2FYEA

Mutant human cathepsin s with irreversible inhibitor cra-14013
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
b'LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTKKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSAYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cathepsin S preproprotein
publication title Mutant Human Cathepsin S with irreversible inhibitor CRA-14013
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fyeA00
2G8EA 3C9EA 1DEUA 2FTDA 2HXZA 4BSQA 2ATOA 3KW9A 4DMXA 3MHSA 4CDEB 1XKGA 2HHNA 1TLOA 2PREA 3RVWA 2P86A 3HD3A 3KKUA 1MEMA 3BPMA 2DC6A 2AIMA 5CHTA 4X6HA 4PADA 4I05A 1PE6A 4YYQA 1MDWA 5CVOB 4YYUA 4G54A 1KFXL 1NPZA 4FIPA 1TL9A 1MEGA 4KLBA 5A24A 1CVZA 4QBBA 3CH3X 3K8UA 3V6CA 1AECA 1BGOA 1HUCB 2G8JA 3S3RA 3KWBX 1VSNA 2NQGA 1AIMA 5JH3A 1M6DA 2DCBA 1CPJA 2CIOA 3CH2X 3IUTA 1STFE 1EWOA 3K24A 4CZWA 4P6EA 4XUIA 3WXFA 1EF7A 2NQAA 1AYUA 2YJ2A 3PW3A 3H8CA 1U9QX 2R9CA 1JQPA 4Q8HA 4YYRA 1BQIA 3KSEA 5F02A 5FPWA 2FRAA 1AYWA 2B1NA 3QJ3A 5CVMA 2FO5A 3IOQA 4QRGA 1IWDA 4YYSA 4I04A 1U9VA 4PP2E 4BPVA 2DC7A 2DC8A 4MSXA 2DCAA 1ATKA 2YJ8A 2FYEA 3RVXA 2R6NA 2YJCA 1NL6A 2AYNA 4N8WA 3P5VA 1YVBA 1GLOA 2PADA 4QRXA 4BS5A 1DF0A 3H89A 1VJVA 3F5VA 2XU3A 4RY2A 2F7DA 3IV2A 1PXVA 1PADA 2DZZA 4YYWA 3HHAA 3U8EA 2FRQA 1PIPA 4PI3A 4ZUXU 4CDCB 3MHHA 1AYVA 1YK7A 1QDQA 1Q6KA 2AU1A 2OP3A 2AVWA 2XU1A 1F2CA 3QT4A 1AU4A 1PPNA 2Y5BA 4YYVA 3BC3A 4AXMA 2DJGB 3PNRA 1FH0A 2JQFR 3OVZA 1ZCMA 3GCBA 4W5BA 1QOLA 1BP4A 3S3QA 3CBKA 4YV8A 4X6IA 2PBHA 3P5XA 2VHSA 3KWZA 1QXPA 1NB5A 2R9OA 1AU0A 2DJFB 1ME3A 1PPDA 2CB5A 2GFOA 3HWNA 1KHPA 2R9MA 2P0RA 3OISA 2O6XA 1EWPA 2R9FA 1ME4A 3B79A 2OZ2A 1AU2A 3P5UA 3LXSA 2E03A 2E01A 2H7JA 1ZIVA 1YK8A 1O0EA 1QMYA 1POPA 2DCCA 3O1GA 3F75A 3IHPA 2OULA 5K16A 1PPOA 2WBFX 3BWKA 3NHEA 2IBIA 3M99A 1GCBA 1Y4HA 3ERVA 3N3GA 1CQDA 3IMAA 1PCIA 2AUXA 4I07A 1CTEA 1YT7A 3BOWA 6PADA 2Y6EA 4FJCA 1THEA 3D6SA 3H7DA 1U5IA 3N4CA 2DC9A 4W4UA 3BCNA 3V6EA 3MORA 3CBJA 2G6DA 2GHUA 2BDZA 3OVXA 1ITOA 8PCHA 1NLJA 3PBHA 4QH6A 2E02A 2E00A 1S4VA 2FT2A 4W5CA 5J94A 1SP4B 1GECE 1AU3A 5EF4A 2R9NA 2BDLA 2YJBA 2FQ9A 4P6GA 2C0YA 1EWLA 1NB3A 2P7UA 3I06A 3ZUAA 4OELA 1PBHA 2YJ9A 3KFQA 4QRVA 4CDDB 2NQDB 1CSBB 4OEMA 3WXGA 2B1MA 3DF0A 4N79A 3K9MA 1CS8A 2JQGR 3LFYA 1SNKA 4MZOA 3N3KA 1MS6A 3OF9A 2FUDA 9PAPA 4BQVA 5CHVA 3AI8A 4HWYA 1F2BA 5EGWA 1K3BB 3HHIA 1Y08A 3BPFA 1KXRA 1MHWA 1CV8A 3USVA 3KX1A 2AUZA 1PPPA 4AXLA 3WXEA 4WA6A 7PCKA 4PP1A 1F2AA 3O0UA 3QSDA 3OF8A 4BS6A 4MZSA 3TNXA 5JA7A 1ICFA 2IPPB 3IEJA 3E1ZB 3H8BA 3PDFA 4CDFB 1EWMA 1CJLA 4K7CA 2AYOA 3P5WA 1MIRA 2DCDA 4XR7A 4X6JA 2ACTA 2XU5A 5CVNB 1CB5A 3MTNA 1F29A 2AS8A 4FK5A 4Q8GA 2HD5A 2PNSA 2NQIA 1A6RA 1X9YA 2XU4A 2F1GA 1U9WA 1U9XA 1NQCA 2G7YA 1YALA 1KHQA 1TU6A 3H6SA 1BY8A 4N4ZA 3I3TA 1KFUL 2DZYA 2HH5A 4DMYA 1GMYA 3RVVA 4YVAA 5PADA 2VHFA 2ARYA
