2FYEA

Mutant human cathepsin s with irreversible inhibitor cra-14013
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
217
Chain Sequence
LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTKKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSAYRAATCRKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEKGYIRMARNKGNHCGIASFPSYPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutant Human Cathepsin S with irreversible inhibitor CRA-14013
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords cathepsin S preproprotein
total genus 66
structure length 217
sequence length 217
ec nomenclature ec 3.4.22.27: Cathepsin S.
pdb deposition date 2006-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2fyeA00
2HXZA 2DCCA 2PNSA 4QBBA 2FT2A 2OULA 4G54A 4PI3A 1PPNA 2Y5BA 4BPVA 2R9NA 2GHUA 3HD3A 4N8WA 4AXLA 3HHIA 2NQAA 1PPOA 5A24A 1ITOA 4YVAA 2YJ2A 1X9YA 3N4CA 3H89A 3BPFA 3V6EA 2XU3A 2NQDB 2AU1A 4CDFB 1CTEA 3KW9A 3S3QA 1AECA 1ME4A 2Y6EA 2P0RA 2YJCA 3CBKA 1AU3A 1AYUA 4MSXA 1KFUL 2H7JA 2FTDA 4W4UA 1TLOA 5JA7A 2DCBA 4XR7A 3O0UA 5CVOB 2F1GA 2G8EA 4PP1A 1QDQA 1AIMA 4I05A 1GMYA 2AYNA 2FQ9A 1KXRA 6PADA 2AVWA 2G6DA 4KLBA 2G8JA 2E02A 4AXMA 3P5VA 3HWNA 5J94A 2FRQA 2E03A 3P5WA 3C9EA 3ZUAA 1MS6A 1SNKA 2B1NA 3USVA 4FK5A 3CH3X 2GFOA 4YYWA 2BDZA 1CV8A 2ARYA 1EWPA 2NQIA 2ACTA 1FH0A 4WA6A 4FJCA 4HWYA 1POPA 3IV2A 1ATKA 2AIMA 4QRGA 2R9CA 1QOLA 2ATOA 2VHSA 4QRVA 4BQVA 3M99A 1M6DA 1CB5A 1DF0A 1Y08A 2R9MA 1BGOA 4DMYA 1GCBA 3LXSA 3PW3A 4YYRA 2E01A 3PDFA 3OVZA 2AYOA 3N3KA 2DC7A 5PADA 3IOQA 3TNXA 1NB3A 1EWLA 3KSEA 1KHPA 5EF4A 3H8BA 1GECE 3I3TA 3MORA 4Q8GA 7PCKA 1PPDA 3IMAA 4YYSA 1NLJA 3F5VA 4RY2A 3S3RA 1U9WA 1BY8A 1SP4B 1F29A 1YT7A 1EWMA 3K9MA 4YV8A 3OF9A 3KX1A 4I04A 1ZCMA 2XU5A 2P86A 1U5IA 2AUZA 4BSQA 1KFXL 1U9VA 2IBIA 3IEJA 4YYQA 2OP3A 1EF7A 3WXEA 1AYWA 2R9OA 1YK8A 1CS8A 3PNRA 2YJ8A 2DZYA 3K24A 1MIRA 2BDLA 3P5UA 4CDCB 4W5BA 5F02A 3K8UA 5CVNB 4YYVA 1NB5A 3HHAA 3NHEA 3QJ3A 3AI8A 4W5CA 4CDDB 1EWOA 1KHQA 3MHSA 1AYVA 3RVVA 1TU6A 1VJVA 1YALA 1MDWA 1STFE 8PCHA 4I07A 3DF0A 4CDEB 1DEUA 1JQPA 1QXPA 2G7YA 3IHPA 5CHVA 1PXVA 3U8EA 5FPWA 2O6XA 2P7UA 2CB5A 4OEMA 4X6JA 2FO5A 1AU0A 4BS5A 1IWDA 1PIPA 4K7CA 9PAPA 1ICFA 1U9QX 4QH6A 2FYEA 4Q8HA 1YVBA 4N79A 2YJ9A 1THEA 2DJGB 1ZIVA 2YJBA 3KFQA 2IPPB 1BQIA 1O0EA 2JQGR 1F2BA 5JH3A 3N3GA 3BOWA 4MZSA 2DCDA 1PPPA 4CZWA 4DMXA 1ME3A 2F7DA 1MEMA 3QSDA 4P6EA 3IUTA 4X6IA 1QMYA 2XU1A 3H8CA 5K16A 2PREA 2DZZA 3KWZA 5CHTA 3BC3A 1S4VA 5CVMA 3ERVA 2DC9A 2AUXA 4BS6A 3MTNA 1CJLA 2DCAA 4PADA 