1X9YA

The prostaphopain b structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
346
Chain Sequence
b'KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cysteine proteinase
publication title Prostaphopain B structure: a comparison of proregion-mediated and staphostatin-mediated protease inhibition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 116
structure length 346
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
A PF14731 Staphopain_pro Staphopain proregion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.500.10 Alpha Beta Roll prostaphopain b, domain 1 Staphopain proregion domain 1x9yA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1x9yA02
1CPJA 2OULA 3HD3A 1ITOA 3KWBX 1YALA 4HWYA 2FQ9A 3BOWA 1U9QX 1ATKA 1TL9A 4PI3A 4CDEB 2ARYA 4W5BA 5PADA 3BCNA 1PCIA 4YYSA 1U9XA 4CDCB 1BQIA 1YK8A 3NHEA 2R9CA 4P6GA 1KFUL 2Y5BA 1EWLA 3D6SA 1VJVA 7PCKA 5JA7A 4YVAA 4QBBA 1Y4HA 1QDQA 2FYEA 4MZSA 4QH6A 3MHSA 3M99A 3CH3X 4I05A 3K8UA 1EF7A 4Q8HA 1POPA 3P5VA 1CTEA 1ME3A 1BY8A 1Q6KA 2FRQA 1DF0A 2HD5A 3TNXA 2DZYA 2NQDB 1BGOA 2B1MA 3F5VA 3WXGA 2YJBA 1GECE 1TLOA 3LXSA 4PADA 3KSEA 2VHSA 5K16A 5JH3A 4DMXA 2IPPB 3N3KA 1PIPA 3CBJA 4I04A 4BPVA 1MIRA 3H8BA 2YJ9A 2F7DA 2BDLA 1EWOA 2AS8A 2AYOA 1THEA 1KXRA 3WXFA 1NB5A 4X6HA 1GCBA 2XU5A 3IMAA 1NLJA 1HUCB 1STFE 2DCDA 2VHFA 4BS5A 4Q8GA 3HHIA 2R9MA 3P5UA 1DEUA 4AXMA 3OISA 2JQGR 2PBHA 1K3BB 5CVMA 4CDFB 3IOQA 1O0EA 3S3QA 1SP4B 1KFXL 1AU3A 3N3GA 1Y08A 2OZ2A 3KKUA 3ZUAA 1TU6A 4W5CA 1XKGA 2YJ2A 2G7YA 4FIPA 1CJLA 3AI8A 2DJFB 3IV2A 2FO5A 3BWKA 1A6RA 4I07A 2DCCA 5EF4A 3OF9A 3V6CA 2AUZA 2YJCA 4YYQA 3PDFA 1MDWA 2AIMA 3PBHA 3MHHA 3WXEA 3IUTA 1CB5A 1BP4A 4P6EA 4PP2E 1CQDA 1AU0A 1YK7A 3H6SA 1PADA 2R9NA 5EGWA 3P5WA 2PREA 1M6DA 2OP3A 1S4VA 5CVOB 1GMYA 4YYWA 3V6EA 4QRVA 1NL6A 1PPOA 1QMYA 1MHWA 4FJCA 2R9OA 1F29A 1EWMA 2BDZA 2IBIA 2DC7A 2E03A 4CDDB 