chains in the Genus database with same CATH superfamily
2G8EA 3C9EA 1DEUA 2FTDA 2HXZA 4BSQA 4RNAA 2ATOA 3KW9A 4DMXA 4BOSA 3MHSA 4OVZB 4CDEB 1XKGA 2HHNA 1TLOA 2PREA 3RVWA 2BTWB 2JTCA 2P86A 3OQCA 4HXDB 3HD3A 3KKUA 1MEMA 3BPMA 2DC6A 3ZNHA 2AIMA 5CHTA 4X6HA 1YZBA 4PADA 4I05A 1PE6A 4YYQA 1MDWA 2J7QA 5CVOB 4YYUA 4R3DA 4G54A 1KFXL 1NPZA 4FIPA 1TL9A 1MEGA 4KLBA 5A24A 1CVZA 4QBBA 3BB7A 4WURA 3CH3X 3K8UA 3V6CA 1AECA 1BGOA 1HUCB 2G8JA 3S3RA 3KWBX 4IUMA 1VSNA 2NQGA 3TMPA 4BOUA 1AIMA 5JH3A 1M6DA 2DCBA 1CPJA 2CIOA 3CH2X 3IUTA 1STFE 1EWOA 3K24A 4CZWA 4P6EA 4XUIA 3WXFA 1EF7A 2NQAA 1AYUA 2YJ2A 3H8CA 3PW3A 1U9QX 2R9CA 1JQPA 4Q8HA 4YYRA 5E6JA 1BQIA 3BY4A 4A5UA 3KSEA 2AGAA 5F02A 5FPWA 2FRAA 3PT2A 1AYWA 2B1NA 3QJ3A 5CVMA 3MJ5A 2FO5A 3IOQA 4QRGA 1IWDA 4YYSA 4I04A 3BBAA 1U9VA 3O65A 4PP2E 4BPVA 2DC7A 3W30A 2DC8A 4MSXA 2DCAA 1ATKA 2YJ8A 2FYEA 3PRMA 2R6NA 2YJCA 1NL6A 2AYNA 4N8WA 3RVXA 3P5VA 4BOZA 1YVBA 1GLOA 4GUAA 2PADA 4QRXA 4BS5A 1DF0A 3H89A 1VJVA 3F5VA 1PVJA 4IP3A 2XU3A 4RY2A 2F7DA 3IV2A 3B21A 1PXVA 2BU3A 1DKIA 1PADA 3PHWA 2DZZA 4YYWA 3HHAA 3U8EA 2FRQA 1PIPA 4PI3A 4BOPA 4PT5A 4ZUXU 4CDCB 3MHHA 1AYVA 1YK7A 1QDQA 2J7QC 1Q6KA 2AU1A 2OP3A 2AVWA 2XU1A 1F2CA 3QT4A 1AU4A 1PPNA 2Y5BA 4YYVA 3BC3A 4AXMA 2DJGB 3PNRA 1FH0A 2JQFR 3OVZA 1ZCMA 3GCBA 4W5BA 1QOLA 1BP4A 3S3QA 3E9SA 3CBKA 3TRKA 4RKXA 4YV8A 4X6IA 2PBHA 3P5XA 2VHSA 3KWZA 1QXPA 1NB5A 3PHXA 2R9OA 2JRIA 1AU0A 2DJFB 1ME3A 1PPDA 2CB5A 2GFOA 3HWNA 1KHPA 2R9MA 2P0RA 3OISA 2O6XA 1EWPA 2R9FA 1ME4A 3B79A 2OZ2A 1AU2A 3P5UA 3LXSA 2E03A 2E01A 2H7JA 2FE8A 1ZIVA 1YK8A 1O0EA 1QMYA 1POPA 2DCCA 3O1GA 3F75A 3IHPA 2OULA 5K16A 4M0WA 1PPOA 2WBFX 3BWKA 4P16A 3NHEA 2IBIA 3M99A 4D8IA 1GCBA 1Y4HA 3ERVA 3N3GA 1CQDA 3IMAA 1PCIA 2AUXA 4MM3B 4I07A 3MP2A 1CTEA 1YT7A 3BOWA 6PADA 2Y6EA 4FJCA 1THEA 3D6SA 4BOQA 4D8BA 3W31A 3H7DA 1U5IA 3N4CA 2DC9A 4W4UA 3BCNA 3V6EA 3MORA 3CBJA 2G6DA 2GHUA 4RF1A 2BDZA 3OVXA 1ITOA 3PSEA 8PCHA 1NLJA 4D8EA 3PBHA 4QH6A 2E02A 3IFUA 2E00A 1S4VA 4RF0A 2FT2A 4W5CA 5JZEA 5J94A 1SP4B 1GECE 1AU3A 5EF4A 4ZTBA 2R9NA 4XZXA 2BDLA 2YJBA 2FQ9A 4P6GA 2HWKA 2C0YA 1EWLA 1NB3A 2P7UA 3I06A 3ZUAA 3MTVA 4OELA 1PBHA 2YJ9A 3KFQA 