2FYEA

Mutant human cathepsin s with irreversible inhibitor cra-14013
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTKKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSAYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S preproprotein
publication title Mutant Human Cathepsin S with irreversible inhibitor CRA-14013
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fyeA00
1MDWA 2OP3A 1AU4A 2G7YA 1PE6A 1CB5A 4MZOA 2NQGA 3HWNA 4Q8HA 4DMXA 2CIOA 3RVXA 2HD5A 1GLOA 1PIPA 1KFUL 1NQCA 3PNRA 1YVBA 2R9CA 1BQIA 2NQAA 4Q8GA 2Y6EA 4I07A 3AI8A 1AU0A 2JQFR 3BOWA 1NLJA 1HUCB 1U5IA 3LXSA 1PADA 3GCBA 2E03A 3D6SA 1S4VA 1VJVA 3S3RA 2JQGR 3CH2X 2IPPB 1YK7A 1FH0A 3WXGA 4BSQA 1AYVA 1QMYA 2HH5A 5F02A 1ICFA 2YJ2A 4CDEB 3F75A 8PCHA 4N4ZA 2E02A 2XU1A 2DC6A 1DEUA 1STFE 4PADA 2FO5A 1KXRA 3BWKA 2OZ2A 3CBKA 1PPPA 5CHTA 3QJ3A 4W4UA 2DCAA 3IHPA 2HHNA 2PREA 3MHSA 3BC3A 4G54A 2XU3A 3P5UA 1EF7A 1YT7A 1AU3A 3OF8A 1PBHA 4BS5A 1BP4A 3OVXA 4YYQA 3PDFA 1MIRA 1F2BA 1PXVA 1QDQA 1U9VA 2H7JA 4AXMA 4CDCB 2DCCA 1MS6A 1NB5A 2F7DA 3RVVA 1Y4HA 3N4CA 1M6DA 3IV2A 2XU4A 4OEMA 2DCDA 3RVWA 4N79A 2ATOA 4P6EA 2C0YA 1KHQA 1AIMA 3TNXA 3H6SA 3KWZA 2AUZA 1AECA 2AYOA 2HXZA 4DMYA 2GFOA 1PPDA 3KKUA 1VSNA 4X6IA 2YJ8A 3O0UA 2G8JA 5FPWA 2YJ9A 4FK5A 2ARYA 2DCBA 4YVAA 2AU1A 2DZYA 4AXLA 1BY8A 3WXEA 1ZCMA 3BCNA 3IOQA 2FQ9A 1MEMA 1U9WA 1GECE 3N3GA 4RY2A 5JH3A 3MORA 4KLBA 1KHPA 1X9YA 3K9MA 3KX1A 1YK8A 2DJGB 3B79A 4BS6A 4YYVA 2YJBA 1ATKA 1EWPA 2AIMA 5EGWA 3IEJA 3K8UA 2XU5A 4PP1A 3N3KA 2YJCA 1EWLA 4FJCA 3QT4A 3OVZA 3OF9A 3KSEA 2P0RA 3IUTA 3C9EA 3H89A 5CVNB 2GHUA 2ACTA 7PCKA 4YYUA 1KFXL 2R9MA 3CBJA 3KWBX 4PI3A 4BPVA 4CDDB 2E01A 2NQIA 1U9QX 3BPFA 3O1GA 3DF0A 2NQDB 2FTDA 4P6GA 2WBFX 1AYUA 4QH6A 5CVMA 2AVWA 1JQPA 3V6EA 3PW3A 1PPNA 4QBBA 3I3TA 2AS8A 2G6DA 4QRXA 1A6RA 4WA6A 3H8BA 4K7CA 3HHAA 4ZUXU 1F2CA 1SP4B 3H7DA 2P7UA 1NL6A 4OELA 2DC8A 1AU2A 1ME3A 1DF0A 2DC7A 3MTNA 3S3QA 3P5XA 2OULA 3M99A 3NHEA 2Y5BA 2FRQA 3USVA 2FT2A 1GMYA 1GCBA 5EF4A 2PBHA 5CVOB 3V6CA 1NPZA 3H8CA 2AUXA 3K24A 1CVZA 1CQDA 1CPJA 1K3BB 3LFYA 3I06A 5PADA 2F1GA 3P5VA 4W5BA 4QRGA 1MEGA 5JA7A 1CJLA 4YYWA 2CB5A 3ERVA 3F5VA 1ITOA 1EWOA 1YALA 2IBIA 2VHSA 2FYEA 1CS8A 2O6XA 2R9OA 4MZSA 1AYWA 1QOLA 1CV8A 4QRVA 5K16A 1QXPA 1BGOA 2R9NA 3HD3A 3ZUAA 1IWDA 3QSDA 4X6HA 2AYNA 1Y08A 2P86A 1TU6A 2DC9A 2BDZA 1SNKA 1PPOA 2FRAA 4YV8A 1CSBB 2FUDA 2DJFB 4N8WA 3U8EA 4I04A 4FIPA 6PADA 5A24A 1Q6KA 4XUIA 4BQVA 2R9FA 3P5WA 1NB3A 1CTEA 3IMAA 4CDFB 3KFQA 4PP2E 3OISA 5CHVA 1MHWA 3PBHA 2B1NA 3BPMA 2R6NA 2E00A 9PAPA 3MHHA 3WXFA 1PCIA 4HWYA 1THEA 1XKGA 2BDLA 2B1MA 1TL9A 1POPA 4W5CA 3KW9A 4YYSA 1TLOA 1U9XA 4XR7A 4YYRA 2PNSA 1F29A 1ZIVA 4CZWA 3E1ZB 2G8EA 4I05A 4MSXA 3HHIA 1F2AA 1O0EA 1EWMA 1ME4A 2DZZA 2VHFA 5J94A 3CH3X 2PADA 4X6JA