3WXGA 1BP4A 4XUIA 2DJFB 2NQGA 3OVXA 2AS8A 4P6GA 3H7DA 4MZOA 2WBFX 2HHNA 2PBHA 1PCIA 3F75A 2DC6A 3MHHA 2E00A 1GLOA 1HUCB 2FUDA 1Y4HA 4X6HA 2DC8A 3BWKA 3BPMA 1CPJA 1YK7A 2HD5A 3BCNA 1XKGA 1AU4A 3KWBX 4FIPA 2XU4A 1A6RA 3B79A 1F2AA 1CQDA 2B1MA 3PBHA 1AU2A 1MHWA 4YYUA 1CVZA 3RVWA 3GCBA 1PBHA 3E1ZB 1TL9A 1MEGA 2CIOA 3H6SA 3CH2X 3KKUA 1PE6A 3O1GA 4OELA 2R9FA 5EGWA 3V6CA 2VHFA 1U9XA 1NL6A 1K3BB 4ZUXU 3D6SA 3I06A 2JQFR 3WXFA 1Q6KA 3OF8A 3P5XA 3QT4A 1NPZA 1NQCA 3CBJA 3LFYA 3OISA 2PADA 4PP2E 4QRXA 2OZ2A 2FRAA 1PADA 1CSBB 1F2CA 2R6NA 4N4ZA 1VSNA 2C0YA 2HH5A 3RVXA
chains in the Genus database with same CATH superfamily
2HXZA 2DCCA 2PNSA 4QBBA 2FT2A 2OULA 4G54A 4PI3A 1PPNA 4BOUA 5JZEA 2Y5BA 4BPVA 2R9NA 4R3DA 2GHUA 3HD3A 4N8WA 4AXLA 3PHUA 3HHIA 2NQAA 1PPOA 5A24A 1UKFA 2J7QC 4HXDB 1ITOA 4YVAA 2YJ2A 1X9YA 3N4CA 3H89A 3BPFA 3V6EA 2XU3A 2NQDB 2AU1A 4CDFB 1CTEA 3PSEA 3KW9A 3S3QA 1AECA 1ME4A 2Y6EA 2P0RA 2YJCA 3CBKA 1AU3A 1AYUA 4MSXA 1KFUL 2H7JA 2FTDA 4W4UA 1TLOA 5JA7A 2DCBA 4XR7A 3O0UA 5CVOB 2F1GA 2G8EA 4PP1A 1QDQA 1YZBA 1AIMA 4I05A 1GMYA 4MI7A 2AYNA 4BOSA 2FQ9A 1KXRA 6PADA 2JRIA 4D8EA 2AVWA 2G6DA 4KLBA 2G8JA 4REZA 2E02A 4AXMA 3P5VA 3HWNA 5J94A 4WURA 2FRQA 2E03A 3P5WA 3C9EA 3MJ5A 3ZUAA 1MS6A 3OQCA 1SNKA 2B1NA 3USVA 4FK5A 4IUMA 1DKIA 3CH3X 2GFOA 4YYWA 2BDZA 1CV8A 2ARYA 1EWPA 2NQIA 2ACTA 1FH0A 4WA6A 4FJCA 4HWYA 1POPA 3IV2A 1ATKA 2AIMA 4QRGA 2R9CA 4OVZA 1QOLA 2ATOA 2VHSA 4QRVA 4BQVA 3M99A 1M6DA 1CB5A 1DF0A 3W31A 1Y08A 2R9MA 1BGOA 4DMYA 1GCBA 3LXSA 3PW3A 4YYRA 2E01A 3PDFA 3OVZA 2AYOA 3N3KA 2DC7A 5PADA 3IOQA 3TNXA 1NB3A 1EWLA 3KSEA 1KHPA 5EF4A 3H8BA 4ZTBA 1GECE 3PHWA 3I3TA 3MORA 4Q8GA 7PCKA 1PPDA 3IMAA 4YYSA 1NLJA 3F5VA 3TMPA 2JTCA 4RY2A 3S3RA 1U9WA 1BY8A 1SP4B 1F29A 1YT7A 4GUAA 2AGAA 1EWMA 3IFUA 3K9MA 4RKXA 4YV8A 4PT5A 3OF9A 3KX1A 3PRPA 4I04A 1ZCMA 2XU5A 2P86A 2UZJA 1U5IA 2BTWA 2AUZA 5EZSA 4BSQA 1KFXL 1U9VA 2IBIA 3IEJA 4YYQA 2OP3A 1EF7A 4MM3B 3WXEA 1AYWA 2R9OA 1YK8A 1CS8A 3PNRA 2YJ8A 2DZYA 3K24A 1MIRA 2BDLA 3P5UA 4CDCB 1PVJA 2DOSA 4W5BA 4A5UA 5F02A 3K8UA 5CVNB 4YYVA 1NB5A 3HHAA 3NHEA 3MP2A 4P16A 3QJ3A 3ZNHA 3AI8A 4W5CA 4CDDB 1EWOA 3B21A 1KHQA 3BY4A 3MHSA 1AYVA 3RVVA 1TU6A 1VJVA 1YALA 1MDWA 1STFE 8PCHA 4I07A 2BTWB 3DF0A 4CDEB 1DEUA 1JQPA 1QXPA 2G7YA 3IHPA 5CHVA 1PXVA 3PT2A 3U8EA 5FPWA 2O6XA 3MTVA 2P7UA 3W30A 2CB5A 4OEMA 2HWKA 4X6JA 2FO5A 1AU0A 4BS5A 3RNVA 1IWDA 1PIPA 4K7CA 9PAPA 1ICFA 1U9QX 4QH6A 4BOPA 2FYEA 4Q8HA 1YVBA 4N79A 2YJ9A 1THEA 2DJGB 1ZIVA 3O65A 2YJBA 3KFQA 4OVZB 2IPPB 1BQIA 1O0EA 2JQGR 