4QRVA 4CDDB 2NQDB 1CSBB 4REZA 4OEMA 3WXGA 2B1MA 3DF0A 4N79A 3K9MA 1CS8A 2JQGR 3LFYA 1SNKA 4MZOA 3N3KA 1MS6A 3OF9A 2FUDA 9PAPA 4BQVA 5CHVA 3AI8A 4HWYA 1F2BA 5EGWA 1K3BB 3HHIA 1Y08A 3BPFA 1KXRA 1MHWA 1CV8A 3USVA 3KX1A 2AUZA 3PRPA 1PPPA 4AXLA 3WXEA 4WA6A 7PCKA 3PHUA 2Z84A 5KO3A 4PP1A 5EZQA 1F2AA 3O0UA 3QSDA 5EZSA 1UKFA 3OF8A 4BS6A 4MZSA 3TNXA 5JA7A 2DOSA 1ICFA 2IPPB 3IEJA 3E1ZB 3H8BA 3PDFA 4CDFB 1EWMA 1CJLA 4K7CA 4OW0A 2AYOA 3P5WA 1MIRA 2DCDA 4MI7A 4XR7A 4X6JA 2ACTA 2XU5A 5CVNB 1CB5A 3MTNA 1F29A 2AS8A 4FK5A 4Q8GA 2HD5A 2PNSA 2NQIA 1A6RA 1X9YA 2XU4A 2F1GA 1U9WA 1U9XA 1NQCA 2G7YA 3RNVA 1YALA 1KHQA 2UZJA 1TU6A 3H6SA 1BY8A 4N4ZA 3I3TA 1KFUL 4OVZA 2DZYA 2HH5A 4DMYA 1GMYA 3RVVA 4YVAA 5PADA 2BTWA 2VHFA 3C0RA 2ARYA
chains in the Genus database with same CATH topology
2G8EA 3C9EA 1DEUA 2FTDA 4B55A 2HXZA 4BSQA 2ATOA 3KW9A 4DMXA 3MHSA 4CDEB 1XKGA 2HHNA 1TLOA 2PREA 3RVWA 2P86A 3HD3A 3KKUA 1MEMA 3BPMA 2DC6A 2AIMA 5CHTA 4X6HA 4PADA 4I05A 1PE6A 4YYQA 1MDWA 5CVOB 4YYUA 4G54A 1KFXL 1NPZA 4FIPA 1TL9A 1MEGA 4KLBA 5A24A 1CVZA 4QBBA 3CH3X 3K8UA 3V6CA 1AECA 1BGOA 1HUCB 2G8JA 3S3RA 3KWBX 1VSNA 2NQGA 1AIMA 4NV8A 5JH3A 1M6DA 2DCBA 1CPJA 2VFBA 2CIOA 3CH2X 3IUTA 1STFE 1EWOA 3K24A 4CZWA 4P6EA 4XUIA 3WXFA 1EF7A 2NQAA 1AYUA 2YJ2A 3PW3A 3H8CA 1U9QX 2R9CA 1JQPA 4Q8HA 4YYRA 1BQIA 3KSEA 5F02A 5FPWA 2FRAA 1AYWA 2B1NA 3QJ3A 5CVMA 2FO5A 3IOQA 4QRGA 1IWDA 4YYSA 4I04A 1U9VA 4PP2E 4BPVA 2DC7A 2DC8A 4MSXA 2DCAA 1ATKA 2YJ8A 2FYEA 3RVXA 2R6NA 2YJCA 1NL6A 2AYNA 4N8WA 3P5VA 1YVBA 1GLOA 2PADA 4QRXA 4BS5A 1DF0A 3H89A 1VJVA 3F5VA 4GUZA 2XU3A 4RY2A 2F7DA 3IV2A 1PXVA 1PADA 2DZZA 4YYWA 3HHAA 3U8EA 2FRQA 1PIPA 4PI3A 4ZUXU 4CDCB 3MHHA 1AYVA 1YK7A 1QDQA 1Q6KA 2AU1A 2OP3A 2AVWA 2XU1A 1F2CA 3QT4A 1AU4A 1PPNA 2Y5BA 4YYVA 1E2TA 3BC3A 1W5RA 4AXMA 2DJGB 3PNRA 1FH0A 2JQFR 3OVZA 1ZCMA 3GCBA 4W5BA 1QOLA 1BP4A 3S3QA 3CBKA 4YV8A 4X6IA 2PBHA 3P5XA 2VHSA 3KWZA 1QXPA 1NB5A 2R9OA 1AU0A 2DJFB 1ME3A 1PPDA 2CB5A 2GFOA 3HWNA 1KHPA 2R9MA 2P0RA 3OISA 2O6XA 1W4TA 1EWPA 4C5PA 2R9FA 1ME4A 3B79A 2OZ2A 1AU2A 3P5UA 3LXSA 2E03A 2E01A 2H7JA 1ZIVA 1YK8A 1O0EA 1QMYA 1POPA 2DCCA 3O1GA 3F75A 3IHPA 2OULA 5K16A 1PPOA 2WBFX 3BWKA 2VFCA 3NHEA 2IBIA 3M99A 1GCBA 1Y4HA 3ERVA 3N3GA 1CQDA 3IMAA 1PCIA 2AUXA 4I07A 1CTEA 1YT7A 3BOWA 6PADA 2Y6EA 4FJCA 1THEA 3D6SA 3D9WA 1U5IA 3H7DA 3N4CA 2DC9A 4W4UA 3BCNA 3V6EA 3MORA 3CBJA 2BSZA 2G6DA 2GHUA 2BDZA 3OVXA 1ITOA 8PCHA 1NLJA 3LTWA 3PBHA 4QH6A 2E02A 2E00A 1S4VA 2FT2A 4W5CA 5J94A 1SP4B 1GECE 1AU3A 5EF4A 