chains in the Genus database with same CATH superfamily
1MDWA 4WURA 2OP3A 1AU4A 4IUMA 2G7YA 5E6JA 1PE6A 1CB5A 4MZOA 2NQGA 3HWNA 4Q8HA 4DMXA 1YZBA 2CIOA 3RVXA 2HD5A 1GLOA 1PIPA 1KFUL 1NQCA 3PNRA 1YVBA 2R9CA 1BQIA 2NQAA 4Q8GA 2Y6EA 4I07A 3AI8A 1AU0A 2JQFR 3BOWA 1NLJA 1HUCB 1U5IA 3LXSA 1PADA 3GCBA 2E03A 3D6SA 1S4VA 1VJVA 3S3RA 2JQGR 4OW0A 3CH2X 2IPPB 1YK7A 4MM3B 1FH0A 3WXGA 4BSQA 1AYVA 1QMYA 2HH5A 3ZNHA 5F02A 1ICFA 2YJ2A 4HXDB 4CDEB 3F75A 8PCHA 4N4ZA 4XZXA 2E02A 2XU1A 2DC6A 1DEUA 1STFE 1UKFA 4PADA 2FO5A 2JRIA 1KXRA 3BWKA 2OZ2A 3CBKA 1PPPA 5CHTA 4BOSA 2J7QA 3QJ3A 4W4UA 4RKXA 2DCAA 3IHPA 2Z84A 2HHNA 2PREA 3MHSA 3BC3A 4G54A 2XU3A 3P5UA 1EF7A 1YT7A 1AU3A 3OF8A 1PBHA 4BS5A 1BP4A 3OVXA 4YYQA 3PDFA 1MIRA 1F2BA 1PXVA 3E9SA 1QDQA 1U9VA 2H7JA 4REZA 4AXMA 5EZQA 4CDCB 2DCCA 1MS6A 1NB5A 2F7DA 3RVVA 1Y4HA 3N4CA 1M6DA 3IV2A 2HWKA 2XU4A 4D8EA 3PSEA 4OEMA 2JTCA 2DCDA 3RVWA 4N79A 2ATOA 2BTWA 4P6EA 2C0YA 3TMPA 1KHQA 1AIMA 3TNXA 3H6SA 3KWZA 2AUZA 1AECA 2AYOA 2HXZA 4DMYA 4P16A 2GFOA 1PPDA 3MJ5A 3KKUA 1VSNA 4X6IA 2YJ8A 3O0UA 4RF1A 2G8JA 5FPWA 2YJ9A 4FK5A 2ARYA 2DCBA 4YVAA 2AU1A 2DZYA 4M0WA 4AXLA 1BY8A 4D8BA 3WXEA 1ZCMA 2DOSA 2J7QC 3BCNA 3IOQA 2FQ9A 1MEMA 1U9WA 1GECE 3N3GA 4GUAA 4BOQA 4ZTBA 4RY2A 5JH3A 3MORA 4KLBA 4OVZA 1KHPA 1X9YA 3K9MA 3KX1A 1YK8A 2DJGB 3B79A 4BS6A 4YYVA 2YJBA 1ATKA 1EWPA 2AIMA 5EGWA 3IEJA 3K8UA 2XU5A 1PVJA 4PP1A 3N3KA 2YJCA 1EWLA 4FJCA 3QT4A 3OVZA 3OF9A 3RNVA 3KSEA 2P0RA 3IUTA 3OQCA 3C9EA 3H89A 5CVNB 2GHUA 2ACTA 7PCKA 4YYUA 1KFXL 2R9MA 3CBJA 3KWBX 4PI3A 4A5UA 4BPVA 4CDDB 2E01A 2NQIA 1U9QX 3O65A 2BU3A 3BPFA 3PHWA 3O1GA 3DF0A 2NQDB 2FTDA 4P6GA 4MI7A 2WBFX 1AYUA 4QH6A 4RF0A 2AVWA 1JQPA 5CVMA 3V6EA 3PW3A 1PPNA 4QBBA 3I3TA 2AS8A 2G6DA 4QRXA 1A6RA 4WA6A 3H8BA 4K7CA 3HHAA 4BOPA 4ZUXU 1F2CA 1SP4B 2AGAA 3H7DA 2P7UA 1NL6A 3PHUA 3B21A 3PRPA 4OELA 2UZJA 2DC8A 1AU2A 1ME3A 1DF0A 5KO3A 2DC7A 4D8IA 3MTNA 3S3QA 3P5XA 2OULA 3M99A 1DKIA 3NHEA 3C0RA 3PHXA 2Y5BA 2FRQA 3USVA 2FT2A 3TRKA 1GMYA 1GCBA 5EF4A 2PBHA 5CVOB 3V6CA 4OVZB 1NPZA 3H8CA 3W31A 2AUXA 3K24A 1CVZA 3BY4A 1CQDA 1CPJA 1K3BB 3LFYA 3I06A 5PADA 2F1GA 3P5VA 4W5BA 4QRGA 1MEGA 5JA7A 1CJLA 4YYWA 2CB5A 3ERVA 3F5VA 1ITOA 1EWOA 1YALA 2IBIA 2VHSA 