4QRGA 2DJGB 2HH5A 1U5IA 4XUIA 4KLBA 1AECA 5J94A 4N79A 2YJ8A 1AYVA 2P0RA 4BSQA 3BPFA 4MSXA 2E00A 1CV8A 3LFYA 2XU3A 1AYUA 2P7UA 1U9WA 3PNRA 3K24A 2G6DA 3BC3A 3K9MA 3C9EA 1YVBA 1FH0A 3E1ZB 1GLOA 5CHVA 3H89A 3DF0A 3IEJA 3S3RA 4G54A 4QRXA 4MZOA 1VSNA 4RY2A 4CZWA 1PBHA 2CB5A 4FK5A 4N4ZA 2AYNA 1ICFA 2G8JA 2XU1A 3QSDA 3RVWA 3RVVA 2ACTA 1F2AA 3OVZA 1QXPA 4OEMA 4DMYA 1MS6A 2F1GA 1PPDA 2AU1A 2DC6A 2AVWA 2HHNA 2G8EA 2NQGA 2H7JA 1KHPA 2DC8A 1ME4A 1X9YA 3QJ3A 3H7DA 5CVNB 4YV8A 2Y6EA 2DCBA 3U8EA 3HWNA 3RVXA 2XU4A 3BPMA 3MTNA 2JQFR 3H8CA 4YYUA 3CH2X 3OVXA 2P86A 3KW9A 8PCHA 1PXVA 1CVZA 4W4UA 4XR7A 3CBKA 2NQAA 3HHAA 2FRAA 4X6IA 2C0YA 2E01A 4ZUXU 4YYRA 1AU2A 5A24A 3MORA 1F2CA 4AXLA 4PP1A 2R9FA 2DC9A 4BQVA 1YT7A 3N4CA 3B79A 3ERVA 4WA6A 1PE6A 1SNKA 4N8WA 3KWZA 2FT2A 1EWPA 1CS8A 1PPNA 4K7CA 2GFOA 3KFQA 5FPWA 3USVA 4YYVA 4X6JA 3OF8A 6PADA 1ZIVA 3I3TA 2AUXA 2E02A 3QT4A 2ATOA 3I06A 1PPPA 3KX1A 1QOLA 2CIOA 2R6NA 2PNSA 3F75A 1MEMA 1NQCA 3PW3A 1AIMA 2O6XA 2FUDA 1CSBB 1NB3A 1AYWA 3O0UA 2HXZA 2B1NA 2DCAA 4BS6A 3IHPA 1ZCMA 4OELA 3O1GA 2FTDA 1IWDA 5CHTA 2GHUA 1AU4A 1U9VA 1KHQA 5F02A 2PADA 1NPZA 1F2BA 1JQPA 3GCBA 1MEGA 2DZZA 2NQIA 9PAPA 3P5XA 2WBFX
chains in the Genus database with same CATH superfamily
1CPJA 2OULA 3HD3A 1ITOA 2BTWA 3KWBX 3W30A 1YALA 4HWYA 2FQ9A 3BOWA 1U9QX 1ATKA 1TL9A 4PI3A 4CDEB 2ARYA 4W5BA 5PADA 3BCNA 1PCIA 4YYSA 1U9XA 3O65A 4RF1A 4CDCB 1BQIA 1YK8A 3NHEA 4OW0A 2R9CA 4P6GA 1KFUL 2Y5BA 1EWLA 3D6SA 1VJVA 7PCKA 5JA7A 4YVAA 4QBBA 1Y4HA 1QDQA 2FYEA 4MZSA 4QH6A 3PHXA 3MHSA 3M99A 3CH3X 4I05A 3K8UA 1EF7A 4Q8HA 3B21A 1POPA 3P5VA 3BBAA 1CTEA 1ME3A 1BY8A 1Q6KA 2FRQA 1DF0A 2HD5A 3TNXA 2DZYA 4M0WA 2NQDB 1BGOA 2B1MA 3F5VA 3WXGA 2YJBA 1GECE 1TLOA 3LXSA 4PADA 3KSEA 2VHSA 5K16A 5JH3A 4A5UA 4DMXA 2IPPB 3N3KA 1PIPA 3CBJA 4I04A 4BPVA 1MIRA 3H8BA 5E6JA 2YJ9A 2F7DA 2BDLA 1EWOA 2AS8A 2AYOA 2BTWB 1THEA 1KXRA 