2R9NA 2BDLA 4NV7A 2YJBA 2FQ9A 4P6GA 2C0YA 1EWLA 1NB3A 2P7UA 3I06A 3ZUAA 4OELA 1PBHA 2YJ9A 3KFQA 4QRVA 4CDDB 2NQDB 1CSBB 4OEMA 3WXGA 2B1MA 3DF0A 4N79A 3K9MA 1CS8A 2JQGR 3LFYA 1SNKA 4MZOA 3N3KA 1MS6A 1W6FA 3OF9A 2FUDA 9PAPA 4BQVA 5CHVA 3AI8A 4HWYA 1F2BA 5EGWA 1K3BB 3HHIA 1Y08A 3BPFA 1KXRA 1MHWA 1CV8A 3USVA 3KX1A 2AUZA 1PPPA 4AXLA 3WXEA 4WA6A 7PCKA 4PP1A 1F2AA 3O0UA 3QSDA 1GX3A 3OF8A 4BS6A 4MZSA 3TNXA 5JA7A 1ICFA 2IPPB 3IEJA 3E1ZB 3H8BA 3PDFA 4CDFB 1EWMA 1CJLA 4K7CA 4BGFA 2AYOA 3P5WA 1MIRA 2DCDA 4XR7A 4X6JA 2ACTA 2XU5A 5CVNB 1CB5A 3MTNA 1F29A 2AS8A 4FK5A 4Q8GA 2HD5A 2PNSA 2NQIA 1A6RA 1X9YA 2XU4A 2F1GA 1U9WA 1U9XA 1NQCA 2G7YA 1YALA 1KHQA 1TU6A 3H6SA 1BY8A 4N4ZA 3I3TA 1KFUL 2DZYA 2HH5A 4DMYA 1GMYA 3RVVA 4YVAA 5PADA 2VHFA 2ARYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8E A;  3C9E A;  1DEU A;  2FTD A;  2HXZ A;  4BSQ A;  2ATO A;  3KW9 A;  4DMX A;  3MHS A;  4CDE B;  1XKG A;  2HHN A;  1TLO A;  2PRE A;  3RVW A;  2P86 A;  3HD3 A;  3KKU A;  1MEM A;  3BPM A;  2DC6 A;  2AIM A;  5CHT A;  4X6H A;  4PAD A;  4I05 A;  1PE6 A;  4YYQ A;  1MDW A;  5CVO B;  4YYU A;  4G54 A;  1KFX L;  1NPZ A;  4FIP A;  1TL9 A;  1MEG A;  4KLB A;  5A24 A;  1CVZ A;  4QBB A;  3CH3 X;  3K8U A;  3V6C A;  1AEC A;  1BGO A;  1HUC B;  2G8J A;  3S3R A;  3KWB X;  1VSN A;  2NQG A;  1AIM A;  5JH3 A;  1M6D A;  2DCB A;  1CPJ A;  2CIO A;  3CH2 X;  3IUT A;  1STF E;  1EWO A;  3K24 A;  4CZW A;  4P6E A;  4XUI A;  3WXF A;  1EF7 A;  2NQA A;  1AYU A;  2YJ2 A;  3PW3 A;  3H8C A;  1U9Q X;  2R9C A;  1JQP A;  4Q8H A;  4YYR A;  1BQI A;  3KSE A;  5F02 A;  5FPW A;  2FRA A;  1AYW A;  2B1N A;  3QJ3 A;  5CVM A;  2FO5 A;  3IOQ A;  4QRG A;  1IWD A;  4YYS A;  4I04 A;  1U9V A;  4PP2 E;  4BPV A;  2DC7 A;  2DC8 A;  4MSX A;  2DCA A;  1ATK A;  2YJ8 A;  2FYE A;  3RVX A;  2R6N A;  2YJC A;  1NL6 A;  2AYN A;  4N8W A;  3P5V A;  1YVB A;  1GLO A;  2PAD A;  4QRX A;  4BS5 A;  1DF0 A;  3H89 A;  1VJV A;  3F5V A;  2XU3 A;  4RY2 A;  2F7D A;  3IV2 A;  1PXV A;  1PAD A;  2DZZ A;  4YYW A;  3HHA A;  3U8E A;  2FRQ A;  1PIP A;  4PI3 A;  4ZUX U;  4CDC B;  3MHH A;  1AYV A;  1YK7 A;  1QDQ A;  1Q6K A;  2AU1 A;  2OP3 A;  2AVW A;  2XU1 A;  1F2C A;  3QT4 A;  1AU4 A;  1PPN A;  2Y5B A;  4YYV A;  3BC3 A;  4AXM A;  2DJG B;  3PNR A;  1FH0 A;  2JQF R;  3OVZ A;  1ZCM A;  3GCB A;  4W5B A;  1QOL A;  1BP4 A;  3S3Q A;  3CBK A;  4YV8 A;  4X6I A;  2PBH A;  3P5X A;  2VHS A;  3KWZ A;  1QXP A;  1NB5 A;  2R9O A;  1AU0 A;  2DJF B;  1ME3 A;  1PPD A;  2CB5 A;  