2FYEA

Mutant human cathepsin s with irreversible inhibitor cra-14013
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTKKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSAYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S preproprotein
molecule tags Hydrolase
source organism Homo sapiens
publication title Mutant Human Cathepsin S with irreversible inhibitor CRA-14013
rcsb
total genus 66
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fyeA00
1BQIA 1MEGA 2AYNA 2XU3A 3KFQA 3WXEA 4N79A 3KSEA 2HHNA 1S4VA 3CH2X 3QJ3A 1PXVA 1Y08A 2HD5A 3KX1A 2DCBA 1FH0A 2CB5A 4PADA 3H8BA 4W5CA 3F75A 3HHIA 2C0YA 2E02A 1KFXL 3S3QA 4XR7A 1XKGA 1F2CA 2GHUA 2DCAA 4CDEB 3IEJA 4CDDB 3N3GA 4DMXA 1MDWA 3RVWA 2FT2A 4PI3A 5CVOB 1PPNA 4QBBA 4G54A 1M6DA 5F02A 4N8WA 2DC9A 3PW3A 2R9FA 3DF0A 2GFOA 2YJBA 1PIPA 2OULA 1NL6A 2PREA 4MZOA 2G8JA 5EGWA 2ATOA 1EWMA 4QRXA 3LXSA 1MIRA 1VSNA 4YYUA 1U9QX 2O6XA 3CBKA 4BPVA 5CHTA 3OF9A 2AUZA 1NB3A 4QRGA 5JA7A 3BWKA 4FK5A 1ICFA 1SP4B 3K24A 3K8UA 1QDQA 3BPMA 2PADA 5FPWA 1AYUA 2PBHA 3U8EA 3MHHA 1ATKA 3LFYA 2NQIA 3CBJA 2JQFR 2P7UA 5K16A 4YV8A 1QMYA 1U9XA 1QOLA 4QH6A 4W4UA 3CH3X 4DMYA 1ITOA 1YK8A 1PBHA 2FQ9A 5CVNB 3PDFA 4X6IA 1DEUA 3N3KA 4I07A 1MEMA 4I04A 4MSXA 3OF8A 2NQDB 1BP4A 2DCCA 4BQVA 3MORA 3GCBA 3RVXA 2FTDA 3WXFA 2G6DA 3RVVA 1U9VA 1THEA 1ZCMA 1KHPA 5J94A 2R9MA 1AYVA 3O1GA 1MHWA 1QXPA 4N4ZA 1JQPA 1CB5A 1CJLA 3K9MA 3PNRA 3V6EA 3P5UA 1ZIVA 3PBHA 3KW9A 4HWYA 3QT4A 2HH5A 2YJ8A 1TLOA 1EWOA 2AS8A 4YYVA 1Q6KA 2DJGB 1GMYA 1HUCB 1GCBA 4P6GA 4YVAA 2OP3A 3KWZA 3MHSA 4KLBA 3P5WA 8PCHA 2F7DA 2FRQA 2B1MA 4I05A 1GLOA 1KHQA 1EWPA 4PP1A 1F2BA 1KFUL 2H7JA 3IMAA 3BC3A 1YALA 5EF4A 2ARYA 3KWBX 1GECE 2Y6EA 2PNSA 2R9CA 3P5VA 3S3RA 4FIPA 1A6RA 1YK7A 2E03A 1BY8A 3N4CA 1F2AA 2FO5A 2NQGA 3OVZA 3HHAA 4RY2A 3H8CA 9PAPA 3BPFA 3BCNA 4YYWA 1PE6A 2DC6A 2P0RA 1CS8A 2R6NA 1AECA 1EF7A 2F1GA 4K7CA 2DC8A 1NLJA 3H89A 4AXMA 1AU0A 1PPPA 3H7DA 1IWDA 2DC7A 1ME4A 1PADA 2WBFX 2Y5BA 2DJFB 5CVMA 2XU4A 4BS6A 4FJCA 7PCKA 2P86A 4ZUXU 2FYEA 2BDLA 4YYSA 1MS6A 3HD3A 2E00A 4YYRA 2AYOA 3AI8A 2DCDA 5PADA 5CHVA 2R9OA 4MZSA 3I3TA 4OEMA 2YJ9A 1CV8A 4P6EA 3BOWA 4CZWA 4Q8GA 1SNKA 2E01A 1U9WA 1PPOA 1YT7A 4YYQA 2XU1A 4PP2E 4X6JA 5JH3A 4W5BA 1KXRA 4QRVA 3OISA 3ERVA 1NB5A 3OVXA 3USVA 1O0EA 3KKUA 2IPPB 1VJVA 1ME3A 2VHSA 4X6HA 1AU3A 2IBIA 3V6CA 1NPZA 2AIMA 1K3BB 1U5IA 3D6SA 1TU6A 2AU1A 2AVWA 4AXLA 2DZZA 1STFE 1DF0A 1CQDA 2G7YA 1AU4A 1CPJA 3HWNA 1AYWA 1PCIA 3C9EA 2AUXA 1AU2A 4BSQA 1TL9A 2G8EA 2FRAA 6PADA 4CDCB 2HXZA 2BDZA 2DZYA 3B79A 2B1NA 1CSBB 3H6SA 2ACTA 2VHFA 2YJ2A 3IOQA 1BGOA 3O0UA 1X9YA 1POPA 1F29A 3MTNA 3P5XA 1AIMA 1PPDA 2XU5A 3F5VA 1CTEA 2R9NA 4BS5A 3ZUAA 3IHPA 2FUDA 4Q8HA 2CIOA 4CDFB 3IUTA 3QSDA 4XUIA 4WA6A 4OELA 3IV2A 2NQAA 1EWLA 1CVZA 1Y4HA 3E1ZB 3WXGA 2YJCA 2OZ2A 5A24A 3M99A 3NHEA 3TNXA 1YVBA 2JQGR 1NQCA 3I06A
