X;  1KFU L;  3PBH A;  4MI7 A;  4BS6 A;  3OQC A;  5CVO B;  2Y5B A;  1AYW A;  1NB3 A;  4N79 A;  3QJ3 A;  1VSN A;  3KX1 A;  3BWK A;  1IWD A;  4MSX A;  1CJL A;  4R3D A;  1CSB B;  3RVV A;  3HWN A;  1M6D A;  5E6J A;  2R6N A;  1PPN A;  2DZY A;  3PHW A;  3K8U A;  8PCH A;  2R9C A;  1AU3 A;  2DCC A;  4WUR A;  3IEJ A;  3TNX A;  2DC8 A;  2OZ2 A;  3B21 A;  3LFY A;  2BTW A;  3PHX A;  4CDC B;  3OVZ A;  4N8W A;  1TU6 A;  1CPJ A;  1CB5 A;  4CZW A;  4M0W A;  2DOS A;  3PW3 A;  4AXM A;  1KHP A;  2OUL A;  3P5X A;  4KLB A;  4CDD B;  4YYU A;  1PIP A;  2GFO A;  4A5U A;  1ATK A;  2G7Y A;  3NHE A;  1YAL A;  4YYS A;  1U5I A;  2FRQ A;  3IV2 A;  3S3R A;  2FUD A;  3N3K A;  1BY8 A;  3BPM A;  2YJ2 A;  3I3T A;  1DF0 A;  1NPZ A;  4MZO A;  2E02 A;  1TL9 A;  1YK7 A;  1YK8 A;  2CB5 A;  2R9F A;  3E1Z B;  1PE6 A;  4PP2 E;  2JTC A;  3MTV A;  3OF8 A;  2E01 A;  2G8J A;  4BOU A;  3OVX A;  1SNK A;  4IP3 A;  2ATO A;  2BDL A;  4IUM A;  2DC9 A;  4MZS A;  4XUI A;  4QRV A;  4XZX A;  3BC3 A;  1DKI A;  3E9S A;  1TLO A;  2NQD B;  3C9E A;  2DCB A;  2DCA A;  1U9V A;  2P7U A;  1CV8 A;  4X6H A;  3TRK A;  4BOZ A;  1ZIV A;  2XU5 A;  2AS8 A;  2BTW B;  2P86 A;  1PXV A;  4W5C A;  2AUZ A;  1AIM A;  1YZB A;  3W30 A;  1AYU A;  1ME3 A;  1NB5 A;  3MHS A;  4D8I A;  1MEG A;  1PAD A;  1DEU A;  2J7Q A;  1NQC A;  1X9Y A;  2R9N A;  4W4U A;  1PPO A;  2ACT A;  4D8B A;  3CH3 X;  3K9M A;  3PT2 A;  4OEM A;  5J94 A;  2DZZ A;  4HWY A;  1THE A;  3TMP A;  3QSD A;  2CIO A;  3O0U A;  3PDF A;  3CH2 X;  1BGO A;  3BPF A;  3HHA A;  4QRG A;  4FIP A;  1CS8 A;  2AUX A;  1FH0 A;  2HHN A;  2VHF A;  3BY4 A;  3V6E A;  2AIM A;  3P5U A;  2F1G A;  3RVX A;  2DJF B;  5F02 A;  3BB7 A;  4YYR A;  1GMY A;  3MTN A;  4BSQ A;  3KKU A;  3O1G A;  3WXF A;  2DC6 A;  2FT2 A;  1EWL A;  4OEL A;  4I07 A;  3IUT A;  2XU1 A;  2B1N A;  1AEC A;  1UKF A;  4P16 A;  1Y08 A;  2O6X A;  1KXR A;  4N4Z A;  1AU2 A;  2R9O A;  4MM3 B;  4XR7 A;  3ZNH A;  5EGW A;  4CDE B;  4FK5 A;  3N4C A;  1S4V A;  2FE8 A;  3HHI A;  1EWP A;  1F2C A;  3ZUA A;  4YYV A;  4OVZ A;  5A24 A;  3ERV A;  1PCI A;  2PRE A;  3BOW A;  5PAD A;  4ZTB A;  1U9X A;  3RVW A;  5EZS A;  4W5B A;  4BOP A;  4RNA A;  2AVW A;  4QRX A;  4YYW A;  5FPW A;  4REZ A;  2DCD A;  4DMY A;  5KO3 A;  1MEM A;  1MHW A;  3F75 A;  1CTE A;  3KFQ A;  4OW0 A;  2DJG B;  1CQD A;  2JQF R;  1PPP A;  4I04 A;  1PBH A;  3MHH A;  1F2A A;  3KW9 A;  3H6S A;  