3WXFA 1NB5A 4X6HA 1GCBA 2XU5A 3IMAA 1NLJA 1HUCB 1STFE 4HXDB 2DCDA 2VHFA 4BS5A 4Q8GA 3HHIA 2R9MA 3P5UA 1DEUA 4AXMA 3OISA 2JQGR 2PBHA 1K3BB 5CVMA 4CDFB 4GUAA 2JTCA 2J7QC 3IOQA 1O0EA 3S3QA 1SP4B 1KFXL 4BOPA 1AU3A 1PVJA 3RNVA 3N3GA 1Y08A 2OZ2A 3KKUA 3ZUAA 1TU6A 4W5CA 1XKGA 2YJ2A 3PT2A 2G7YA 4FIPA 1CJLA 3AI8A 2DJFB 3BY4A 3IV2A 2FO5A 3BWKA 1A6RA 4I07A 2DCCA 5EF4A 3OF9A 3V6CA 2AUZA 2YJCA 4YYQA 3PDFA 1MDWA 2AIMA 3PBHA 3MHHA 3WXEA 3IUTA 1CB5A 1BP4A 4P6EA 4PP2E 1CQDA 1AU0A 1YK7A 3H6SA 1PADA 2R9NA 1YZBA 5EGWA 3P5WA 2PREA 5JZEA 1M6DA 2OP3A 1S4VA 5CVOB 1GMYA 4YYWA 2AGAA 3IFUA 3V6EA 4QRVA 1NL6A 3C0RA 1PPOA 4BOUA 4RNAA 1QMYA 1MHWA 4FJCA 2R9OA 1F29A 2UZJA 1EWMA 2BDZA 2IBIA 3MP2A 2DC7A 2E03A 4CDDB 4D8IA 4QRGA 2DJGB 2HH5A 1U5IA 4XUIA 4KLBA 1AECA 5J94A 4N79A 2YJ8A 1AYVA 2P0RA 4BSQA 3BPFA 4MSXA 2E00A 1CV8A 3LFYA 2XU3A 1AYUA 2P7UA 1U9WA 3PNRA 4BOZA 2DOSA 3K24A 4IP3A 2G6DA 3BC3A 3K9MA 3C9EA 1YVBA 1FH0A 4BOQA 3E1ZB 1GLOA 4P16A 5CHVA 3PHUA 3H89A 4RF0A 3DF0A 2HWKA 3IEJA 4MM3B 3S3RA 3PSEA 4G54A 4QRXA 4MZOA 1VSNA 4RY2A 4CZWA 1PBHA 2CB5A 4FK5A 4N4ZA 2AYNA 4XZXA 1ICFA 2G8JA 2XU1A 3QSDA 3RVWA 3RVVA 2ACTA 1F2AA 3OVZA 1QXPA 3TRKA 2JRIA 4OEMA 4DMYA 1MS6A 3PHWA 4PT5A 4REZA 2F1GA 4MI7A 1PPDA 2AU1A 2DC6A 4OVZA 2AVWA 2HHNA 2BU3A 2G8EA 2NQGA 2H7JA 1KHPA 2DC8A 1ME4A 1X9YA 5EZSA 3QJ3A 3H7DA 5CVNB 4YV8A 2Y6EA 2DCBA 3BB7A 3W31A 3U8EA 3HWNA 4WURA 3PRPA 3RVXA 2XU4A 3BPMA 3MTNA 2JQFR 3H8CA 4YYUA 3CH2X 3E9SA 3OVXA 2P86A 3KW9A 8PCHA 1PXVA 1CVZA 4W4UA 4XR7A 3CBKA 2NQAA 3HHAA 2FRAA 4X6IA 2C0YA 2E01A 3ZNHA 4ZUXU 4YYRA 1AU2A 5A24A 3MORA 1F2CA 4AXLA 4PP1A 2R9FA 2DC9A 3OQCA 1YT7A 4BQVA 3N4CA 3B79A 1DKIA 4IUMA 4R3DA 5KO3A 3ERVA 4WA6A 1PE6A 1SNKA 5EZQA 4N8WA 2J7QA 3KWZA 2FT2A 1EWPA 1CS8A 1PPNA 4K7CA 2Z84A 2GFOA 3KFQA 4OVZB 5FPWA 3USVA 4YYVA 2FE8A 4X6JA 3OF8A 6PADA 1ZIVA 3I3TA 2AUXA 2E02A 3QT4A 2ATOA 3I06A 1PPPA 3KX1A 4RKXA 