1F2BA 3C0RA 5JH3A 3N3GA 3BOWA 5KO3A 4MZSA 2DCDA 4IP3A 1PPPA 4CZWA 4DMXA 1ME3A 2F7DA 1MEMA 4M0WA 3BBAA 3QSDA 4P6EA 3IUTA 4X6IA 1QMYA 4RNAA 2XU1A 3BB7A 3H8CA 3PRMA 5K16A 2PREA 2DZZA 3KWZA 5CHTA 3BC3A 1S4VA 5CVMA 3ERVA 2DC9A 2AUXA 4BS6A 3MTNA 1CJLA 2DCAA 4PADA 3WXGA 1BP4A 4XUIA 2DJFB 2NQGA 3OVXA 2AS8A 4RF0A 4P6GA 3H7DA 4MZOA 2WBFX 2HHNA 2PBHA 1PCIA 3F75A 2DC6A 3MHHA 2E00A 3TRKA 1GLOA 1HUCB 2FUDA 3PHXA 1Y4HA 4X6HA 2DC8A 3BWKA 5E6JA 3BPMA 1CPJA 1YK7A 3E9SA 2HD5A 2Z84A 3BCNA 2J7QA 1XKGA 1AU4A 3KWBX 4FIPA 2XU4A 1A6RA 3B79A 1F2AA 1CQDA 2B1MA 3PBHA 5EZQA 1AU2A 1MHWA 4YYUA 1CVZA 3RVWA 3GCBA 1PBHA 3E1ZB 1TL9A 1MEGA 4D8BA 2FE8A 2CIOA 4BOQA 3H6SA 3CH2X 4RF1A 3KKUA 1PE6A 2BU3A 3O1GA 4OELA 2R9FA 5EGWA 3V6CA 2VHFA 1U9XA 1NL6A 1K3BB 4BOZA 4ZUXU 3D6SA 4OW0A 4D8IA 3I06A 2JQFR 3WXFA 1Q6KA 3OF8A 4XZXA 3P5XA 3QT4A 1NPZA 1NQCA 3CBJA 3LFYA 3OISA 2PADA 4PP2E 4QRXA 2OZ2A 2FRAA 1PADA 1CSBB 1F2CA 2R6NA 4N4ZA 1VSNA 2C0YA 2HH5A 3RVXA
chains in the Genus database with same CATH topology
2HXZA 2DCCA 2PNSA 4QBBA 2FT2A 2OULA 4G54A 4PI3A 1PPNA 2Y5BA 4BPVA 2R9NA 2GHUA 3HD3A 4N8WA 4AXLA 3HHIA 2NQAA 1PPOA 2VFBA 5A24A 1ITOA 1W4TA 2YJ2A 4YVAA 1X9YA 3N4CA 3H89A 3BPFA 3V6EA 2XU3A 2NQDB 2AU1A 4CDFB 4BGFA 1CTEA 3KW9A 3S3QA 1AECA 1ME4A 2Y6EA 2P0RA 2YJCA 3CBKA 1AU3A 1AYUA 4MSXA 1KFUL 2H7JA 2FTDA 4W4UA 1TLOA 5JA7A 2DCBA 4XR7A 3O0UA 5CVOB 2F1GA 2G8EA 4PP1A 1QDQA 1AIMA 4I05A 1GMYA 2AYNA 2FQ9A 1KXRA 6PADA 2AVWA 2G6DA 4KLBA 1W6FA 2G8JA 1GX3A 3LTWA 2E02A 4AXMA 3P5VA 3HWNA 5J94A 2FRQA 2E03A 3P5WA 3C9EA 3ZUAA 1MS6A 1SNKA 2B1NA 3USVA 4FK5A 3CH3X 2GFOA 4YYWA 2BDZA 1CV8A 2ARYA 1EWPA 2NQIA 2ACTA 1FH0A 4WA6A 4FJCA 4HWYA 1POPA 3IV2A 1ATKA 2AIMA 4QRGA 2R9CA 1QOLA 2ATOA 2VHSA 4QRVA 4BQVA 3M99A 1M6DA 1CB5A 1DF0A 1Y08A 2R9MA 1BGOA 4DMYA 1GCBA 3LXSA 3PW3A 4YYRA 2E01A 3PDFA 3OVZA 2AYOA 3N3KA 2DC7A 5PADA 3IOQA 3TNXA 1NB3A 1EWLA 3KSEA 1KHPA 5EF4A 3H8BA 1GECE 3I3TA 3MORA 4Q8GA 7PCKA 1PPDA 3IMAA 4YYSA 1NLJA 3F5VA 4RY2A 3S3RA 1U9WA 1BY8A 1SP4B 1F29A 4NV7A 1YT7A 1EWMA 3K9MA 4YV8A 3OF9A 3KX1A 4I04A 1ZCMA 2XU5A 2P86A 1U5IA 2AUZA 4BSQA 1KFXL 1U9VA 2IBIA 3IEJA 1E2TA 4YYQA 2OP3A 1EF7A 3WXEA 1AYWA 2R9OA 1YK8A 1CS8A 3PNRA 2YJ8A 2DZYA 3K24A 1MIRA 2BDLA 3P5UA 4CDCB 4W5BA 5F02A 3K8UA 5CVNB 4YYVA 1NB5A 3HHAA 3NHEA 2BSZA 2VFCA 3QJ3A 3AI8A 4W5CA 4CDDB 1EWOA 1KHQA 3MHSA 1AYVA 4NV8A 3RVVA 1TU6A 1VJVA 1YALA 1MDWA 1STFE 8PCHA 4I07A 3DF0A 4CDEB 1DEUA 1JQPA 1QXPA 2G7YA 3IHPA 5CHVA 1PXVA 3U8EA 5FPWA 2O6XA 2P7UA 2CB5A 4OEMA 4X6JA 2FO5A 1AU0A 4BS5A 1IWDA 1PIPA 4K7CA 9PAPA 