chains in the Genus database with same CATH superfamily
1BQIA 1MEGA 2AYNA 2XU3A 3PT2A 3KFQA 3WXEA 4N79A 3KSEA 2HHNA 1S4VA 3CH2X 3QJ3A 4BOPA 1PXVA 1Y08A 2HD5A 3KX1A 4BOSA 2DCBA 1FH0A 3BBAA 2CB5A 4PADA 3H8BA 4W5CA 3F75A 3HHIA 2C0YA 2E02A 4M0WA 1KFXL 2J7QC 3S3QA 4XR7A 1XKGA 1F2CA 2GHUA 2DCAA 4REZA 4CDEB 3IEJA 3BY4A 4CDDB 3N3GA 4DMXA 4MM3B 1MDWA 3RVWA 2FT2A 4RKXA 5EZSA 4PI3A 5CVOB 3PRMA 1PPNA 4QBBA 4G54A 1M6DA 5F02A 4N8WA 2DC9A 3PW3A 2R9FA 3DF0A 2GFOA 2YJBA 4D8BA 1PIPA 2OULA 1NL6A 2PREA 4MZOA 2G8JA 5EGWA 2ATOA 1EWMA 4QRXA 3LXSA 1MIRA 1VSNA 4YYUA 1U9QX 2O6XA 3CBKA 4BPVA 5CHTA 3OF9A 2AUZA 1NB3A 4QRGA 5JA7A 4MI7A 3BWKA 4FK5A 1ICFA 3PSEA 1YZBA 1SP4B 3K24A 3K8UA 1QDQA 3BPMA 2FE8A 2PADA 5FPWA 1PVJA 2JRIA 3W30A 1AYUA 2PBHA 3U8EA 3MHHA 1ATKA 3LFYA 2NQIA 3CBJA 4PT5A 4OVZA 4XZXA 2JQFR 2P7UA 5K16A 4YV8A 1QMYA 1U9XA 4RF1A 1QOLA 4QH6A 4W4UA 3CH3X 4DMYA 1ITOA 1YK8A 1PBHA 2FQ9A 5CVNB 3PDFA 4X6IA 1DEUA 3PHUA 3N3KA 4I07A 1MEMA 4I04A 4MSXA 3OF8A 2NQDB 1BP4A 2DCCA 4BQVA 3MORA 4IP3A 3GCBA 3RVXA 4WURA 2FTDA 3O65A 3WXFA 2G6DA 3RVVA 1U9VA 1THEA 1ZCMA 1KHPA 5J94A 2R9MA 1AYVA 2BTWB 1MHWA 3O1GA 1QXPA 4N4ZA 1JQPA 1CB5A 1CJLA 3B21A 3K9MA 3E9SA 3PNRA 3V6EA 2Z84A 3P5UA 1ZIVA 3PBHA 3KW9A 4HWYA 3QT4A 2HH5A 2YJ8A 1TLOA 4HXDB 1EWOA 2AS8A 5JZEA 1DKIA 4YYVA 1Q6KA 2DJGB 1GMYA 1HUCB 1GCBA 4P6GA 4YVAA 4RF0A 2OP3A 3KWZA 3MHSA 4GUAA 4KLBA 3MP2A 3P5WA 8PCHA 2F7DA 2FRQA 2B1MA 4I05A 1GLOA 1KHQA 1EWPA 4PP1A 1F2BA 1KFUL 2H7JA 3IMAA 3BC3A 1YALA 5EF4A 3MTVA 2ARYA 4OW0A 3PHWA 3KWBX 3OQCA 2UZJA 1GECE 2Y6EA 2PNSA 2R9CA 3P5VA 4ZTBA 3S3RA 4FIPA 1A6RA 1YK7A 3C0RA 4OVZB 2E03A 1BY8A 3N4CA 1F2AA 2FO5A 2NQGA 3OVZA 3HHAA 4RY2A 3H8CA 9PAPA 3BPFA 3BCNA 4YYWA 1PE6A 2DC6A 2P0RA 3PHXA 1CS8A 2R6NA 2AGAA 1AECA 1EF7A 2HWKA 2F1GA 4K7CA 2DC8A 1NLJA 3H89A 4AXMA 1AU0A 1PPPA 3H7DA 1UKFA 1IWDA 2DC7A 1ME4A 1PADA 3PRPA 2WBFX 2Y5BA 2DJFB 5CVMA 2XU4A 4BS6A 4FJCA 7PCKA 2P86A 4ZUXU 2FYEA 2BDLA 4YYSA 1MS6A 3HD3A 2E00A 4YYRA 2AYOA 3AI8A 4R3DA 2DCDA 4A5UA 5PADA 5CHVA 2R9OA 4MZSA 3I3TA 4OEMA 2YJ9A 3TMPA 1CV8A 4P6EA 2JTCA 3BOWA 3MJ5A 4CZWA 4D8IA 4Q8GA 3ZNHA 1SNKA 2E01A 1U9WA 1PPOA 1YT7A 4YYQA 2XU1A 4PP2E 