1QOLA 1UKFA 2CIOA 2R6NA 2PNSA 3F75A 1MEMA 1NQCA 3MTVA 3PW3A 1AIMA 3PRMA 2O6XA 2FUDA 1CSBB 1NB3A 3MJ5A 1AYWA 3O0UA 2HXZA 2B1NA 2DCAA 3TMPA 4BS6A 3IHPA 1ZCMA 4OELA 4ZTBA 4D8BA 3O1GA 2FTDA 1IWDA 5CHTA 2GHUA 1AU4A 1U9VA 1KHQA 5F02A 2PADA 1NPZA 1F2BA 4BOSA 1JQPA 3GCBA 4D8EA 1MEGA 2DZZA 2NQIA 9PAPA 3P5XA 2WBFX
chains in the Genus database with same CATH topology
1CPJA 2OULA 3HD3A 1ITOA 4C5PA 3KWBX 1YALA 4HWYA 2FQ9A 3BOWA 2BSZA 1U9QX 1ATKA 1TL9A 4PI3A 4CDEB 2ARYA 4W5BA 5PADA 3BCNA 1PCIA 4YYSA 1U9XA 4CDCB 1BQIA 1YK8A 3NHEA 2R9CA 4P6GA 1KFUL 2Y5BA 1EWLA 3D6SA 1VJVA 7PCKA 5JA7A 4YVAA 4QBBA 1Y4HA 1QDQA 2FYEA 4MZSA 4QH6A 3MHSA 3M99A 3CH3X 4I05A 3K8UA 1EF7A 4Q8HA 1POPA 3P5VA 1CTEA 1ME3A 1BY8A 1Q6KA 2FRQA 1DF0A 2HD5A 3TNXA 2DZYA 2NQDB 1BGOA 2B1MA 3F5VA 3WXGA 2YJBA 1GECE 1TLOA 3LXSA 4PADA 3KSEA 2VHSA 5K16A 5JH3A 4DMXA 2IPPB 3N3KA 1PIPA 3CBJA 4I04A 4BPVA 1MIRA 3H8BA 2YJ9A 2F7DA 2BDLA 1EWOA 2AS8A 2AYOA 1THEA 1KXRA 3WXFA 1NB5A 4X6HA 1GCBA 2XU5A 3IMAA 1NLJA 1HUCB 1STFE 2DCDA 2VHFA 4BS5A 4Q8GA 3HHIA 2R9MA 3P5UA 1DEUA 4AXMA 4GUZA 3OISA 2JQGR 2PBHA 1K3BB 5CVMA 4CDFB 3IOQA 1O0EA 3S3QA 1SP4B 1KFXL 1AU3A 3N3GA 1Y08A 2OZ2A 3KKUA 3ZUAA 1TU6A 4W5CA 1XKGA 2YJ2A 2G7YA 4FIPA 1CJLA 3AI8A 2DJFB 3IV2A 2FO5A 3BWKA 1A6RA 4I07A 2DCCA 5EF4A 3OF9A 3V6CA 1W4TA 2AUZA 2YJCA 4YYQA 3PDFA 1MDWA 2AIMA 3PBHA 3MHHA 3WXEA 3IUTA 1CB5A 1BP4A 4P6EA 4PP2E 1CQDA 4B55A 1AU0A 1YK7A 4NV7A 3H6SA 1PADA 2R9NA 5EGWA 3P5WA 2PREA 1M6DA 2OP3A 1S4VA 5CVOB 1GMYA 4YYWA 3V6EA 4QRVA 3D9WA 1NL6A 1PPOA 1E2TA 1QMYA 1MHWA 4FJCA 2R9OA 1F29A 1EWMA 2BDZA 2IBIA 2DC7A 2E03A 4CDDB 2VFBA 4QRGA 2DJGB 2HH5A 1U5IA 4XUIA 4KLBA 1AECA 5J94A 4N79A 2YJ8A 1AYVA 2P0RA 4BSQA 3BPFA 4MSXA 2VFCA 2E00A 1CV8A 3LFYA 2XU3A 1AYUA 2P7UA 1U9WA 3PNRA 3K24A 2G6DA 3BC3A 3K9MA 3C9EA 1YVBA 1FH0A 3E1ZB 1GX3A 1GLOA 5CHVA 3LTWA 3H89A 3DF0A 3IEJA 3S3RA 4G54A 4QRXA 4MZOA 1VSNA 4RY2A 