1ICFA 1U9QX 4QH6A 2FYEA 4Q8HA 1YVBA 4N79A 2YJ9A 1THEA 2DJGB 1ZIVA 2YJBA 3KFQA 2IPPB 1BQIA 1O0EA 2JQGR 1F2BA 5JH3A 3N3GA 3BOWA 1W5RA 4C5PA 4MZSA 2DCDA 1PPPA 4CZWA 4DMXA 1ME3A 2F7DA 1MEMA 3QSDA 4P6EA 3IUTA 4X6IA 1QMYA 2XU1A 3H8CA 5K16A 2PREA 2DZZA 3KWZA 5CHTA 3BC3A 1S4VA 5CVMA 3ERVA 2DC9A 2AUXA 4BS6A 3MTNA 1CJLA 2DCAA 4PADA 3WXGA 1BP4A 4XUIA 2DJFB 2NQGA 3OVXA 2AS8A 4P6GA 3H7DA 4MZOA 2WBFX 2HHNA 2PBHA 1PCIA 3F75A 2DC6A 3MHHA 2E00A 1GLOA 1HUCB 2FUDA 1Y4HA 4X6HA 2DC8A 3BWKA 3D9WA 3BPMA 1CPJA 1YK7A 2HD5A 3BCNA 1XKGA 1AU4A 3KWBX 4FIPA 2XU4A 1A6RA 3B79A 1F2AA 1CQDA 2B1MA 3PBHA 1AU2A 1MHWA 4YYUA 4B55A 1CVZA 3RVWA 3GCBA 4GUZA 1PBHA 3E1ZB 1TL9A 1MEGA 2CIOA 3H6SA 3CH2X 3KKUA 1PE6A 3O1GA 4OELA 2R9FA 5EGWA 3V6CA 2VHFA 1U9XA 1NL6A 1K3BB 4ZUXU 3D6SA 3I06A 2JQFR 3WXFA 1Q6KA 3OF8A 3P5XA 3QT4A 1NPZA 1NQCA 3CBJA 3LFYA 3OISA 2PADA 4PP2E 4QRXA 2OZ2A 2FRAA 1PADA 1CSBB 1F2CA 2R6NA 4N4ZA 1VSNA 2C0YA 2HH5A 3RVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXZ A;  2DCC A;  2PNS A;  4QBB A;  2FT2 A;  2OUL A;  4G54 A;  4PI3 A;  1PPN A;  2Y5B A;  4BPV A;  2R9N A;  2GHU A;  3HD3 A;  4N8W A;  4AXL A;  3HHI A;  2NQA A;  1PPO A;  5A24 A;  1ITO A;  4YVA A;  2YJ2 A;  1X9Y A;  3N4C A;  3H89 A;  3BPF A;  3V6E A;  2XU3 A;  2NQD B;  2AU1 A;  4CDF B;  1CTE A;  3KW9 A;  3S3Q A;  1AEC A;  1ME4 A;  2Y6E A;  2P0R A;  2YJC A;  3CBK A;  1AU3 A;  1AYU A;  4MSX A;  1KFU L;  2H7J A;  2FTD A;  4W4U A;  1TLO A;  5JA7 A;  2DCB A;  4XR7 A;  3O0U A;  5CVO B;  2F1G A;  2G8E A;  4PP1 A;  1QDQ A;  1AIM A;  4I05 A;  1GMY A;  2AYN A;  2FQ9 A;  1KXR A;  6PAD A;  2AVW A;  2G6D A;  4KLB A;  2G8J A;  2E02 A;  4AXM A;  3P5V A;  3HWN A;  5J94 A;  2FRQ A;  2E03 A;  3P5W A;  3C9E A;  3ZUA A;  1MS6 A;  1SNK A;  2B1N A;  3USV A;  4FK5 A;  3CH3 X;  2GFO A;  4YYW A;  2BDZ A;  1CV8 A;  2ARY A;  1EWP A;  2NQI A;  2ACT A;  1FH0 A;  4WA6 A;  4FJC A;  4HWY A;  1POP A;  3IV2 A;  1ATK A;  2AIM A;  4QRG A;  2R9C A;  1QOL A;  2ATO A;  2VHS A;  4QRV A;  4BQV A;  3M99 A;  1M6D A;  1CB5 A;  1DF0 A;  1Y08 A;  2R9M A;  1BGO A;  4DMY A;  1GCB A;  3LXS A;  3PW3 A;  4YYR A;  2E01 A;  3PDF A;  3OVZ A;  2AYO A;  3N3K A;  2DC7 A;  5PAD A;  3IOQ A;  3TNX A;  1NB3 A;  1EWL A;  3KSE A;  1KHP A;  5EF4 A;  3H8B A;  1GEC E;  3I3T A;  3MOR A;  4Q8G A;  7PCK A;  1PPD A;  3IMA A;  4YYS A;  1NLJ A;  3F5V A;  4RY2 A;  3S3R A;  1U9W A;  1BY8 A;  1SP4 B;  1F29 A;  1YT7 A;  1EWM A;  3K9M A;  4YV8 A;  3OF9 A;  3KX1 A;  4I04 A;  1ZCM A;  2XU5 A;  2P86 A;  1U5I A;  2AUZ A;  4BSQ A;  1KFX L;  1U9V A;  2IBI A;  3IEJ A;  4YYQ A;  2OP3 A;  1EF7 A;  3WXE A;  1AYW A;  2R9O A;  1YK8 A;  1CS8 A;  3PNR A;  2YJ8 A;  2DZY A;  3K24 A;  1MIR A;  2BDL A;  3P5U A;  4CDC B;  4W5B A;  5F02 A;  3K8U A;  5CVN B;  4YYV A;  1NB5 A;  3HHA A;  3NHE A;  3QJ3 A;  3AI8 A;  4W5C A;  4CDD B;  1EWO A;  1KHQ A;  3MHS A;  1AYV A;  3RVV A;  1TU6 A;  1VJV A;  1YAL A;  1MDW A;  1STF E;  8PCH A;  4I07 A;  3DF0 A;  4CDE B;  1DEU A;  1JQP A;  1QXP A;  2G7Y A;  3IHP A;  5CHV A;  1PXV A;  3U8E A;  5FPW A;  2O6X A;  2P7U A;  2CB5 A;  4OEM A;  4X6J A;  2FO5 A;  1AU0 A;  4BS5 A;  1IWD A;  1PIP A;  4K7C A;  9PAP A;  1ICF A;  1U9Q X;  4QH6 A;  2FYE A;  4Q8H A;  1YVB A;  4N79 A;  2YJ9 A;  1THE A;  2DJG B;  1ZIV A;  2YJB A;  3KFQ A;  2IPP B;  1BQI A;  1O0E A;  2JQG R;  1F2B A;  5JH3 A;  3N3G A;  3BOW A;  4MZS A;  2DCD A;  1PPP A;  4CZW A;  4DMX A;  1ME3 A;  2F7D A;  1MEM A;  3QSD A;  4P6E A;  3IUT A;  4X6I A;  1QMY A;  2XU1 A;  3H8C A;  5K16 A;  2PRE A;  2DZZ A;  3KWZ A;  5CHT A;  3BC3 A;  1S4V A;  5CVM A;  3ERV A;  2DC9 A;  2AUX A;  4BS6 A;  3MTN A;  1CJL A;  2DCA A;  4PAD A;  3WXG A;  1BP4 A;  4XUI A;  2DJF B;  2NQG A;  3OVX A;  2AS8 A;  4P6G A;  3H7D A;  4MZO A;  2WBF X;  2HHN A;  2PBH A;  1PCI A;  3F75 A;  2DC6 A;  3MHH A;  2E00 A;  1GLO A;  1HUC B;  2FUD A;  1Y4H A;  4X6H A;  2DC8 A;  3BWK A;  3BPM A;  1CPJ A;  1YK7 A;  2HD5 A;  3BCN A;  1XKG A;  1AU4 A;  3KWB X;  4FIP A;  2XU4 A;  1A6R A;  3B79 A;  1F2A A;  1CQD A;  2B1M A;  3PBH A;  1AU2 A;  1MHW A;  4YYU A;  1CVZ A;  3RVW A;  3GCB A;  1PBH A;  3E1Z B;  1TL9 A;  1MEG A;  2CIO A;  3H6S A;  3CH2 X;  3KKU A;  1PE6 A;  3O1G A;  4OEL A;  2R9F A;  5EGW A;  3V6C A;  2VHF A;  1U9X A;  1NL6 A;  1K3B B;  4ZUX U;  3D6S A;  3I06 A;  2JQF R;  3WXF A;  1Q6K A;  3OF8 A;  3P5X A;  3QT4 A;  1NPZ A;  1NQC A;  3CBJ A;  3LFY A;  3OIS A;  2PAD A;  4PP2 E;  4QRX A;  2OZ2 A;  2FRA A;  1PAD A;  1CSB B;  1F2C A;  2R6N A;  4N4Z A;  1VSN A;  2C0Y A;  2HH5 A;  3RVX A; 
#chains in the Genus database with same CATH topology
 2HXZ A;  2DCC A;  2PNS A;  4QBB A;  2FT2 A;  2OUL A;  4G54 A;  4PI3 A;  1PPN A;  4BOU A;  5JZE A;  2Y5B A;  4BPV A;  2R9N A;  4R3D A;  2GHU A;  3HD3 A;  4N8W A;  4AXL A;  3PHU A;  3HHI A;  2NQA A;  1PPO A;  5A24 A;  1UKF A;  2J7Q C;  4HXD B;  1ITO A;  4YVA A;  2YJ2 A;  1X9Y A;  3N4C A;  3H89 A;  3BPF A;  3V6E A;  2XU3 A;  2NQD B;  2AU1 A;  4CDF B;  1CTE A;  3PSE A;  3KW9 A;  3S3Q A;  1AEC A;  1ME4 A;  2Y6E A;  2P0R A;  2YJC A;  3CBK A;  1AU3 A;  