3PT2A 2FYEA 1CS8A 2O6XA 2R9OA 4R3DA 3PRMA 5JZEA 4MZSA 1AYWA 1QOLA 1CV8A 4QRVA 5K16A 1QXPA 1BGOA 2R9NA 3HD3A 3ZUAA 1IWDA 3QSDA 4X6HA 4IP3A 2AYNA 1Y08A 2P86A 1TU6A 2DC9A 2BDZA 1SNKA 4PT5A 1PPOA 2FRAA 4YV8A 1CSBB 3BB7A 2FUDA 2DJFB 4N8WA 2BTWB 3U8EA 4I04A 4BOZA 5EZSA 4FIPA 6PADA 5A24A 1Q6KA 4XUIA 4BQVA 2R9FA 4BOUA 3P5WA 1NB3A 1CTEA 3IMAA 4CDFB 3KFQA 4PP2E 3MTVA 3OISA 5CHVA 1MHWA 3PBHA 2B1NA 3BPMA 2R6NA 3MP2A 2E00A 9PAPA 3MHHA 3WXFA 3W30A 3IFUA 1PCIA 4HWYA 1THEA 1XKGA 2BDLA 2B1MA 1TL9A 1POPA 4W5CA 3KW9A 4YYSA 1TLOA 1U9XA 4XR7A 4YYRA 2PNSA 1F29A 4RNAA 1ZIVA 3BBAA 4CZWA 3E1ZB 2G8EA 4I05A 4MSXA 3HHIA 1F2AA 1O0EA 1EWMA 1ME4A 2DZZA 2VHFA 2FE8A 5J94A 3CH3X 2PADA 4X6JA
chains in the Genus database with same CATH topology
1MDWA 2OP3A 1AU4A 2G7YA 1PE6A 1CB5A 4MZOA 2NQGA 3HWNA 4Q8HA 4DMXA 2CIOA 3RVXA 2HD5A 1GLOA 1PIPA 1KFUL 1NQCA 3PNRA 1YVBA 2R9CA 1BQIA 2NQAA 4Q8GA 2Y6EA 4I07A 3AI8A 1AU0A 2JQFR 3BOWA 1NLJA 1HUCB 1U5IA 3LXSA 1PADA 3GCBA 2E03A 3D6SA 1S4VA 1VJVA 3S3RA 2JQGR 3CH2X 2IPPB 1YK7A 1FH0A 3D9WA 3WXGA 4BSQA 1AYVA 1QMYA 2HH5A 5F02A 1ICFA 2YJ2A 4CDEB 3F75A 8PCHA 4N4ZA 2E02A 2XU1A 2DC6A 1DEUA 1STFE 4PADA 2FO5A 1KXRA 3BWKA 2OZ2A 3CBKA 1PPPA 5CHTA 3QJ3A 4W4UA 2DCAA 3LTWA 3IHPA 2HHNA 2PREA 3MHSA 3BC3A 4G54A 2XU3A 3P5UA 1EF7A 1YT7A 1AU3A 3OF8A 1PBHA 4BS5A 1BP4A 3OVXA 4YYQA 3PDFA 1MIRA 1F2BA 1PXVA 2VFCA 1QDQA 1U9VA 2H7JA 4AXMA 4CDCB 2DCCA 1MS6A 1NB5A 2F7DA 3RVVA 1Y4HA 3N4CA 1M6DA 3IV2A 2XU4A 4OEMA 1GX3A 4C5PA 2DCDA 3RVWA 4N79A 2ATOA 4P6EA 2C0YA 1KHQA 1AIMA 3TNXA 3H6SA 3KWZA 2AUZA 1AECA 2AYOA 2HXZA 4DMYA 2GFOA 1PPDA 3KKUA 1VSNA 4X6IA 2YJ8A 3O0UA 2G8JA 5FPWA 2YJ9A 4FK5A 2ARYA 2DCBA 4YVAA 2AU1A 2DZYA 4AXLA 1BY8A 3WXEA 1ZCMA 4GUZA 3BCNA 3IOQA 2FQ9A 1MEMA 1U9WA 1GECE 3N3GA 4RY2A 5JH3A 4KLBA 3MORA 1KHPA 1X9YA 3K9MA 3KX1A 1YK8A 2DJGB 3B79A 4BS6A 4YYVA 2YJBA 1ATKA 1EWPA 2AIMA 5EGWA 3IEJA 3K8UA 1W5RA 2XU5A 4PP1A 3N3KA 2YJCA 1EWLA 4FJCA 3QT4A 3OVZA 3OF9A 3KSEA 2P0RA 3IUTA 3C9EA 3H89A 5CVNB 4NV8A 2GHUA 2ACTA 7PCKA 4YYUA 1KFXL 2R9MA 3CBJA 3KWBX 4PI3A 4BPVA 4CDDB 2E01A 2NQIA 1U9QX 3BPFA 3O1GA 3DF0A 2NQDB 2FTDA 4P6GA 2WBFX 1AYUA 4QH6A 5CVMA 2AVWA 1JQPA 3V6EA 3PW3A 1W6FA 4B55A 1PPNA 4QBBA 3I3TA 2AS8A 2G6DA 4QRXA 1A6RA 4WA6A 3H8BA 4K7CA 3HHAA 4ZUXU 1F2CA 1SP4B 3H7DA 2P7UA 1NL6A 4OELA 2VFBA 1W4TA 2DC8A 1AU2A 1ME3A 1DF0A 2DC7A 3MTNA 3S3QA 3P5XA 2OULA 3M99A 3NHEA 2Y5BA 2FRQA 3USVA 2FT2A 1GMYA 1GCBA 5EF4A 2PBHA 5CVOB 3V6CA 1NPZA 3H8CA 2AUXA 3K24A 1CVZA 1CQDA 1CPJA 1K3BB 