4CZWA 1PBHA 2CB5A 4FK5A 4N4ZA 2AYNA 1W6FA 1ICFA 2G8JA 2XU1A 3QSDA 3RVWA 4BGFA 3RVVA 2ACTA 1F2AA 3OVZA 1QXPA 4OEMA 4DMYA 1MS6A 2F1GA 1PPDA 2AU1A 2DC6A 1W5RA 2AVWA 2HHNA 2G8EA 2NQGA 2H7JA 1KHPA 2DC8A 1ME4A 1X9YA 3QJ3A 3H7DA 5CVNB 4YV8A 2Y6EA 2DCBA 3U8EA 3HWNA 3RVXA 2XU4A 3BPMA 3MTNA 2JQFR 3H8CA 4YYUA 3CH2X 3OVXA 2P86A 3KW9A 8PCHA 1PXVA 1CVZA 4W4UA 4XR7A 3CBKA 2NQAA 3HHAA 2FRAA 4X6IA 2C0YA 2E01A 4ZUXU 4YYRA 1AU2A 5A24A 3MORA 1F2CA 4AXLA 4PP1A 2R9FA 2DC9A 4BQVA 1YT7A 3N4CA 3B79A 3ERVA 4WA6A 1PE6A 1SNKA 4N8WA 3KWZA 2FT2A 1EWPA 1CS8A 1PPNA 4K7CA 2GFOA 3KFQA 5FPWA 3USVA 4YYVA 4X6JA 3OF8A 6PADA 1ZIVA 3I3TA 2AUXA 2E02A 3QT4A 2ATOA 3I06A 1PPPA 3KX1A 1QOLA 2CIOA 2R6NA 2PNSA 3F75A 1MEMA 1NQCA 3PW3A 1AIMA 2O6XA 2FUDA 1CSBB 1NB3A 1AYWA 3O0UA 2HXZA 2B1NA 2DCAA 4BS6A 3IHPA 1ZCMA 4OELA 3O1GA 2FTDA 1IWDA 4NV8A 5CHTA 2GHUA 1AU4A 1U9VA 1KHQA 5F02A 2PADA 1NPZA 1F2BA 1JQPA 3GCBA 1MEGA 2DZZA 2NQIA 9PAPA 3P5XA 2WBFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPJ A;  2OUL A;  3HD3 A;  1ITO A;  3KWB X;  1YAL A;  4HWY A;  2FQ9 A;  3BOW A;  1U9Q X;  1ATK A;  1TL9 A;  4PI3 A;  4CDE B;  2ARY A;  4W5B A;  5PAD A;  3BCN A;  1PCI A;  4YYS A;  1U9X A;  4CDC B;  1BQI A;  1YK8 A;  3NHE A;  2R9C A;  4P6G A;  1KFU L;  2Y5B A;  1EWL A;  3D6S A;  1VJV A;  7PCK A;  5JA7 A;  4YVA A;  4QBB A;  1Y4H A;  1QDQ A;  2FYE A;  4MZS A;  4QH6 A;  3MHS A;  3M99 A;  3CH3 X;  4I05 A;  3K8U A;  1EF7 A;  4Q8H A;  1POP A;  3P5V A;  1CTE A;  1ME3 A;  1BY8 A;  1Q6K A;  2FRQ A;  1DF0 A;  2HD5 A;  3TNX A;  2DZY A;  2NQD B;  1BGO A;  2B1M A;  3F5V A;  3WXG A;  2YJB A;  1GEC E;  1TLO A;  3LXS A;  4PAD A;  3KSE A;  2VHS A;  5K16 A;  5JH3 A;  4DMX A;  2IPP B;  3N3K A;  1PIP A;  3CBJ A;  4I04 A;  4BPV A;  1MIR A;  3H8B A;  2YJ9 A;  2F7D A;  2BDL A;  1EWO A;  2AS8 A;  2AYO A;  1THE A;  1KXR A;  3WXF A;  1NB5 A;  4X6H A;  1GCB A;  