1AYU A;  4MSX A;  1KFU L;  2H7J A;  2FTD A;  4W4U A;  1TLO A;  5JA7 A;  2DCB A;  4XR7 A;  3O0U A;  5CVO B;  2F1G A;  2G8E A;  4PP1 A;  1QDQ A;  1YZB A;  1AIM A;  4I05 A;  1GMY A;  4MI7 A;  2AYN A;  4BOS A;  2FQ9 A;  1KXR A;  6PAD A;  2JRI A;  4D8E A;  2AVW A;  2G6D A;  4KLB A;  2G8J A;  4REZ A;  2E02 A;  4AXM A;  3P5V A;  3HWN A;  5J94 A;  4WUR A;  2FRQ A;  2E03 A;  3P5W A;  3C9E A;  3MJ5 A;  3ZUA A;  1MS6 A;  3OQC A;  1SNK A;  2B1N A;  3USV A;  4FK5 A;  4IUM A;  1DKI A;  3CH3 X;  2GFO A;  4YYW A;  2BDZ A;  1CV8 A;  2ARY A;  1EWP A;  2NQI A;  2ACT A;  1FH0 A;  4WA6 A;  4FJC A;  4HWY A;  1POP A;  3IV2 A;  1ATK A;  2AIM A;  4QRG A;  2R9C A;  4OVZ A;  1QOL A;  2ATO A;  2VHS A;  4QRV A;  4BQV A;  3M99 A;  1M6D A;  1CB5 A;  1DF0 A;  3W31 A;  1Y08 A;  2R9M A;  1BGO A;  4DMY A;  1GCB A;  3LXS A;  3PW3 A;  4YYR A;  2E01 A;  3PDF A;  3OVZ A;  2AYO A;  3N3K A;  2DC7 A;  5PAD A;  3IOQ A;  3TNX A;  1NB3 A;  1EWL A;  3KSE A;  1KHP A;  5EF4 A;  3H8B A;  4ZTB A;  1GEC E;  3PHW A;  3I3T A;  3MOR A;  4Q8G A;  7PCK A;  1PPD A;  3IMA A;  4YYS A;  1NLJ A;  3F5V A;  3TMP A;  2JTC A;  4RY2 A;  3S3R A;  1U9W A;  1BY8 A;  1SP4 B;  1F29 A;  1YT7 A;  4GUA A;  2AGA A;  1EWM A;  3IFU A;  3K9M A;  4RKX A;  4YV8 A;  4PT5 A;  3OF9 A;  3KX1 A;  3PRP A;  4I04 A;  1ZCM A;  2XU5 A;  2P86 A;  2UZJ A;  1U5I A;  2BTW A;  2AUZ A;  5EZS A;  4BSQ A;  1KFX L;  1U9V A;  2IBI A;  3IEJ A;  4YYQ A;  2OP3 A;  1EF7 A;  4MM3 B;  3WXE A;  1AYW A;  2R9O A;  1YK8 A;  1CS8 A;  3PNR A;  2YJ8 A;  2DZY A;  3K24 A;  1MIR A;  2BDL A;  3P5U A;  4CDC B;  1PVJ A;  2DOS A;  4W5B A;  4A5U A;  5F02 A;  3K8U A;  5CVN B;  4YYV A;  1NB5 A;  3HHA A;  3NHE A;  3MP2 A;  4P16 A;  3QJ3 A;  3ZNH A;  3AI8 A;  4W5C A;  4CDD B;  1EWO A;  3B21 A;  1KHQ A;  3BY4 A;  3MHS A;  1AYV A;  3RVV A;  1TU6 A;  1VJV A;  1YAL A;  1MDW A;  1STF E;  8PCH A;  4I07 A;  2BTW B;  3DF0 A;  4CDE B;  1DEU A;  1JQP A;  1QXP A;  2G7Y A;  3IHP A;  5CHV A;  1PXV A;  3PT2 A;  3U8E A;  5FPW A;  2O6X A;  3MTV A;  2P7U A;  3W30 A;  2CB5 A;  4OEM A;  2HWK A;  4X6J A;  2FO5 A;  1AU0 A;  4BS5 A;  3RNV A;  1IWD A;  1PIP A;  4K7C A;  9PAP A;  1ICF A;  1U9Q X;  4QH6 A;  4BOP A;  2FYE A;  4Q8H A;  1YVB A;  4N79 A;  2YJ9 A;  1THE A;  2DJG B;  1ZIV A;  3O65 A;  2YJB A;  3KFQ A;  4OVZ B;  2IPP B;  1BQI A;  1O0E A;  2JQG R;  1F2B A;  3C0R A;  5JH3 A;  3N3G A;  3BOW A;  5KO3 A;  4MZS A;  2DCD A;  4IP3 A;  1PPP A;  4CZW A;  4DMX A;  1ME3 A;  2F7D A;  1MEM A;  4M0W A;  3BBA A;  3QSD A;  4P6E A;  