4X6JA 5JH3A 4W5BA 1KXRA 4QRVA 3OISA 3BB7A 3ERVA 1NB5A 3OVXA 3USVA 1O0EA 3KKUA 2IPPB 3RNVA 1VJVA 1ME3A 4RNAA 5KO3A 2VHSA 4X6HA 1AU3A 2IBIA 3V6CA 1NPZA 2AIMA 1K3BB 4P16A 1U5IA 3D6SA 5E6JA 3TRKA 2BU3A 1TU6A 2AU1A 2J7QA 2AVWA 4AXLA 2DZZA 4BOZA 1STFE 5EZQA 1DF0A 2BTWA 1CQDA 2G7YA 1AU4A 1CPJA 3HWNA 1AYWA 1PCIA 3C9EA 2AUXA 1AU2A 4BSQA 1TL9A 4BOUA 2G8EA 2FRAA 6PADA 4CDCB 2HXZA 4BOQA 2BDZA 2DZYA 3B79A 2B1NA 1CSBB 3H6SA 2ACTA 2VHFA 2YJ2A 2DOSA 3IOQA 1BGOA 3O0UA 1X9YA 1POPA 1F29A 3MTNA 3P5XA 1AIMA 1PPDA 2XU5A 3F5VA 1CTEA 2R9NA 4BS5A 3ZUAA 3IHPA 2FUDA 4Q8HA 2CIOA 4CDFB 3IUTA 3IFUA 3QSDA 4IUMA 4XUIA 4WA6A 4OELA 3IV2A 2NQAA 1EWLA 1CVZA 1Y4HA 3E1ZB 3WXGA 4D8EA 2YJCA 2OZ2A 5A24A 3M99A 3W31A 3NHEA 3TNXA 1YVBA 2JQGR 1NQCA 3I06A
chains in the Genus database with same CATH topology
1BQIA 1MEGA 2AYNA 2XU3A 3KFQA 3WXEA 4N79A 3KSEA 2HHNA 1S4VA 3CH2X 3QJ3A 1PXVA 1Y08A 2HD5A 3KX1A 2DCBA 1FH0A 2CB5A 4PADA 3H8BA 4W5CA 3F75A 3HHIA 2C0YA 2E02A 1KFXL 3S3QA 4XR7A 1XKGA 1F2CA 2GHUA 2DCAA 4CDEB 3IEJA 4CDDB 3N3GA 4DMXA 1MDWA 3RVWA 2FT2A 4PI3A 5CVOB 1PPNA 4QBBA 4G54A 1M6DA 5F02A 4N8WA 2DC9A 3PW3A 2R9FA 3DF0A 2GFOA 2YJBA 1PIPA 2OULA 1NL6A 2PREA 4MZOA 2G8JA 5EGWA 2ATOA 1EWMA 4QRXA 3LXSA 1MIRA 1VSNA 4YYUA 1U9QX 2O6XA 3CBKA 4BPVA 5CHTA 3OF9A 2AUZA 1NB3A 4QRGA 5JA7A 3BWKA 4FK5A 1ICFA 1SP4B 3K24A 3K8UA 1QDQA 3BPMA 2PADA 5FPWA 1AYUA 2PBHA 3U8EA 3MHHA 1ATKA 3LFYA 2NQIA 3CBJA 2JQFR 2P7UA 5K16A 4YV8A 1QMYA 1U9XA 1QOLA 4QH6A 4W4UA 3CH3X 4DMYA 1ITOA 1YK8A 1PBHA 2FQ9A 5CVNB 3PDFA 4X6IA 1DEUA 3N3KA 4I07A 1MEMA 4I04A 4MSXA 3OF8A 2NQDB 1BP4A 2DCCA 4BQVA 3MORA 3GCBA 3RVXA 2FTDA 3WXFA 2G6DA 3RVVA 1U9VA 4B55A 1THEA 1ZCMA 1KHPA 5J94A 2R9MA 1AYVA 3O1GA 1MHWA 1QXPA 4N4ZA 1JQPA 1CB5A 3LTWA 1CJLA 3K9MA 3PNRA 3V6EA 3P5UA 1ZIVA 3PBHA 3KW9A 4HWYA 3QT4A 2HH5A 2YJ8A 1TLOA 1EWOA 2AS8A 4YYVA 1Q6KA 2DJGB 1GMYA 1HUCB 1GCBA 4P6GA 4YVAA 2OP3A 3KWZA 3MHSA 1GX3A 4KLBA 3P5WA 8PCHA 2F7DA 2FRQA 2B1MA 4I05A 1E2TA 1GLOA 1KHQA 1EWPA 4PP1A 1F2BA 1KFUL 2H7JA 3IMAA 3BC3A 1YALA 5EF4A 2ARYA 3KWBX 1GECE 2Y6EA 2PNSA 2R9CA 2VFCA 3P5VA 3S3RA 4FIPA 1A6RA 1YK7A 2E03A 1BY8A 3N4CA 1F2AA 2FO5A 2NQGA 3OVZA 3HHAA 4RY2A 3H8CA 9PAPA 3BPFA 3BCNA 4YYWA 1PE6A 2DC6A 2P0RA 1CS8A 2R6NA 1AECA 1EF7A 2F1GA 4K7CA 2DC8A 1NLJA 3H89A 4AXMA 1AU0A 1PPPA 3H7DA 1IWDA 2DC7A 1ME4A 1PADA 2WBFX 2Y5BA 2DJFB 5CVMA 2XU4A 4BS6A 4FJCA 7PCKA 2P86A 4ZUXU 2FYEA 2BDLA 4YYSA 4NV7A 1MS6A 3HD3A 2E00A 4YYRA 2AYOA 3AI8A 2DCDA 5PADA 5CHVA 2R9OA 2BSZA 4MZSA 3I3TA 4OEMA 2YJ9A 