2YJB A;  5CHV A;  3GCB A;  2XU3 A;  2BU3 A;  4G54 A;  3H89 A;  1QXP A;  3IOQ A;  7PCK A;  2FTD A;  1MS6 A;  2WBF X;  2HH5 A;  4DMX A;  4I05 A;  4WA6 A;  2AU1 A;  4X6I A;  1AU0 A;  1GCB A;  3KWZ A;  2OP3 A;  2C0Y A;  4RF0 A;  3IMA A;  2IBI A;  3MJ5 A;  3H7D A;  1POP A;  1AU4 A;  5JA7 A;  2NQG A;  5EF4 A;  4FJC A;  3CBJ A;  4P6G A;  5K16 A;  3WXE A;  3CBK A;  4Q8G A;  3D6S A;  5EZQ A;  4OVZ B;  6PAD A;  4P6E A;  4CDF B;  3H8B A;  4RKX A;  2JQG R;  2XU4 A;  3OF9 A;  1YVB A;  1Q6K A;  3F5V A;  2NQI A;  4YVA A;  1VJV A;  4Q8H A;  3PRM A;  3O65 A;  1Y4H A;  1JQP A;  1KHQ A;  3MOR A;  4QH6 A;  3C0R A;  2JRI A;  4PP1 A;  3MP2 A;  1PPD A;  1MIR A;  1BP4 A;  2YJC A;  3LXS A;  3QT4 A;  1A6R A;  3V6C A;  1F29 A;  3AI8 A;  3H8C A;  4HXD B;  2PAD A;  4BOS A;  2ARY A;  5CVM A;  4RF1 A;  3PRP A;  4D8E A;  3P5W A;  4BQV A;  1U9W A;  2IPP B;  2R9M A;  2Z84 A;  2H7J A;  4GUA A;  4YYQ A;  1QDQ A;  2PNS A;  2E03 A;  2AYN A;  2UZJ A;  4PAD A;  2HD5 A;  1EWM A;  3P5V A;  1ME4 A; 
#chains in the Genus database with same CATH homology
 1STF E;  3N3G A;  1SP4 B;  1O0E A;  3HD3 A;  1CVZ A;  2YJ8 A;  1HUC B;  1NL6 A;  3DF0 A;  3I06 A;  2G6D A;  4QBB A;  4RY2 A;  1W4T A;  1EWO A;  2FO5 A;  3KSE A;  2P0R A;  2VHS A;  3USV A;  3U8E A;  1MDW A;  4X6J A;  4K7C A;  1YT7 A;  1QMY A;  2G8E A;  1KFX L;  3B79 A;  3BCN A;  2FYE A;  4YV8 A;  1BQI A;  5CHT A;  2E00 A;  1AYV A;  1U9Q X;  4AXL A;  2GHU A;  3K24 A;  2FRA A;  1QOL A;  9PAP A;  2BDZ A;  4BS5 A;  2FQ9 A;  2Y6E A;  3IHP A;  3WXG A;  1ITO A;  2PBH A;  3OIS A;  2YJ9 A;  5CVN B;  1K3B B;  5JH3 A;  1ZCM A;  2DC7 A;  2AYO A;  1NLJ A;  4ZUX U;  2B1M A;  1GLO A;  2HXZ A;  1F2B A;  3M99 A;  1XKG A;  1GEC E;  4BPV A;  2NQA A;  3S3Q A;  4PI3 A;  1ICF A;  2F7D A;  1EF7 A;  3PNR A;  3KWB X;  1KFU L;  3PBH A;  4BS6 A;  5CVO B;  2Y5B A;  1AYW A;  1NB3 A;  4N79 A;  3QJ3 A;  1VSN A;  2BSZ A;  3KX1 A;  3BWK A;  1IWD A;  4MSX A;  1CJL A;  1CSB B;  3RVV A;  3HWN A;  1M6D A;  2R6N A;  1PPN A;  2VFC A;  2DZY A;  3K8U A;  8PCH A;  2R9C A;  1AU3 A;  2DCC A;  3IEJ A;  3TNX A;  2DC8 A;  2OZ2 A;  3LFY A;  4CDC B;  3OVZ A;  4N8W A;  1TU6 A;  1CPJ A;  1CB5 A;  4CZW A;  3PW3 A;  4AXM A;  1KHP A;  2OUL A;  3P5X A;  1E2T A;  4KLB A;  4CDD B;  4C5P A;  1PIP A;  2GFO A;  4YYU A;  1ATK A;  2G7Y A;  3NHE A;  1YAL A;  4YYS A;  1U5I A;  2FRQ A;  3IV2 A;  3S3R A;  2FUD A;  3N3K