2GFO A;  3HWN A;  1KHP A;  2R9M A;  2P0R A;  3OIS A;  2O6X A;  1EWP A;  2R9F A;  1ME4 A;  3B79 A;  2OZ2 A;  1AU2 A;  3P5U A;  3LXS A;  2E03 A;  2E01 A;  2H7J A;  1ZIV A;  1YK8 A;  1O0E A;  1QMY A;  1POP A;  2DCC A;  3O1G A;  3F75 A;  3IHP A;  2OUL A;  5K16 A;  1PPO A;  2WBF X;  3BWK A;  3NHE A;  2IBI A;  3M99 A;  1GCB A;  1Y4H A;  3ERV A;  3N3G A;  1CQD A;  3IMA A;  1PCI A;  2AUX A;  4I07 A;  1CTE A;  1YT7 A;  3BOW A;  6PAD A;  2Y6E A;  4FJC A;  1THE A;  3D6S A;  3H7D A;  1U5I A;  3N4C A;  2DC9 A;  4W4U A;  3BCN A;  3V6E A;  3MOR A;  3CBJ A;  2G6D A;  2GHU A;  2BDZ A;  3OVX A;  1ITO A;  8PCH A;  1NLJ A;  3PBH A;  4QH6 A;  2E02 A;  2E00 A;  1S4V A;  2FT2 A;  4W5C A;  5J94 A;  1SP4 B;  1GEC E;  1AU3 A;  5EF4 A;  2R9N A;  2BDL A;  2YJB A;  2FQ9 A;  4P6G A;  2C0Y A;  1EWL A;  1NB3 A;  2P7U A;  3I06 A;  3ZUA A;  4OEL A;  1PBH A;  2YJ9 A;  3KFQ A;  4QRV A;  4CDD B;  2NQD B;  1CSB B;  4OEM A;  3WXG A;  2B1M A;  3DF0 A;  4N79 A;  3K9M A;  1CS8 A;  2JQG R;  3LFY A;  1SNK A;  4MZO A;  3N3K A;  1MS6 A;  3OF9 A;  2FUD A;  9PAP A;  4BQV A;  5CHV A;  3AI8 A;  4HWY A;  1F2B A;  5EGW A;  1K3B B;  3HHI A;  1Y08 A;  3BPF A;  1KXR A;  1MHW A;  1CV8 A;  3USV A;  3KX1 A;  2AUZ A;  1PPP A;  4AXL A;  3WXE A;  4WA6 A;  7PCK A;  4PP1 A;  1F2A A;  3O0U A;  3QSD A;  3OF8 A;  4BS6 A;  4MZS A;  3TNX A;  5JA7 A;  1ICF A;  2IPP B;  3IEJ A;  3E1Z B;  3H8B A;  3PDF A;  4CDF B;  1EWM A;  1CJL A;  4K7C A;  2AYO A;  3P5W A;  1MIR A;  2DCD A;  4XR7 A;  4X6J A;  2ACT A;  2XU5 A;  5CVN B;  1CB5 A;  3MTN A;  1F29 A;  2AS8 A;  4FK5 A;  4Q8G A;  2HD5 A;  2PNS A;  2NQI A;  1A6R A;  1X9Y A;  2XU4 A;  2F1G A;  1U9W A;  1U9X A;  1NQC A;  2G7Y A;  1YAL A;  1KHQ A;  1TU6 A;  3H6S A;  1BY8 A;  4N4Z A;  3I3T A;  1KFU L;  2DZY A;  2HH5 A;  4DMY A;  1GMY A;  3RVV A;  4YVA A;  5PAD A;  2VHF A;  2ARY A; 
#chains in the Genus database with same CATH topology
 2G8E A;  3C9E A;  1DEU A;  2FTD A;  2HXZ A;  4BSQ A;  4RNA A;  2ATO A;  3KW9 A;  4DMX A;  4BOS A;  3MHS A;  4OVZ B;  4CDE B;  1XKG A;  2HHN A;  1TLO A;  2PRE A;  3RVW A;  2BTW B;  2JTC A;  2P86 A;  3OQC A;  4HXD B;  3HD3 A;  3KKU A;  1MEM A;  3BPM A;  2DC6 A;  3ZNH A;  2AIM A;  5CHT A;  4X6H A;  1YZB A;  4PAD A;  4I05 A;  1PE6 A;  4YYQ A;  1MDW A;  2J7Q A;  5CVO B;  4YYU A;  4R3D A;  4G54 A;  1KFX L;  1NPZ A;  4FIP A;  1TL9 A;  1MEG A;  4KLB A;  5A24 A;  1CVZ A;  4QBB A;  3BB7 A;  4WUR A;  3CH3 X;  3K8U A;  3V6C A;  1AEC A;  1BGO A;  1HUC B;  