2XU5 A;  3IMA A;  1NLJ A;  1HUC B;  1STF E;  2DCD A;  2VHF A;  4BS5 A;  4Q8G A;  3HHI A;  2R9M A;  3P5U A;  1DEU A;  4AXM A;  3OIS A;  2JQG R;  2PBH A;  1K3B B;  5CVM A;  4CDF B;  3IOQ A;  1O0E A;  3S3Q A;  1SP4 B;  1KFX L;  1AU3 A;  3N3G A;  1Y08 A;  2OZ2 A;  3KKU A;  3ZUA A;  1TU6 A;  4W5C A;  1XKG A;  2YJ2 A;  2G7Y A;  4FIP A;  1CJL A;  3AI8 A;  2DJF B;  3IV2 A;  2FO5 A;  3BWK A;  1A6R A;  4I07 A;  2DCC A;  5EF4 A;  3OF9 A;  3V6C A;  2AUZ A;  2YJC A;  4YYQ A;  3PDF A;  1MDW A;  2AIM A;  3PBH A;  3MHH A;  3WXE A;  3IUT A;  1CB5 A;  1BP4 A;  4P6E A;  4PP2 E;  1CQD A;  1AU0 A;  1YK7 A;  3H6S A;  1PAD A;  2R9N A;  5EGW A;  3P5W A;  2PRE A;  1M6D A;  2OP3 A;  1S4V A;  5CVO B;  1GMY A;  4YYW A;  3V6E A;  4QRV A;  1NL6 A;  1PPO A;  1QMY A;  1MHW A;  4FJC A;  2R9O A;  1F29 A;  1EWM A;  2BDZ A;  2IBI A;  2DC7 A;  2E03 A;  4CDD B;  4QRG A;  2DJG B;  2HH5 A;  1U5I A;  4XUI A;  4KLB A;  1AEC A;  5J94 A;  4N79 A;  2YJ8 A;  1AYV A;  2P0R A;  4BSQ A;  3BPF A;  4MSX A;  2E00 A;  1CV8 A;  3LFY A;  2XU3 A;  1AYU A;  2P7U A;  1U9W A;  3PNR A;  3K24 A;  2G6D A;  3BC3 A;  3K9M A;  3C9E A;  1YVB A;  1FH0 A;  3E1Z B;  1GLO A;  5CHV A;  3H89 A;  3DF0 A;  3IEJ A;  3S3R A;  4G54 A;  4QRX A;  4MZO A;  1VSN A;  4RY2 A;  4CZW A;  1PBH A;  2CB5 A;  4FK5 A;  4N4Z A;  2AYN A;  1ICF A;  2G8J A;  2XU1 A;  3QSD A;  3RVW A;  3RVV A;  2ACT A;  1F2A A;  3OVZ A;  1QXP A;  4OEM A;  4DMY A;  1MS6 A;  2F1G A;  1PPD A;  2AU1 A;  2DC6 A;  2AVW A;  2HHN A;  2G8E A;  2NQG A;  2H7J A;  1KHP A;  2DC8 A;  1ME4 A;  1X9Y A;  3QJ3 A;  3H7D A;  5CVN B;  4YV8 A;  2Y6E A;  2DCB A;  3U8E A;  3HWN A;  3RVX A;  2XU4 A;  3BPM A;  3MTN A;  2JQF R;  3H8C A;  4YYU A;  3CH2 X;  3OVX A;  2P86 A;  3KW9 A;  8PCH A;  1PXV A;  1CVZ A;  4W4U A;  4XR7 A;  3CBK A;  2NQA A;  3HHA A;  2FRA A;  4X6I A;  2C0Y A;  2E01 A;  4ZUX U;  4YYR A;  1AU2 