1CV8A 4P6EA 3BOWA 4CZWA 4Q8GA 1SNKA 2E01A 1U9WA 1PPOA 1YT7A 4YYQA 2XU1A 4PP2E 4X6JA 5JH3A 1W5RA 4W5BA 1W4TA 3D9WA 1KXRA 4QRVA 3OISA 3ERVA 1NB5A 3OVXA 3USVA 1O0EA 3KKUA 2IPPB 1VJVA 1ME3A 2VHSA 4NV8A 4X6HA 1AU3A 2IBIA 3V6CA 1NPZA 2AIMA 1K3BB 1U5IA 3D6SA 1TU6A 2AU1A 2AVWA 4AXLA 2DZZA 1STFE 1DF0A 1CQDA 2G7YA 1AU4A 1CPJA 3HWNA 1AYWA 1PCIA 3C9EA 2AUXA 1AU2A 4BSQA 1TL9A 2G8EA 2FRAA 6PADA 4CDCB 2HXZA 2BDZA 2DZYA 4GUZA 3B79A 2B1NA 2VFBA 1CSBB 3H6SA 2ACTA 2VHFA 2YJ2A 3IOQA 1BGOA 3O0UA 1X9YA 1POPA 1F29A 3MTNA 1W6FA 3P5XA 1AIMA 4C5PA 1PPDA 2XU5A 3F5VA 1CTEA 2R9NA 4BS5A 3ZUAA 3IHPA 2FUDA 4Q8HA 2CIOA 4CDFB 3IUTA 3QSDA 4XUIA 4WA6A 4OELA 3IV2A 2NQAA 4BGFA 1EWLA 1CVZA 1Y4HA 3E1ZB 3WXGA 2YJCA 2OZ2A 5A24A 3M99A 3NHEA 3TNXA 1YVBA 2JQGR 1NQCA 3I06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQI A;  1MEG A;  2AYN A;  2XU3 A;  3KFQ A;  3WXE A;  4N79 A;  3KSE A;  2HHN A;  1S4V A;  3CH2 X;  3QJ3 A;  1PXV A;  1Y08 A;  2HD5 A;  3KX1 A;  2DCB A;  1FH0 A;  2CB5 A;  4PAD A;  3H8B A;  4W5C A;  3F75 A;  3HHI A;  2C0Y A;  2E02 A;  1KFX L;  3S3Q A;  4XR7 A;  1XKG A;  1F2C A;  2GHU A;  2DCA A;  4CDE B;  3IEJ A;  4CDD B;  3N3G A;  4DMX A;  1MDW A;  3RVW A;  2FT2 A;  4PI3 A;  5CVO B;  1PPN A;  4QBB A;  4G54 A;  1M6D A;  5F02 A;  4N8W A;  2DC9 A;  3PW3 A;  2R9F A;  3DF0 A;  2GFO A;  2YJB A;  1PIP A;  2OUL A;  1NL6 A;  2PRE A;  4MZO A;  2G8J A;  5EGW A;  2ATO A;  1EWM A;  4QRX A;  3LXS A;  1MIR A;  1VSN A;  4YYU A;  1U9Q X;  2O6X A;  3CBK A;  4BPV A;  5CHT A;  3OF9 A;  2AUZ A;  1NB3 A;  4QRG A;  5JA7 A;  3BWK A;  4FK5 A;  1ICF A;  1SP4 B;  3K24 A;  3K8U A;  1QDQ A;  3BPM A;  2PAD A;  5FPW A;  1AYU A;  2PBH A;  3U8E A;  3MHH A;  1ATK A;  3LFY A;  2NQI A;  3CBJ A;  2JQF R;  2P7U A;  5K16 A;  4YV8 A;  1QMY A;  1U9X A;  1QOL A;  4QH6 A;  4W4U A;  3CH3 X;  4DMY A;  1ITO A;  1YK8 A;  1PBH A;  2FQ9 A;  5CVN B;  3PDF A;  4X6I A;  1DEU A;  3N3K A;  4I07 A;  1MEM A;  4I04 A;  4MSX A;  3OF8 A;  2NQD B;  1BP4 A;  2DCC A;  4BQV A;  3MOR A;  3GCB A;  3RVX A;  2FTD A;  3WXF A;  2G6D A;  3RVV A;  1U9V A;  1THE A;  1ZCM A;  1KHP A;  5J94 A;  2R9M A;  1AYV A;  3O1G A;  1MHW A;  1QXP A;  4N4Z A;  1JQP A;  1CB5 A;  1CJL A;  3K9M A;  3PNR A;  3V6E A;  3P5U A;  1ZIV A;  3PBH A;  3KW9 A;  4HWY A;  3QT4 A;  2HH5 A;  2YJ8 A;  1TLO A;  1EWO A;  2AS8 A;  4YYV A;  1Q6K A;  2DJG B;  1GMY A;  1HUC B;  1GCB A;  4P6G A;  4YVA A;  2OP3 A;  3KWZ A;  3MHS A;  4KLB A;  3P5W A;  8PCH A;  2F7D A;  2FRQ A;  2B1M A;  