3LFYA 3I06A 5PADA 2F1GA 3P5VA 4W5BA 4QRGA 1MEGA 5JA7A 1CJLA 4YYWA 2CB5A 3ERVA 3F5VA 1ITOA 1EWOA 1YALA 2IBIA 2VHSA 2FYEA 1CS8A 2O6XA 2R9OA 4MZSA 1AYWA 1QOLA 1CV8A 4QRVA 5K16A 1QXPA 1BGOA 2R9NA 3HD3A 3ZUAA 1IWDA 3QSDA 4X6HA 2AYNA 1Y08A 2P86A 1TU6A 2DC9A 2BDZA 2BSZA 1SNKA 1PPOA 4NV7A 2FRAA 4YV8A 1CSBB 2FUDA 2DJFB 4N8WA 4BGFA 3U8EA 4I04A 4FIPA 6PADA 5A24A 1Q6KA 4XUIA 4BQVA 2R9FA 3P5WA 1NB3A 1CTEA 3IMAA 4CDFB 3KFQA 4PP2E 3OISA 5CHVA 1MHWA 3PBHA 2B1NA 3BPMA 2R6NA 2E00A 9PAPA 3MHHA 3WXFA 1PCIA 4HWYA 1THEA 1XKGA 2BDLA 2B1MA 1TL9A 1POPA 4W5CA 1E2TA 3KW9A 4YYSA 1TLOA 1U9XA 4XR7A 4YYRA 2PNSA 1F29A 1ZIVA 4CZWA 3E1ZB 2G8EA 4I05A 4MSXA 3HHIA 1F2AA 1O0EA 1EWMA 1ME4A 2DZZA 2VHFA 5J94A 3CH3X 2PADA 4X6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDW A;  2OP3 A;  1AU4 A;  2G7Y A;  1PE6 A;  1CB5 A;  4MZO A;  2NQG A;  3HWN A;  4Q8H A;  4DMX A;  2CIO A;  3RVX A;  2HD5 A;  1GLO A;  1PIP A;  1KFU L;  1NQC A;  3PNR A;  1YVB A;  2R9C A;  1BQI A;  2NQA A;  4Q8G A;  2Y6E A;  4I07 A;  3AI8 A;  1AU0 A;  2JQF R;  3BOW A;  1NLJ A;  1HUC B;  1U5I A;  3LXS A;  1PAD A;  3GCB A;  2E03 A;  3D6S A;  1S4V A;  1VJV A;  3S3R A;  2JQG R;  3CH2 X;  2IPP B;  1YK7 A;  1FH0 A;  3WXG A;  4BSQ A;  1AYV A;  1QMY A;  2HH5 A;  5F02 A;  1ICF A;  2YJ2 A;  4CDE B;  3F75 A;  8PCH A;  4N4Z A;  2E02 A;  2XU1 A;  2DC6 A;  1DEU A;  1STF E;  4PAD A;  2FO5 A;  1KXR A;  3BWK A;  2OZ2 A;  3CBK A;  1PPP A;  5CHT A;  3QJ3 A;  4W4U A;  2DCA A;  3IHP A;  2HHN A;  2PRE A;  3MHS A;  3BC3 A;  4G54 A;  2XU3 A;  3P5U A;  1EF7 A;  1YT7 A;  1AU3 A;  3OF8 A;  1PBH A;  4BS5 A;  1BP4 A;  3OVX A;  4YYQ A;  3PDF A;  1MIR A;  1F2B A;  1PXV A;  1QDQ A;  1U9V A;  2H7J A;  4AXM A;  4CDC B;  2DCC A;  1MS6 A;  1NB5 A;  2F7D A;  3RVV A;  1Y4H A;  3N4C A;  1M6D A;  3IV2 A;  2XU4 A;  4OEM A;  2DCD A;  3RVW A;  4N79 A;  2ATO A;  4P6E A;  2C0Y A;  1KHQ A;  1AIM A;  3TNX A;  3H6S A;  3KWZ A;  2AUZ A;  1AEC A;  2AYO A;  2HXZ A;  4DMY A;  2GFO A;  1PPD A;  3KKU A;  1VSN A;  4X6I A;  2YJ8 A;  3O0U A;  2G8J A;  5FPW A;  2YJ9 A;  4FK5 A;  2ARY A;  2DCB A;  4YVA A;  2AU1 A;  2DZY A;  4AXL A;  1BY8 A;  3WXE A;  1ZCM A;  3BCN A;  3IOQ A;  2FQ9 A;  1MEM A;  1U9W A;  1GEC E;  3N3G A;  4RY2 A;  5JH3 A;  3MOR A;  4KLB A;  1KHP A;  1X9Y A;  3K9M A;  3KX1 A;  1YK8 A;  2DJG B;  3B79 A;  4BS6 A;  4YYV A;  2YJB A;  1ATK A;  1EWP A;  2AIM A;  5EGW A;  3IEJ A;  3K8U A;  2XU5 A;  4PP1 A;  3N3K A;  2YJC A;  1EWL A;  4FJC A;  3QT4 A;  3OVZ A;  