3IUT A;  4X6I A;  1QMY A;  4RNA A;  2XU1 A;  3BB7 A;  3H8C A;  3PRM A;  5K16 A;  2PRE A;  2DZZ A;  3KWZ A;  5CHT A;  3BC3 A;  1S4V A;  5CVM A;  3ERV A;  2DC9 A;  2AUX A;  4BS6 A;  3MTN A;  1CJL A;  2DCA A;  4PAD A;  3WXG A;  1BP4 A;  4XUI A;  2DJF B;  2NQG A;  3OVX A;  2AS8 A;  4RF0 A;  4P6G A;  3H7D A;  4MZO A;  2WBF X;  2HHN A;  2PBH A;  1PCI A;  3F75 A;  2DC6 A;  3MHH A;  2E00 A;  3TRK A;  1GLO A;  1HUC B;  2FUD A;  3PHX A;  1Y4H A;  4X6H A;  2DC8 A;  3BWK A;  5E6J A;  3BPM A;  1CPJ A;  1YK7 A;  3E9S A;  2HD5 A;  2Z84 A;  3BCN A;  2J7Q A;  1XKG A;  1AU4 A;  3KWB X;  4FIP A;  2XU4 A;  1A6R A;  3B79 A;  1F2A A;  1CQD A;  2B1M A;  3PBH A;  5EZQ A;  1AU2 A;  1MHW A;  4YYU A;  1CVZ A;  3RVW A;  3GCB A;  1PBH A;  3E1Z B;  1TL9 A;  1MEG A;  4D8B A;  2FE8 A;  2CIO A;  4BOQ A;  3H6S A;  3CH2 X;  4RF1 A;  3KKU A;  1PE6 A;  2BU3 A;  3O1G A;  4OEL A;  2R9F A;  5EGW A;  3V6C A;  2VHF A;  1U9X A;  1NL6 A;  1K3B B;  4BOZ A;  4ZUX U;  3D6S A;  4OW0 A;  4D8I A;  3I06 A;  2JQF R;  3WXF A;  1Q6K A;  3OF8 A;  4XZX A;  3P5X A;  3QT4 A;  1NPZ A;  1NQC A;  3CBJ A;  3LFY A;  3OIS A;  2PAD A;  4PP2 E;  4QRX A;  2OZ2 A;  2FRA A;  1PAD A;  1CSB B;  1F2C A;  2R6N A;  4N4Z A;  1VSN A;  2C0Y A;  2HH5 A;  3RVX A; 
#chains in the Genus database with same CATH homology
 2HXZ A;  2DCC A;  2PNS A;  4QBB A;  2FT2 A;  2OUL A;  4G54 A;  4PI3 A;  1PPN A;  2Y5B A;  4BPV A;  2R9N A;  2GHU A;  3HD3 A;  4N8W A;  4AXL A;  3HHI A;  2NQA A;  1PPO A;  2VFB A;  5A24 A;  1ITO A;  1W4T A;  2YJ2 A;  4YVA A;  1X9Y A;  3N4C A;  3H89 A;  3BPF A;  3V6E A;  2XU3 A;  2NQD B;  2AU1 A;  4CDF B;  4BGF A;  1CTE A;  3KW9 A;  3S3Q A;  1AEC A;  1ME4 A;  2Y6E A;  2P0R A;  2YJC A;  3CBK A;  1AU3 A;  1AYU A;  4MSX A;  1KFU L;  2H7J A;  2FTD A;  4W4U A;  1TLO A;  5JA7 A;  2DCB A;  4XR7 A;  3O0U A;  5CVO B;  2F1G A;  2G8E A;  4PP1 A;  1QDQ A;  1AIM A;  4I05 A;  1GMY A;  2AYN A;  2FQ9 A;  1KXR A;  6PAD A;  2AVW A;  2G6D A;  4KLB A;  1W6F A;  2G8J A;  1GX3 A;  3LTW A;  2E02 A;  4AXM A;  3P5V A;  3HWN A;  5J94 A;  2FRQ A;  2E03 A;  3P5W A;  3C9E A;  3ZUA A;  1MS6 A;  1SNK A;  2B1N A;  3USV A;  4FK5 A;  3CH3 X;  2GFO A;  4YYW A;  2BDZ A;  1CV8 A;  2ARY A;  1EWP A;  2NQI A;  2ACT A;  1FH0 A;  4WA6 A;  4FJC A;  4HWY A;  1POP A;  3IV2 A;  1ATK A;  2AIM A;  4QRG A;  2R9C A;  1QOL A;  2ATO A;  2VHS A;  4QRV A;  4BQV A;  3M99 A;  1M6D A;  1CB5 A;  1DF0 A;  1Y08 A;  2R9M A;  1BGO A;  4DMY A;  1GCB A;  3LXS A;  3PW3 A;  4YYR A;  2E01 A;  3PDF A;  3OVZ A;  2AYO A;  3N3K A;  2DC7 A;  5PAD A;  3IOQ A;  3TNX A;  1NB3 A;  1EWL A;  3KSE A;  1KHP A;  5EF4 A;  3H8B A;  1GEC E;  3I3T A;  3MOR A;  4Q8G A;  7PCK A;  1PPD A;  3IMA A;  4YYS A;  1NLJ A;  3F5V A;  4RY2 A;  3S3R A;  1U9W A;  1BY8 A;  1SP4 B;  1F29 A;  4NV7 A;  1YT7 A;  1EWM A;  3K9M A;  4YV8 A;  3OF9 A;  3KX1 A;  4I04 A;  1ZCM A;  2XU5 A;  2P86 A;  1U5I A;  2AUZ A;  4BSQ A;  1KFX L;  1U9V A;  2IBI A;  3IEJ A;  1E2T A;  4YYQ A;  2OP3 A;  1EF7 A;  3WXE A;  1AYW A;  2R9O A;  1YK8 A;  1CS8 A;  3PNR A;  2YJ8 A;  2DZY A;  3K24 A;  1MIR A;  2BDL A;  3P5U A;  4CDC B;  4W5B A;  5F02 A;  3K8U A;  5CVN B;  4YYV A;  1NB5 A;  3HHA A;  3NHE A;  2BSZ A;  2VFC A;  3QJ3 A;  3AI8 A;  4W5C A;  4CDD B;  1EWO A;  1KHQ A;  3MHS A;  1AYV A;  4NV8 A;  3RVV A;  1TU6 A;  1VJV A;  1YAL A;  1MDW A;  1STF E;  8PCH A;  4I07 A;  3DF0 A;  4CDE B;  1DEU A;  1JQP A;  1QXP A;  2G7Y A;  3IHP A;  5CHV A;  1PXV A;  3U8E A;  5FPW A;  2O6X A;  2P7U A;  2CB5 A;  4OEM A;  4X6J A;  2FO5 A;  1AU0 A;  4BS5 A;  1IWD A;  1PIP A;  4K7C A;  9PAP A;  1ICF A;  1U9Q X;  4QH6 A;  2FYE A;  4Q8H A;  1YVB A;  4N79 A;  2YJ9 A;  1THE A;  2DJG B;  1ZIV A;  2YJB A;  3KFQ A;  2IPP B;  1BQI A;  1O0E A;  2JQG R;  1F2B A;  5JH3 A;  3N3G A;  3BOW A;  1W5R A;  4C5P A;  4MZS A;  2DCD A;  1PPP A;  4CZW A;  4DMX A;  1ME3 A;  2F7D A;  1MEM A;  3QSD A;  4P6E A;  3IUT A;  4X6I A;  1QMY A;  2XU1 A;  3H8C A;  5K16 A;  2PRE A;  2DZZ A;  3KWZ A;  5CHT A;  3BC3 A;  1S4V A;  5CVM A;  3ERV A;  2DC9 A;  2AUX A;  4BS6 A;  3MTN A;  1CJL A;  2DCA A;  4PAD A;  3WXG A;  1BP4 A;  4XUI A;  2DJF B;  2NQG A;  3OVX A;  2AS8 A;  4P6G A;  3H7D A;  4MZO A;  2WBF X;  2HHN A;  2PBH A;  1PCI A;  3F75 A;  2DC6 A;  3MHH A;  2E00 A;  1GLO A;  1HUC B;  2FUD A;  1Y4H A;  4X6H A;  2DC8 A;  3BWK A;  3D9W A;  3BPM A;  1CPJ A;  1YK7 A;  2HD5 A;  3BCN A;  1XKG A;  1AU4 A;  3KWB X;  4FIP A;  2XU4 A;  1A6R A;  3B79 A;  1F2A A;  1CQD A;  2B1M A;  3PBH A;  1AU2 A;  1MHW A;  4YYU A;  4B55 A;  1CVZ A;  3RVW A;  3GCB A;  4GUZ A;  1PBH A;  3E1Z B;  1TL9 A;  1MEG A;  2CIO A;  3H6S A;  3CH2 X;  3KKU A;  1PE6 A;  3O1G A;  4OEL A;  2R9F A;  5EGW A;  3V6C A;  2VHF A;  1U9X A;  1NL6 A;  1K3B B;  4ZUX U;  3D6S A;  3I06 A;  2JQF R;  3WXF A;  1Q6K A;  3OF8 A;  3P5X A;  3QT4 A;  1NPZ A;  1NQC A;  3CBJ A;  3LFY A;  3OIS A;  2PAD A;  4PP2 E;  4QRX A;  2OZ2 A;  2FRA A;  1PAD A;  1CSB B;  1F2C A;  2R6N A;  4N4Z A;  1VSN A;  2C0Y A;  2HH5 A;  3RVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...