4I05 A;  1GLO A;  1KHQ A;  1EWP A;  4PP1 A;  1F2B A;  1KFU L;  2H7J A;  3IMA A;  3BC3 A;  1YAL A;  5EF4 A;  2ARY A;  3KWB X;  1GEC E;  2Y6E A;  2PNS A;  2R9C A;  3P5V A;  3S3R A;  4FIP A;  1A6R A;  1YK7 A;  2E03 A;  1BY8 A;  3N4C A;  1F2A A;  2FO5 A;  2NQG A;  3OVZ A;  3HHA A;  4RY2 A;  3H8C A;  9PAP A;  3BPF A;  3BCN A;  4YYW A;  1PE6 A;  2DC6 A;  2P0R A;  1CS8 A;  2R6N A;  1AEC A;  1EF7 A;  2F1G A;  4K7C A;  2DC8 A;  1NLJ A;  3H89 A;  4AXM A;  1AU0 A;  1PPP A;  3H7D A;  1IWD A;  2DC7 A;  1ME4 A;  1PAD A;  2WBF X;  2Y5B A;  2DJF B;  5CVM A;  2XU4 A;  4BS6 A;  4FJC A;  7PCK A;  2P86 A;  4ZUX U;  2FYE A;  2BDL A;  4YYS A;  1MS6 A;  3HD3 A;  2E00 A;  4YYR A;  2AYO A;  3AI8 A;  2DCD A;  5PAD A;  5CHV A;  2R9O A;  4MZS A;  3I3T A;  4OEM A;  2YJ9 A;  1CV8 A;  4P6E A;  3BOW A;  4CZW A;  4Q8G A;  1SNK A;  2E01 A;  1U9W A;  1PPO A;  1YT7 A;  4YYQ A;  2XU1 A;  4PP2 E;  4X6J A;  5JH3 A;  4W5B A;  1KXR A;  4QRV A;  3OIS A;  3ERV A;  1NB5 A;  3OVX A;  3USV A;  1O0E A;  3KKU A;  2IPP B;  1VJV A;  1ME3 A;  2VHS A;  4X6H A;  1AU3 A;  2IBI A;  3V6C A;  1NPZ A;  2AIM A;  1K3B B;  1U5I A;  3D6S A;  1TU6 A;  2AU1 A;  2AVW A;  4AXL A;  2DZZ A;  1STF E;  1DF0 A;  1CQD A;  2G7Y A;  1AU4 A;  1CPJ A;  3HWN A;  1AYW A;  1PCI A;  3C9E A;  2AUX A;  1AU2 A;  4BSQ A;  1TL9 A;  2G8E A;  2FRA A;  6PAD A;  4CDC B;  2HXZ A;  2BDZ A;  2DZY A;  3B79 A;  2B1N A;  1CSB B;  3H6S A;  2ACT A;  2VHF A;  2YJ2 A;  3IOQ A;  1BGO A;  3O0U A;  1X9Y A;  1POP A;  1F29 A;  3MTN A;  3P5X A;  1AIM A;  1PPD A;  2XU5 A;  3F5V A;  1CTE A;  2R9N A;  4BS5 A;  3ZUA A;  3IHP A;  2FUD A;  4Q8H A;  2CIO A;  4CDF B;  3IUT A;  3QSD A;  4XUI A;  4WA6 A;  4OEL A;  3IV2 A;  2NQA A;  1EWL A;  1CVZ A;  1Y4H A;  3E1Z B;  3WXG A;  2YJC A;  2OZ2 A;  5A24 A;  3M99 A;  3NHE A;  3TNX A;  1YVB A;  2JQG R;  1NQC A;  3I06 A; 
#chains in the Genus database with same CATH topology
 1BQI A;  1MEG A;  2AYN A;  2XU3 A;  3PT2 A;  3KFQ A;  3WXE A;  4N79 A;  3KSE A;  2HHN A;  1S4V A;  3CH2 X;  3QJ3 A;  4BOP A;  1PXV A;  1Y08 A;  2HD5 A;  3KX1 A;  4BOS A;  2DCB A;  1FH0 A;  3BBA A;  2CB5 A;  4PAD A;  3H8B A;  4W5C A;  3F75 A;  3HHI A;  2C0Y A;  2E02 A;  4M0W A;  1KFX L;  2J7Q C;  3S3Q A;  4XR7 A;  1XKG A;  1F2C A;  2GHU A;  2DCA A;  4REZ A;  4CDE B;  3IEJ A;  3BY4 A;  4CDD B;  3N3G A;  4DMX A;  4MM3 B;  1MDW A;  3RVW A;  2FT2 A;  4RKX A;  5EZS A;  4PI3 A;  5CVO B;  3PRM A;  1PPN A;  4QBB A;  4G54 A;  1M6D A;  5F02 A;  4N8W A;  2DC9 A;  3PW3 A;  2R9F A;  3DF0 A;  2GFO A;  2YJB A;  4D8B A;  1PIP A;  2OUL A;  1NL6 A;  2PRE A;  4MZO A;  2G8J A;  5EGW A;  2ATO A;  1EWM A;  4QRX A;  3LXS A;  1MIR A;  1VSN A;  4YYU A;  1U9Q X;  2O6X A;  3CBK A;  4BPV A;  5CHT A;  3OF9 A;  2AUZ A;  1NB3 A;  4QRG A;  5JA7 A;  4MI7 A;  3BWK A;  4FK5 A;  1ICF A;  3PSE A;  1YZB A;  1SP4 B;  3K24 A;  3K8U A;  1QDQ A;  3BPM A;  2FE8 A;  2PAD A;  5FPW A;  1PVJ A;  2JRI A;  3W30 A;  1AYU A;  2PBH A;  3U8E A;  3MHH A;  1ATK A;  3LFY A;  2NQI A;  3CBJ A;  4PT5 A;  4OVZ A;  4XZX A;  2JQF R;  2P7U A;  5K16 A;  4YV8 A;  1QMY A;  1U9X A;  4RF1 A;  1QOL A;  4QH6 A;  4W4U A;  3CH3 X;  4DMY A;  1ITO A;  1YK8 A;  1PBH A;  2FQ9 A;  5CVN B;  3PDF A;  4X6I A;  1DEU A;  3PHU A;  3N3K A;  4I07 A;  1MEM A;  4I04 A;  4MSX A;  3OF8 A;  2NQD B;  1BP4 A;  2DCC A;  4BQV A;  3MOR A;  4IP3 A;  3GCB A;  3RVX A;  4WUR A;  2FTD A;  3O65 A;  3WXF A;  2G6D A;  3RVV A;  1U9V A;  1THE A;  1ZCM A;  1KHP A;  5J94 A;  2R9M A;  1AYV A;  2BTW B;  1MHW A;  3O1G A;  1QXP A;  4N4Z A;  1JQP A;  1CB5 A;  1CJL A;  3B21 A;  3K9M A;  3E9S A;  3PNR A;  3V6E A;  2Z84 A;  3P5U A;  1ZIV A;  3PBH A;  3KW9 A;  4HWY A;  3QT4 A;  2HH5 A;  2YJ8 A;  1TLO A;  4HXD B;  1EWO A;  2AS8 A;  5JZE A;  1DKI A;  4YYV A;  1Q6K A;  2DJG B;  1GMY A;  1HUC B;  1GCB A;  4P6G A;  4YVA A;  4RF0 A;  2OP3 A;  3KWZ A;  3MHS A;  4GUA A;  4KLB A;  3MP2 A;  3P5W A;  8PCH A;  2F7D A;  2FRQ A;  2B1M A;  4I05 A;  1GLO A;  1KHQ A;  1EWP A;  4PP1 A;  1F2B A;  1KFU L;  2H7J A;  3IMA A;  3BC3 A;  1YAL A;  5EF4 A;  3MTV A;  2ARY A;  4OW0 A;  3PHW A;  3KWB X;  3OQC A;  2UZJ A;  1GEC E;  2Y6E A;  2PNS A;  2R9C A;  3P5V A;  4ZTB A;  3S3R A;  4FIP A;  1A6R A;  1YK7 A;  3C0R A;  4OVZ B;  2E03 A;  1BY8 A;  3N4C A;  1F2A A;  2FO5 A;  2NQG A;  3OVZ A;  3HHA A;  4RY2 A;  3H8C A;  9PAP A;  3BPF A;  3BCN A;  4YYW A;  1PE6 A;  2DC6 A;  2P0R A;  3PHX A;  1CS8 A;  2R6N A;  2AGA A;  1AEC A;  1EF7 A;  2HWK A;  2F1G A;  4K7C A;  2DC8 A;  1NLJ A;  3H89 A;  4AXM A;  1AU0 A;  1PPP A;  3H7D A;  1UKF A;  1IWD A;  2DC7 A;  1ME4 A;  1PAD A;  3PRP A;  2WBF X;  2Y5B A;  2DJF B;  5CVM A;  2XU4 A;  4BS6 A;  4FJC A;  7PCK A;  2P86 A;  4ZUX U;  2FYE A;  2BDL A;  4YYS A;  1MS6 A;  3HD3 A;  2E00 A;  4YYR A;  2AYO A;  3AI8 A;  4R3D A;  2DCD A;  4A5U A;  5PAD A;  5CHV A;  2R9O A;  4MZS A;  3I3T A;  4OEM A;  2YJ9 A;  3TMP A;  1CV8 A;  4P6E A;  2JTC A;  3BOW A;  3MJ5 A;  4CZW A;  4D8I A;  4Q8G A;  3ZNH A;  1SNK A;  