3OF9 A;  3KSE A;  2P0R A;  3IUT A;  3C9E A;  3H89 A;  5CVN B;  2GHU A;  2ACT A;  7PCK A;  4YYU A;  1KFX L;  2R9M A;  3CBJ A;  3KWB X;  4PI3 A;  4BPV A;  4CDD B;  2E01 A;  2NQI A;  1U9Q X;  3BPF A;  3O1G A;  3DF0 A;  2NQD B;  2FTD A;  4P6G A;  2WBF X;  1AYU A;  4QH6 A;  5CVM A;  2AVW A;  1JQP A;  3V6E A;  3PW3 A;  1PPN A;  4QBB A;  3I3T A;  2AS8 A;  2G6D A;  4QRX A;  1A6R A;  4WA6 A;  3H8B A;  4K7C A;  3HHA A;  4ZUX U;  1F2C A;  1SP4 B;  3H7D A;  2P7U A;  1NL6 A;  4OEL A;  2DC8 A;  1AU2 A;  1ME3 A;  1DF0 A;  2DC7 A;  3MTN A;  3S3Q A;  3P5X A;  2OUL A;  3M99 A;  3NHE A;  2Y5B A;  2FRQ A;  3USV A;  2FT2 A;  1GMY A;  1GCB A;  5EF4 A;  2PBH A;  5CVO B;  3V6C A;  1NPZ A;  3H8C A;  2AUX A;  3K24 A;  1CVZ A;  1CQD A;  1CPJ A;  1K3B B;  3LFY A;  3I06 A;  5PAD A;  2F1G A;  3P5V A;  4W5B A;  4QRG A;  1MEG A;  5JA7 A;  1CJL A;  4YYW A;  2CB5 A;  3ERV A;  3F5V A;  1ITO A;  1EWO A;  1YAL A;  2IBI A;  2VHS A;  2FYE A;  1CS8 A;  2O6X A;  2R9O A;  4MZS A;  1AYW A;  1QOL A;  1CV8 A;  4QRV A;  5K16 A;  1QXP A;  1BGO A;  2R9N A;  3HD3 A;  3ZUA A;  1IWD A;  3QSD A;  4X6H A;  2AYN A;  1Y08 A;  2P86 A;  1TU6 A;  2DC9 A;  2BDZ A;  1SNK A;  1PPO A;  2FRA A;  4YV8 A;  1CSB B;  2FUD A;  2DJF B;  4N8W A;  3U8E A;  4I04 A;  4FIP A;  6PAD A;  5A24 A;  1Q6K A;  4XUI A;  4BQV A;  2R9F A;  3P5W A;  1NB3 A;  1CTE A;  3IMA A;  4CDF B;  3KFQ A;  4PP2 E;  3OIS A;  5CHV A;  1MHW A;  3PBH A;  2B1N A;  3BPM A;  2R6N A;  2E00 A;  9PAP A;  3MHH A;  3WXF A;  1PCI A;  4HWY A;  1THE A;  1XKG A;  2BDL A;  2B1M A;  1TL9 A;  1POP A;  4W5C A;  3KW9 A;  4YYS A;  1TLO A;  1U9X A;  4XR7 A;  4YYR A;  2PNS A;  1F29 A;  1ZIV A;  4CZW A;  3E1Z B;  2G8E A;  4I05 A;  4MSX A;  3HHI A;  1F2A A;  1O0E A;  1EWM A;  1ME4 A;  2DZZ A;  2VHF A;  5J94 A;  3CH3 X;  2PAD A;  4X6J A; 
#chains in the Genus database with same CATH topology
 1MDW A;  4WUR A;  2OP3 A;  1AU4 A;  4IUM A;  2G7Y A;  5E6J A;  1PE6 A;  1CB5 A;  4MZO A;  2NQG A;  3HWN A;  4Q8H A;  4DMX A;  1YZB A;  2CIO A;  3RVX A;  2HD5 A;  1GLO A;  1PIP A;  1KFU L;  1NQC A;  3PNR A;  1YVB A;  2R9C A;  1BQI A;  2NQA A;  4Q8G A;  2Y6E A;  4I07 A;  3AI8 A;  1AU0 A;  2JQF R;  3BOW A;  1NLJ A;  1HUC B;  1U5I A;  3LXS A;  1PAD A;  3GCB A;  2E03 A;  3D6S A;  1S4V A;  1VJV A;  3S3R A;  2JQG R;  4OW0 A;  3CH2 X;  2IPP B;  1YK7 A;  4MM3 B;  1FH0 A;  3WXG A;  4BSQ A;  1AYV A;  1QMY A;  2HH5 A;  3ZNH A;  5F02 A;  1ICF A;  2YJ2 A;  4HXD B;  4CDE B;  3F75 A;  