A;  1BY8 A;  3BPM A;  2YJ2 A;  3I3T A;  1DF0 A;  1NPZ A;  4MZO A;  2E02 A;  1TL9 A;  1YK7 A;  1YK8 A;  2CB5 A;  2R9F A;  3E1Z B;  1PE6 A;  2VFB A;  4PP2 E;  4BGF A;  3OF8 A;  2E01 A;  2G8J A;  3OVX A;  1SNK A;  2ATO A;  2BDL A;  2DC9 A;  4MZS A;  4XUI A;  4QRV A;  3BC3 A;  1TLO A;  2NQD B;  3C9E A;  2DCB A;  2DCA A;  1U9V A;  2P7U A;  1CV8 A;  4X6H A;  1ZIV A;  2XU5 A;  2AS8 A;  4GUZ A;  2P86 A;  4W5C A;  1PXV A;  2AUZ A;  1AIM A;  1AYU A;  1ME3 A;  1NB5 A;  3MHS A;  1MEG A;  1PAD A;  1DEU A;  1NQC A;  1X9Y A;  2R9N A;  4W4U A;  1PPO A;  2ACT A;  3CH3 X;  3K9M A;  4OEM A;  5J94 A;  2DZZ A;  4HWY A;  1THE A;  3QSD A;  2CIO A;  3O0U A;  3PDF A;  3CH2 X;  1BGO A;  3BPF A;  3HHA A;  4QRG A;  4FIP A;  1CS8 A;  2AUX A;  1FH0 A;  2HHN A;  2VHF A;  3V6E A;  2AIM A;  3P5U A;  1W6F A;  2F1G A;  3RVX A;  2DJF B;  5F02 A;  4YYR A;  1GMY A;  3MTN A;  4BSQ A;  3KKU A;  3O1G A;  3WXF A;  2DC6 A;  2FT2 A;  1EWL A;  4OEL A;  4I07 A;  3IUT A;  2XU1 A;  2B1N A;  1AEC A;  1Y08 A;  2O6X A;  1KXR A;  4N4Z A;  1AU2 A;  2R9O A;  4XR7 A;  5EGW A;  4CDE B;  4FK5 A;  3N4C A;  1S4V A;  3HHI A;  1EWP A;  1F2C A;  3ZUA A;  4YYV A;  4NV7 A;  5A24 A;  3ERV A;  1PCI A;  2PRE A;  3BOW A;  5PAD A;  1U9X A;  3RVW A;  4W5B A;  2AVW A;  4QRX A;  4YYW A;  5FPW A;  2DCD A;  4DMY A;  3LTW A;  1GX3 A;  1MEM A;  1MHW A;  3F75 A;  1CTE A;  3KFQ A;  4B55 A;  2DJG B;  1CQD A;  2JQF R;  1PPP A;  4I04 A;  1PBH A;  3MHH A;  1F2A A;  3KW9 A;  3H6S A;  2YJB A;  4NV8 A;  5CHV A;  3GCB A;  2XU3 A;  4G54 A;  3H89 A;  1QXP A;  3IOQ A;  7PCK A;  2FTD A;  1MS6 A;  2WBF X;  2HH5 A;  4DMX A;  4I05 A;  4WA6 A;  2AU1 A;  4X6I A;  1AU0 A;  1GCB A;  3KWZ A;  2OP3 A;  2C0Y A;  3IMA A;  2IBI A;  3H7D A;  1POP A;  3D9W A;  1AU4 A;  5JA7 A;  2NQG A;  5EF4 A;  4FJC A;  3CBJ A;  4P6G A;  5K16 A;  3WXE A;  3CBK A;  4Q8G A;  3D6S A;  6PAD A;  4P6E A;  4CDF B;  3H8B A;  2JQG R;  2XU4 A;  3OF9 A;  1YVB A;  1Q6K A;  3F5V A;  2NQI A;  4YVA A;  1VJV A;  1W5R A;  4Q8H A;  1Y4H A;  1JQP A;  1KHQ A;  3MOR A;  4QH6 A;  4PP1 A;  1PPD A;  1MIR A;  3LXS A;  1BP4 A;  2YJC A;  3QT4 A;  1A6R A;  3V6C A;  1F29 A;  3AI8 A;  3H8C A;  2PAD A;  2ARY A;  5CVM A;  3P5W A;  4BQV A;  1U9W A;  2IPP B;  2R9M A;  2H7J A;  4YYQ A;  1QDQ A;  2PNS A;  2E03 A;  2AYN A;  4PAD A;  2HD5 A;  1EWM A;  3P5V A;  1ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...