2G8J A;  3S3R A;  3KWB X;  4IUM A;  1VSN A;  2NQG A;  3TMP A;  4BOU A;  1AIM A;  5JH3 A;  1M6D A;  2DCB A;  1CPJ A;  2CIO A;  3CH2 X;  3IUT A;  1STF E;  1EWO A;  3K24 A;  4CZW A;  4P6E A;  4XUI A;  3WXF A;  1EF7 A;  2NQA A;  1AYU A;  2YJ2 A;  3H8C A;  3PW3 A;  1U9Q X;  2R9C A;  1JQP A;  4Q8H A;  4YYR A;  5E6J A;  1BQI A;  3BY4 A;  4A5U A;  3KSE A;  2AGA A;  5F02 A;  5FPW A;  2FRA A;  3PT2 A;  1AYW A;  2B1N A;  3QJ3 A;  5CVM A;  3MJ5 A;  2FO5 A;  3IOQ A;  4QRG A;  1IWD A;  4YYS A;  4I04 A;  3BBA A;  1U9V A;  3O65 A;  4PP2 E;  4BPV A;  2DC7 A;  3W30 A;  2DC8 A;  4MSX A;  2DCA A;  1ATK A;  2YJ8 A;  2FYE A;  3PRM A;  2R6N A;  2YJC A;  1NL6 A;  2AYN A;  4N8W A;  3RVX A;  3P5V A;  4BOZ A;  1YVB A;  1GLO A;  4GUA A;  2PAD A;  4QRX A;  4BS5 A;  1DF0 A;  3H89 A;  1VJV A;  3F5V A;  1PVJ A;  4IP3 A;  2XU3 A;  4RY2 A;  2F7D A;  3IV2 A;  3B21 A;  1PXV A;  2BU3 A;  1DKI A;  1PAD A;  3PHW A;  2DZZ A;  4YYW A;  3HHA A;  3U8E A;  2FRQ A;  1PIP A;  4PI3 A;  4BOP A;  4PT5 A;  4ZUX U;  4CDC B;  3MHH A;  1AYV A;  1YK7 A;  1QDQ A;  2J7Q C;  1Q6K A;  2AU1 A;  2OP3 A;  2AVW A;  2XU1 A;  1F2C A;  3QT4 A;  1AU4 A;  1PPN A;  2Y5B A;  4YYV A;  3BC3 A;  4AXM A;  2DJG B;  3PNR A;  1FH0 A;  2JQF R;  3OVZ A;  1ZCM A;  3GCB A;  4W5B A;  1QOL A;  1BP4 A;  3S3Q A;  3E9S A;  3CBK A;  3TRK A;  4RKX A;  4YV8 A;  4X6I A;  2PBH A;  3P5X A;  2VHS A;  3KWZ A;  1QXP A;  1NB5 A;  3PHX A;  2R9O A;  2JRI A;  1AU0 A;  2DJF B;  1ME3 A;  1PPD A;  2CB5 A;  2GFO A;  3HWN A;  1KHP A;  2R9M A;  2P0R A;  3OIS A;  2O6X A;  1EWP A;  2R9F A;  1ME4 A;  3B79 A;  2OZ2 A;  1AU2 A;  3P5U A;  3LXS A;  2E03 A;  2E01 A;  2H7J A;  2FE8 A;  1ZIV A;  1YK8 A;  1O0E A;  1QMY A;  1POP A;  2DCC A;  3O1G A;  3F75 A;  3IHP A;  2OUL A;  5K16 A;  4M0W A;  1PPO A;  2WBF X;  3BWK A;  4P16 A;  3NHE A;  2IBI A;  3M99 A;  4D8I A;  1GCB A;  1Y4H A;  3ERV A;  3N3G A;  1CQD A;  3IMA A;  1PCI A;  2AUX A;  4MM3 B;  4I07 A;  3MP2 A;  1CTE A;  1YT7 A;  3BOW A;  6PAD A;  2Y6E A;  4FJC A;  1THE A;  3D6S A;  4BOQ A;  4D8B A;  3W31 A;  3H7D A;  1U5I A;  3N4C A;  2DC9 A;  4W4U A;  3BCN A;  3V6E A;  3MOR A;  3CBJ A;  2G6D A;  2GHU A;  4RF1 A;  2BDZ A;  3OVX A;  1ITO A;  3PSE A;  8PCH A;  1NLJ A;  4D8E A;  3PBH A;  4QH6 A;  2E02 A;  3IFU A;  2E00 A;  1S4V A;  4RF0 A;  2FT2 A;  4W5C A;  5JZE A;  5J94 A;  1SP4 B;  1GEC E;  1AU3 A;  5EF4 A;  4ZTB A;  2R9N A;  4XZX A;  2BDL A;  2YJB A;  2FQ9 A;  4P6G A;  2HWK A;  2C0Y A;  1EWL A;  1NB3 A;  2P7U