2E01 A;  1U9W A;  1PPO A;  1YT7 A;  4YYQ A;  2XU1 A;  4PP2 E;  4X6J A;  5JH3 A;  4W5B A;  1KXR A;  4QRV A;  3OIS A;  3BB7 A;  3ERV A;  1NB5 A;  3OVX A;  3USV A;  1O0E A;  3KKU A;  2IPP B;  3RNV A;  1VJV A;  1ME3 A;  4RNA A;  5KO3 A;  2VHS A;  4X6H A;  1AU3 A;  2IBI A;  3V6C A;  1NPZ A;  2AIM A;  1K3B B;  4P16 A;  1U5I A;  3D6S A;  5E6J A;  3TRK A;  2BU3 A;  1TU6 A;  2AU1 A;  2J7Q A;  2AVW A;  4AXL A;  2DZZ A;  4BOZ A;  1STF E;  5EZQ A;  1DF0 A;  2BTW A;  1CQD A;  2G7Y A;  1AU4 A;  1CPJ A;  3HWN A;  1AYW A;  1PCI A;  3C9E A;  2AUX A;  1AU2 A;  4BSQ A;  1TL9 A;  4BOU A;  2G8E A;  2FRA A;  6PAD A;  4CDC B;  2HXZ A;  4BOQ A;  2BDZ A;  2DZY A;  3B79 A;  2B1N A;  1CSB B;  3H6S A;  2ACT A;  2VHF A;  2YJ2 A;  2DOS A;  3IOQ A;  1BGO A;  3O0U A;  1X9Y A;  1POP A;  1F29 A;  3MTN A;  3P5X A;  1AIM A;  1PPD A;  2XU5 A;  3F5V A;  1CTE A;  2R9N A;  4BS5 A;  3ZUA A;  3IHP A;  2FUD A;  4Q8H A;  2CIO A;  4CDF B;  3IUT A;  3IFU A;  3QSD A;  4IUM A;  4XUI A;  4WA6 A;  4OEL A;  3IV2 A;  2NQA A;  1EWL A;  1CVZ A;  1Y4H A;  3E1Z B;  3WXG A;  4D8E A;  2YJC A;  2OZ2 A;  5A24 A;  3M99 A;  3W31 A;  3NHE A;  3TNX A;  1YVB A;  2JQG R;  1NQC A;  3I06 A; 
#chains in the Genus database with same CATH homology
 1BQI A;  1MEG A;  2AYN A;  2XU3 A;  3KFQ A;  3WXE A;  4N79 A;  3KSE A;  2HHN A;  1S4V A;  3CH2 X;  3QJ3 A;  1PXV A;  1Y08 A;  2HD5 A;  3KX1 A;  2DCB A;  1FH0 A;  2CB5 A;  4PAD A;  3H8B A;  4W5C A;  3F75 A;  3HHI A;  2C0Y A;  2E02 A;  1KFX L;  3S3Q A;  4XR7 A;  1XKG A;  1F2C A;  2GHU A;  2DCA A;  4CDE B;  3IEJ A;  4CDD B;  3N3G A;  4DMX A;  1MDW A;  3RVW A;  2FT2 A;  4PI3 A;  5CVO B;  1PPN A;  4QBB A;  4G54 A;  1M6D A;  5F02 A;  4N8W A;  2DC9 A;  3PW3 A;  2R9F A;  3DF0 A;  2GFO A;  2YJB A;  1PIP A;  2OUL A;  1NL6 A;  2PRE A;  4MZO A;  2G8J A;  5EGW A;  2ATO A;  1EWM A;  4QRX A;  3LXS A;  1MIR A;  1VSN A;  4YYU A;  1U9Q X;  2O6X A;  3CBK A;  4BPV A;  5CHT A;  3OF9 A;  2AUZ A;  1NB3 A;  4QRG A;  5JA7 A;  3BWK A;  4FK5 A;  1ICF A;  1SP4 B;  3K24 A;  3K8U A;  1QDQ A;  3BPM A;  2PAD A;  5FPW A;  1AYU A;  2PBH A;  3U8E A;  3MHH A;  1ATK A;  3LFY A;  2NQI A;  3CBJ A;  2JQF R;  2P7U A;  5K16 A;  4YV8 A;  1QMY A;  1U9X A;  1QOL A;  4QH6 A;  4W4U A;  3CH3 X;  4DMY A;  1ITO A;  1YK8 A;  1PBH A;  2FQ9 A;  5CVN B;  3PDF A;  4X6I A;  1DEU A;  3N3K A;  4I07 A;  1MEM A;  4I04 A;  4MSX A;  3OF8 A;  2NQD B;  1BP4 A;  2DCC A;  4BQV A;  3MOR A;  3GCB A;  3RVX A;  2FTD A;  3WXF A;  2G6D A;  3RVV