8PCH A;  4N4Z A;  4XZX A;  2E02 A;  2XU1 A;  2DC6 A;  1DEU A;  1STF E;  1UKF A;  4PAD A;  2FO5 A;  2JRI A;  1KXR A;  3BWK A;  2OZ2 A;  3CBK A;  1PPP A;  5CHT A;  4BOS A;  2J7Q A;  3QJ3 A;  4W4U A;  4RKX A;  2DCA A;  3IHP A;  2Z84 A;  2HHN A;  2PRE A;  3MHS A;  3BC3 A;  4G54 A;  2XU3 A;  3P5U A;  1EF7 A;  1YT7 A;  1AU3 A;  3OF8 A;  1PBH A;  4BS5 A;  1BP4 A;  3OVX A;  4YYQ A;  3PDF A;  1MIR A;  1F2B A;  1PXV A;  3E9S A;  1QDQ A;  1U9V A;  2H7J A;  4REZ A;  4AXM A;  5EZQ A;  4CDC B;  2DCC A;  1MS6 A;  1NB5 A;  2F7D A;  3RVV A;  1Y4H A;  3N4C A;  1M6D A;  3IV2 A;  2HWK A;  2XU4 A;  4D8E A;  3PSE A;  4OEM A;  2JTC A;  2DCD A;  3RVW A;  4N79 A;  2ATO A;  2BTW A;  4P6E A;  2C0Y A;  3TMP A;  1KHQ A;  1AIM A;  3TNX A;  3H6S A;  3KWZ A;  2AUZ A;  1AEC A;  2AYO A;  2HXZ A;  4DMY A;  4P16 A;  2GFO A;  1PPD A;  3MJ5 A;  3KKU A;  1VSN A;  4X6I A;  2YJ8 A;  3O0U A;  4RF1 A;  2G8J A;  5FPW A;  2YJ9 A;  4FK5 A;  2ARY A;  2DCB A;  4YVA A;  2AU1 A;  2DZY A;  4M0W A;  4AXL A;  1BY8 A;  4D8B A;  3WXE A;  1ZCM A;  2DOS A;  2J7Q C;  3BCN A;  3IOQ A;  2FQ9 A;  1MEM A;  1U9W A;  1GEC E;  3N3G A;  4GUA A;  4BOQ A;  4ZTB A;  4RY2 A;  5JH3 A;  3MOR A;  4KLB A;  4OVZ A;  1KHP A;  1X9Y A;  3K9M A;  3KX1 A;  1YK8 A;  2DJG B;  3B79 A;  4BS6 A;  4YYV A;  2YJB A;  1ATK A;  1EWP A;  2AIM A;  5EGW A;  3IEJ A;  3K8U A;  2XU5 A;  1PVJ A;  4PP1 A;  3N3K A;  2YJC A;  1EWL A;  4FJC A;  3QT4 A;  3OVZ A;  3OF9 A;  3RNV A;  3KSE A;  2P0R A;  3IUT A;  3OQC A;  3C9E A;  3H89 A;  5CVN B;  2GHU A;  2ACT A;  7PCK A;  4YYU A;  1KFX L;  2R9M A;  3CBJ A;  3KWB X;  4PI3 A;  4A5U A;  4BPV A;  4CDD B;  2E01 A;  2NQI A;  1U9Q X;  3O65 A;  2BU3 A;  3BPF A;  3PHW A;  3O1G A;  3DF0 A;  2NQD B;  2FTD A;  4P6G A;  4MI7 A;  2WBF X;  1AYU A;  4QH6 A;  4RF0 A;  2AVW A;  1JQP A;  5CVM A;  3V6E A;  3PW3 A;  1PPN A;  4QBB A;  3I3T A;  2AS8 A;  2G6D A;  4QRX A;  1A6R A;  4WA6 A;  3H8B A;  4K7C A;  3HHA A;  4BOP A;  4ZUX U;  1F2C A;  1SP4 B;  2AGA A;  3H7D A;  2P7U A;  1NL6 A;  3PHU A;  3B21 A;  3PRP A;  4OEL A;  2UZJ A;  2DC8 A;  1AU2 A;  1ME3 A;  1DF0 A;  5KO3 A;  2DC7 A;  4D8I A;  3MTN A;  3S3Q A;  3P5X A;  2OUL A;  3M99 A;  1DKI A;  3NHE A;  3C0R A;  3PHX A;  2Y5B A;  2FRQ A;  3USV A;  2FT2 A;  3TRK A;  1GMY A;  1GCB A;  5EF4 A;  2PBH A;  5CVO B;  3V6C A;  4OVZ B;  1NPZ A;  3H8C A;  3W31 A;  2AUX A;  3K24 A;  1CVZ A;  3BY4 A;  1CQD A;  1CPJ A;  1K3B B;  3LFY A;  3I06 A;  5PAD A;  2F1G A;  3P5V A;  