A;  3I06 A;  3ZUA A;  3MTV A;  4OEL A;  1PBH A;  2YJ9 A;  3KFQ A;  4QRV A;  4CDD B;  2NQD B;  1CSB B;  4REZ A;  4OEM A;  3WXG A;  2B1M A;  3DF0 A;  4N79 A;  3K9M A;  1CS8 A;  2JQG R;  3LFY A;  1SNK A;  4MZO A;  3N3K A;  1MS6 A;  3OF9 A;  2FUD A;  9PAP A;  4BQV A;  5CHV A;  3AI8 A;  4HWY A;  1F2B A;  5EGW A;  1K3B B;  3HHI A;  1Y08 A;  3BPF A;  1KXR A;  1MHW A;  1CV8 A;  3USV A;  3KX1 A;  2AUZ A;  3PRP A;  1PPP A;  4AXL A;  3WXE A;  4WA6 A;  7PCK A;  3PHU A;  2Z84 A;  5KO3 A;  4PP1 A;  5EZQ A;  1F2A A;  3O0U A;  3QSD A;  5EZS A;  1UKF A;  3OF8 A;  4BS6 A;  4MZS A;  3TNX A;  5JA7 A;  2DOS A;  1ICF A;  2IPP B;  3IEJ A;  3E1Z B;  3H8B A;  3PDF A;  4CDF B;  1EWM A;  1CJL A;  4K7C A;  4OW0 A;  2AYO A;  3P5W A;  1MIR A;  2DCD A;  4MI7 A;  4XR7 A;  4X6J A;  2ACT A;  2XU5 A;  5CVN B;  1CB5 A;  3MTN A;  1F29 A;  2AS8 A;  4FK5 A;  4Q8G A;  2HD5 A;  2PNS A;  2NQI A;  1A6R A;  1X9Y A;  2XU4 A;  2F1G A;  1U9W A;  1U9X A;  1NQC A;  2G7Y A;  3RNV A;  1YAL A;  1KHQ A;  2UZJ A;  1TU6 A;  3H6S A;  1BY8 A;  4N4Z A;  3I3T A;  1KFU L;  4OVZ A;  2DZY A;  2HH5 A;  4DMY A;  1GMY A;  3RVV A;  4YVA A;  5PAD A;  2BTW A;  2VHF A;  3C0R A;  2ARY A; 
#chains in the Genus database with same CATH homology
 2G8E A;  3C9E A;  1DEU A;  2FTD A;  4B55 A;  2HXZ A;  4BSQ A;  2ATO A;  3KW9 A;  4DMX A;  3MHS A;  4CDE B;  1XKG A;  2HHN A;  1TLO A;  2PRE A;  3RVW A;  2P86 A;  3HD3 A;  3KKU A;  1MEM A;  3BPM A;  2DC6 A;  2AIM A;  5CHT A;  4X6H A;  4PAD A;  4I05 A;  1PE6 A;  4YYQ A;  1MDW A;  5CVO B;  4YYU A;  4G54 A;  1KFX L;  1NPZ A;  4FIP A;  1TL9 A;  1MEG A;  4KLB A;  5A24 A;  1CVZ A;  4QBB A;  3CH3 X;  3K8U A;  3V6C A;  1AEC A;  1BGO A;  1HUC B;  2G8J A;  3S3R A;  3KWB X;  1VSN A;  2NQG A;  1AIM A;  4NV8 A;  5JH3 A;  1M6D A;  2DCB A;  1CPJ A;  2VFB A;  2CIO A;  3CH2 X;  3IUT A;  1STF E;  1EWO A;  3K24 A;  4CZW A;  4P6E A;  4XUI A;  3WXF A;  1EF7 A;  2NQA A;  1AYU A;  2YJ2 A;  3PW3 A;  3H8C A;  1U9Q X;  2R9C A;  1JQP A;  4Q8H A;  4YYR A;  1BQI A;  3KSE A;  5F02 A;  5FPW A;  2FRA A;  1AYW A;  2B1N A;  3QJ3 A;  5CVM A;  2FO5 A;  3IOQ A;  4QRG A;  1IWD A;  4YYS A;  4I04 A;  1U9V A;  4PP2 E;  4BPV A;  2DC7 A;  2DC8 A;  4MSX A;  2DCA A;  1ATK A;  2YJ8 A;  2FYE A;  3RVX A;  2R6N A;  2YJC A;  1NL6 A;  2AYN A;  4N8W A;  3P5V A;  1YVB A;  1GLO A;  2PAD A;  4QRX A;  4BS5 A;  1DF0 A;  3H89 A;  1VJV A;  3F5V A;  4GUZ A;  2XU3 A;  4RY2 A;  2F7D A;  3IV2 A;  1PXV A;  1PAD A;  2DZZ A;  4YYW A;  3HHA