A;  1U9V A;  4B55 A;  1THE A;  1ZCM A;  1KHP A;  5J94 A;  2R9M A;  1AYV A;  3O1G A;  1MHW A;  1QXP A;  4N4Z A;  1JQP A;  1CB5 A;  3LTW A;  1CJL A;  3K9M A;  3PNR A;  3V6E A;  3P5U A;  1ZIV A;  3PBH A;  3KW9 A;  4HWY A;  3QT4 A;  2HH5 A;  2YJ8 A;  1TLO A;  1EWO A;  2AS8 A;  4YYV A;  1Q6K A;  2DJG B;  1GMY A;  1HUC B;  1GCB A;  4P6G A;  4YVA A;  2OP3 A;  3KWZ A;  3MHS A;  1GX3 A;  4KLB A;  3P5W A;  8PCH A;  2F7D A;  2FRQ A;  2B1M A;  4I05 A;  1E2T A;  1GLO A;  1KHQ A;  1EWP A;  4PP1 A;  1F2B A;  1KFU L;  2H7J A;  3IMA A;  3BC3 A;  1YAL A;  5EF4 A;  2ARY A;  3KWB X;  1GEC E;  2Y6E A;  2PNS A;  2R9C A;  2VFC A;  3P5V A;  3S3R A;  4FIP A;  1A6R A;  1YK7 A;  2E03 A;  1BY8 A;  3N4C A;  1F2A A;  2FO5 A;  2NQG A;  3OVZ A;  3HHA A;  4RY2 A;  3H8C A;  9PAP A;  3BPF A;  3BCN A;  4YYW A;  1PE6 A;  2DC6 A;  2P0R A;  1CS8 A;  2R6N A;  1AEC A;  1EF7 A;  2F1G A;  4K7C A;  2DC8 A;  1NLJ A;  3H89 A;  4AXM A;  1AU0 A;  1PPP A;  3H7D A;  1IWD A;  2DC7 A;  1ME4 A;  1PAD A;  2WBF X;  2Y5B A;  2DJF B;  5CVM A;  2XU4 A;  4BS6 A;  4FJC A;  7PCK A;  2P86 A;  4ZUX U;  2FYE A;  2BDL A;  4YYS A;  4NV7 A;  1MS6 A;  3HD3 A;  2E00 A;  4YYR A;  2AYO A;  3AI8 A;  2DCD A;  5PAD A;  5CHV A;  2R9O A;  2BSZ A;  4MZS A;  3I3T A;  4OEM A;  2YJ9 A;  1CV8 A;  4P6E A;  3BOW A;  4CZW A;  4Q8G A;  1SNK A;  2E01 A;  1U9W A;  1PPO A;  1YT7 A;  4YYQ A;  2XU1 A;  4PP2 E;  4X6J A;  5JH3 A;  1W5R A;  4W5B A;  1W4T A;  3D9W A;  1KXR A;  4QRV A;  3OIS A;  3ERV A;  1NB5 A;  3OVX A;  3USV A;  1O0E A;  3KKU A;  2IPP B;  1VJV A;  1ME3 A;  2VHS A;  4NV8 A;  4X6H A;  1AU3 A;  2IBI A;  3V6C A;  1NPZ A;  2AIM A;  1K3B B;  1U5I A;  3D6S A;  1TU6 A;  2AU1 A;  2AVW A;  4AXL A;  2DZZ A;  1STF E;  1DF0 A;  1CQD A;  2G7Y A;  1AU4 A;  1CPJ A;  3HWN A;  1AYW A;  1PCI A;  3C9E A;  2AUX A;  1AU2 A;  4BSQ A;  1TL9 A;  2G8E A;  2FRA A;  6PAD A;  4CDC B;  2HXZ A;  2BDZ A;  2DZY A;  4GUZ A;  3B79 A;  2B1N A;  2VFB A;  1CSB B;  3H6S A;  2ACT A;  2VHF A;  2YJ2 A;  3IOQ A;  1BGO A;  3O0U A;  1X9Y A;  1POP A;  1F29 A;  3MTN A;  1W6F A;  3P5X A;  1AIM A;  4C5P A;  1PPD A;  2XU5 A;  3F5V A;  1CTE A;  2R9N A;  4BS5 A;  3ZUA A;  3IHP A;  2FUD A;  4Q8H A;  2CIO A;  4CDF B;  3IUT A;  3QSD A;  4XUI A;  4WA6 A;  4OEL A;  3IV2 A;  2NQA A;  4BGF A;  1EWL A;  1CVZ A;  1Y4H A;  3E1Z B;  3WXG A;  2YJC A;  2OZ2 A;  5A24 A;  3M99 A;  3NHE A;  3TNX A;  1YVB A;  2JQG R;  1NQC A;  3I06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...