4W5B A;  4QRG A;  1MEG A;  5JA7 A;  1CJL A;  4YYW A;  2CB5 A;  3ERV A;  3F5V A;  1ITO A;  1EWO A;  1YAL A;  2IBI A;  2VHS A;  3PT2 A;  2FYE A;  1CS8 A;  2O6X A;  2R9O A;  4R3D A;  3PRM A;  5JZE A;  4MZS A;  1AYW A;  1QOL A;  1CV8 A;  4QRV A;  5K16 A;  1QXP A;  1BGO A;  2R9N A;  3HD3 A;  3ZUA A;  1IWD A;  3QSD A;  4X6H A;  4IP3 A;  2AYN A;  1Y08 A;  2P86 A;  1TU6 A;  2DC9 A;  2BDZ A;  1SNK A;  4PT5 A;  1PPO A;  2FRA A;  4YV8 A;  1CSB B;  3BB7 A;  2FUD A;  2DJF B;  4N8W A;  2BTW B;  3U8E A;  4I04 A;  4BOZ A;  5EZS A;  4FIP A;  6PAD A;  5A24 A;  1Q6K A;  4XUI A;  4BQV A;  2R9F A;  4BOU A;  3P5W A;  1NB3 A;  1CTE A;  3IMA A;  4CDF B;  3KFQ A;  4PP2 E;  3MTV A;  3OIS A;  5CHV A;  1MHW A;  3PBH A;  2B1N A;  3BPM A;  2R6N A;  3MP2 A;  2E00 A;  9PAP A;  3MHH A;  3WXF A;  3W30 A;  3IFU A;  1PCI A;  4HWY A;  1THE A;  1XKG A;  2BDL A;  2B1M A;  1TL9 A;  1POP A;  4W5C A;  3KW9 A;  4YYS A;  1TLO A;  1U9X A;  4XR7 A;  4YYR A;  2PNS A;  1F29 A;  4RNA A;  1ZIV A;  3BBA A;  4CZW A;  3E1Z B;  2G8E A;  4I05 A;  4MSX A;  3HHI A;  1F2A A;  1O0E A;  1EWM A;  1ME4 A;  2DZZ A;  2VHF A;  2FE8 A;  5J94 A;  3CH3 X;  2PAD A;  4X6J A; 
#chains in the Genus database with same CATH homology
 1MDW A;  2OP3 A;  1AU4 A;  2G7Y A;  1PE6 A;  1CB5 A;  4MZO A;  2NQG A;  3HWN A;  4Q8H A;  4DMX A;  2CIO A;  3RVX A;  2HD5 A;  1GLO A;  1PIP A;  1KFU L;  1NQC A;  3PNR A;  1YVB A;  2R9C A;  1BQI A;  2NQA A;  4Q8G A;  2Y6E A;  4I07 A;  3AI8 A;  1AU0 A;  2JQF R;  3BOW A;  1NLJ A;  1HUC B;  1U5I A;  3LXS A;  1PAD A;  3GCB A;  2E03 A;  3D6S A;  1S4V A;  1VJV A;  3S3R A;  2JQG R;  3CH2 X;  2IPP B;  1YK7 A;  1FH0 A;  3D9W A;  3WXG A;  4BSQ A;  1AYV A;  1QMY A;  2HH5 A;  5F02 A;  1ICF A;  2YJ2 A;  4CDE B;  3F75 A;  8PCH A;  4N4Z A;  2E02 A;  2XU1 A;  2DC6 A;  1DEU A;  1STF E;  4PAD A;  2FO5 A;  1KXR A;  3BWK A;  2OZ2 A;  3CBK A;  1PPP A;  5CHT A;  3QJ3 A;  4W4U A;  2DCA A;  3LTW A;  3IHP A;  2HHN A;  2PRE A;  3MHS A;  3BC3 A;  4G54 A;  2XU3 A;  3P5U A;  1EF7 A;  1YT7 A;  1AU3 A;  3OF8 A;  1PBH A;  4BS5 A;  1BP4 A;  3OVX A;  4YYQ A;  3PDF A;  1MIR A;  1F2B A;  1PXV A;  2VFC A;  1QDQ A;  1U9V A;  2H7J A;  4AXM A;  4CDC B;  2DCC A;  1MS6 A;  1NB5 A;  2F7D A;  3RVV A;  1Y4H A;  3N4C A;  1M6D A;  3IV2 A;  2XU4 A;  4OEM A;  1GX3 A;  4C5P A;  2DCD A;  3RVW A;  4N79 A;  2ATO A;  4P6E A;  2C0Y A;  1KHQ A;  1AIM A;  3TNX A;  3H6S A;  3KWZ A;  2AUZ A;  1AEC A;  2AYO A;  2HXZ A;  4DMY A;  2GFO A;  1PPD A;  3KKU A;  1VSN A;  4X6I A;  2YJ8 A;  3O0U A;  2G8J A;  5FPW A;  2YJ9 A;  4FK5 A;  2ARY A;  2DCB A;  4YVA A;  2AU1 A;  2DZY A;  4AXL A;  1BY8 A;  3WXE A;  1ZCM A;  4GUZ A;  3BCN A;  3IOQ A;  2FQ9 A;  1MEM A;  1U9W A;  1GEC E;  3N3G A;  4RY2 A;  5JH3 A;  4KLB A;  3MOR A;  1KHP A;  1X9Y A;  3K9M A;  3KX1 A;  1YK8 A;  2DJG B;  3B79 A;  4BS6 A;  4YYV A;  2YJB A;  1ATK A;  1EWP A;  2AIM A;  5EGW A;  3IEJ A;  3K8U A;  1W5R A;  2XU5 A;  4PP1 A;  3N3K A;  2YJC A;  1EWL A;  4FJC A;  3QT4 A;  3OVZ A;  3OF9 A;  3KSE A;  2P0R A;  3IUT A;  3C9E A;  3H89 A;  5CVN B;  4NV8 A;  2GHU A;  2ACT A;  7PCK A;  4YYU A;  1KFX L;  2R9M A;  3CBJ A;  3KWB X;  4PI3 A;  4BPV A;  4CDD B;  2E01 A;  2NQI A;  1U9Q X;  3BPF A;  3O1G A;  3DF0 A;  2NQD B;  2FTD A;  4P6G A;  2WBF X;  1AYU A;  4QH6 A;  5CVM A;  2AVW A;  1JQP A;  3V6E A;  3PW3 A;  1W6F A;  4B55 A;  1PPN A;  4QBB A;  3I3T A;  2AS8 A;  2G6D A;  4QRX A;  1A6R A;  4WA6 A;  3H8B A;  4K7C A;  3HHA A;  4ZUX U;  1F2C A;  1SP4 B;  3H7D A;  2P7U A;  1NL6 A;  4OEL A;  2VFB A;  1W4T A;  2DC8 A;  1AU2 A;  1ME3 A;  1DF0 A;  2DC7 A;  3MTN A;  3S3Q A;  3P5X A;  2OUL A;  3M99 A;  3NHE A;  2Y5B A;  2FRQ A;  3USV A;  2FT2 A;  1GMY A;  1GCB A;  5EF4 A;  2PBH A;  5CVO B;  3V6C A;  1NPZ A;  3H8C A;  2AUX A;  3K24 A;  1CVZ A;  1CQD A;  1CPJ A;  1K3B B;  3LFY A;  3I06 A;  5PAD A;  2F1G A;  3P5V A;  4W5B A;  4QRG A;  1MEG A;  5JA7 A;  1CJL A;  4YYW A;  2CB5 A;  3ERV A;  3F5V A;  1ITO A;  1EWO A;  1YAL A;  2IBI A;  2VHS A;  2FYE A;  1CS8 A;  2O6X A;  2R9O A;  4MZS A;  1AYW A;  1QOL A;  1CV8 A;  4QRV A;  5K16 A;  1QXP A;  1BGO A;  2R9N A;  3HD3 A;  3ZUA A;  1IWD A;  3QSD A;  4X6H A;  2AYN A;  1Y08 A;  2P86 A;  1TU6 A;  2DC9 A;  2BDZ A;  2BSZ A;  1SNK A;  1PPO A;  4NV7 A;  2FRA A;  4YV8 A;  1CSB B;  2FUD A;  2DJF B;  4N8W A;  4BGF A;  3U8E A;  4I04 A;  4FIP A;  6PAD A;  5A24 A;  1Q6K A;  4XUI A;  4BQV A;  2R9F A;  3P5W A;  1NB3 A;  1CTE A;  3IMA A;  4CDF B;  3KFQ A;  4PP2 E;  3OIS A;  5CHV A;  1MHW A;  3PBH A;  2B1N A;  3BPM A;  2R6N A;  2E00 A;  9PAP A;  3MHH A;  3WXF A;  1PCI A;  4HWY A;  1THE A;  1XKG A;  2BDL A;  2B1M A;  1TL9 A;  1POP A;  4W5C A;  1E2T A;  3KW9 A;  4YYS A;  1TLO A;  1U9X A;  4XR7 A;  4YYR A;  2PNS A;  1F29 A;  1ZIV A;  4CZW A;  3E1Z B;  2G8E A;  4I05 A;  4MSX A;  3HHI A;  1F2A A;  1O0E A;  1EWM A;  1ME4 A;  2DZZ A;  2VHF A;  5J94 A;  3CH3 X;  2PAD A;  4X6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...