A;  3U8E A;  2FRQ A;  1PIP A;  4PI3 A;  4ZUX U;  4CDC B;  3MHH A;  1AYV A;  1YK7 A;  1QDQ A;  1Q6K A;  2AU1 A;  2OP3 A;  2AVW A;  2XU1 A;  1F2C A;  3QT4 A;  1AU4 A;  1PPN A;  2Y5B A;  4YYV A;  1E2T A;  3BC3 A;  1W5R A;  4AXM A;  2DJG B;  3PNR A;  1FH0 A;  2JQF R;  3OVZ A;  1ZCM A;  3GCB A;  4W5B A;  1QOL A;  1BP4 A;  3S3Q A;  3CBK A;  4YV8 A;  4X6I A;  2PBH A;  3P5X A;  2VHS A;  3KWZ A;  1QXP A;  1NB5 A;  2R9O A;  1AU0 A;  2DJF B;  1ME3 A;  1PPD A;  2CB5 A;  2GFO A;  3HWN A;  1KHP A;  2R9M A;  2P0R A;  3OIS A;  2O6X A;  1W4T A;  1EWP A;  4C5P A;  2R9F A;  1ME4 A;  3B79 A;  2OZ2 A;  1AU2 A;  3P5U A;  3LXS A;  2E03 A;  2E01 A;  2H7J A;  1ZIV A;  1YK8 A;  1O0E A;  1QMY A;  1POP A;  2DCC A;  3O1G A;  3F75 A;  3IHP A;  2OUL A;  5K16 A;  1PPO A;  2WBF X;  3BWK A;  2VFC A;  3NHE A;  2IBI A;  3M99 A;  1GCB A;  1Y4H A;  3ERV A;  3N3G A;  1CQD A;  3IMA A;  1PCI A;  2AUX A;  4I07 A;  1CTE A;  1YT7 A;  3BOW A;  6PAD A;  2Y6E A;  4FJC A;  1THE A;  3D6S A;  3D9W A;  1U5I A;  3H7D A;  3N4C A;  2DC9 A;  4W4U A;  3BCN A;  3V6E A;  3MOR A;  3CBJ A;  2BSZ A;  2G6D A;  2GHU A;  2BDZ A;  3OVX A;  1ITO A;  8PCH A;  1NLJ A;  3LTW A;  3PBH A;  4QH6 A;  2E02 A;  2E00 A;  1S4V A;  2FT2 A;  4W5C A;  5J94 A;  1SP4 B;  1GEC E;  1AU3 A;  5EF4 A;  2R9N A;  2BDL A;  4NV7 A;  2YJB A;  2FQ9 A;  4P6G A;  2C0Y A;  1EWL A;  1NB3 A;  2P7U A;  3I06 A;  3ZUA A;  4OEL A;  1PBH A;  2YJ9 A;  3KFQ A;  4QRV A;  4CDD B;  2NQD B;  1CSB B;  4OEM A;  3WXG A;  2B1M A;  3DF0 A;  4N79 A;  3K9M A;  1CS8 A;  2JQG R;  3LFY A;  1SNK A;  4MZO A;  3N3K A;  1MS6 A;  1W6F A;  3OF9 A;  2FUD A;  9PAP A;  4BQV A;  5CHV A;  3AI8 A;  4HWY A;  1F2B A;  5EGW A;  1K3B B;  3HHI A;  1Y08 A;  3BPF A;  1KXR A;  1MHW A;  1CV8 A;  3USV A;  3KX1 A;  2AUZ A;  1PPP A;  4AXL A;  3WXE A;  4WA6 A;  7PCK A;  4PP1 A;  1F2A A;  3O0U A;  3QSD A;  1GX3 A;  3OF8 A;  4BS6 A;  4MZS A;  3TNX A;  5JA7 A;  1ICF A;  2IPP B;  3IEJ A;  3E1Z B;  3H8B A;  3PDF A;  4CDF B;  1EWM A;  1CJL A;  4K7C A;  4BGF A;  2AYO A;  3P5W A;  1MIR A;  2DCD A;  4XR7 A;  4X6J A;  2ACT A;  2XU5 A;  5CVN B;  1CB5 A;  3MTN A;  1F29 A;  2AS8 A;  4FK5 A;  4Q8G A;  2HD5 A;  2PNS A;  2NQI A;  1A6R A;  1X9Y A;  2XU4 A;  2F1G A;  1U9W A;  1U9X A;  1NQC A;  2G7Y A;  1YAL A;  1KHQ A;  1TU6 A;  3H6S A;  1BY8 A;  4N4Z A;  3I3T A;  1KFU L;  2DZY A;  2HH5 A;  4DMY A;  1GMY A;  3RVV A;  4YVA A;  5PAD A;  2VHF A;  2ARY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...