A;  5A24 A;  3MOR A;  1F2C A;  4AXL A;  4PP1 A;  2R9F A;  2DC9 A;  4BQV A;  1YT7 A;  3N4C A;  3B79 A;  3ERV A;  4WA6 A;  1PE6 A;  1SNK A;  4N8W A;  3KWZ A;  2FT2 A;  1EWP A;  1CS8 A;  1PPN A;  4K7C A;  2GFO A;  3KFQ A;  5FPW A;  3USV A;  4YYV A;  4X6J A;  3OF8 A;  6PAD A;  1ZIV A;  3I3T A;  2AUX A;  2E02 A;  3QT4 A;  2ATO A;  3I06 A;  1PPP A;  3KX1 A;  1QOL A;  2CIO A;  2R6N A;  2PNS A;  3F75 A;  1MEM A;  1NQC A;  3PW3 A;  1AIM A;  2O6X A;  2FUD A;  1CSB B;  1NB3 A;  1AYW A;  3O0U A;  2HXZ A;  2B1N A;  2DCA A;  4BS6 A;  3IHP A;  1ZCM A;  4OEL A;  3O1G A;  2FTD A;  1IWD A;  5CHT A;  2GHU A;  1AU4 A;  1U9V A;  1KHQ A;  5F02 A;  2PAD A;  1NPZ A;  1F2B A;  1JQP A;  3GCB A;  1MEG A;  2DZZ A;  2NQI A;  9PAP A;  3P5X A;  2WBF X; 
#chains in the Genus database with same CATH topology
 1CPJ A;  2OUL A;  3HD3 A;  1ITO A;  2BTW A;  3KWB X;  3W30 A;  1YAL A;  4HWY A;  2FQ9 A;  3BOW A;  1U9Q X;  1ATK A;  1TL9 A;  4PI3 A;  4CDE B;  2ARY A;  4W5B A;  5PAD A;  3BCN A;  1PCI A;  4YYS A;  1U9X A;  3O65 A;  4RF1 A;  4CDC B;  1BQI A;  1YK8 A;  3NHE A;  4OW0 A;  2R9C A;  4P6G A;  1KFU L;  2Y5B A;  1EWL A;  3D6S A;  1VJV A;  7PCK A;  5JA7 A;  4YVA A;  4QBB A;  1Y4H A;  1QDQ A;  2FYE A;  4MZS A;  4QH6 A;  3PHX A;  3MHS A;  3M99 A;  3CH3 X;  4I05 A;  3K8U A;  1EF7 A;  4Q8H A;  3B21 A;  1POP A;  3P5V A;  3BBA A;  1CTE A;  1ME3 A;  1BY8 A;  1Q6K A;  2FRQ A;  1DF0 A;  2HD5 A;  3TNX A;  2DZY A;  4M0W A;  2NQD B;  1BGO A;  2B1M A;  3F5V A;  3WXG A;  2YJB A;  1GEC E;  1TLO A;  3LXS A;  4PAD A;  3KSE A;  2VHS A;  5K16 A;  5JH3 A;  4A5U A;  4DMX A;  2IPP B;  3N3K A;  1PIP A;  3CBJ A;  4I04 A;  4BPV A;  1MIR A;  3H8B A;  5E6J A;  2YJ9 A;  2F7D A;  2BDL A;  1EWO A;  2AS8 A;  2AYO A;  2BTW B;  1THE A;  1KXR A;  3WXF A;  1NB5 A;  4X6H A;  1GCB A;  2XU5 A;  3IMA A;  1NLJ A;  1HUC B;  1STF E;  4HXD B;  2DCD A;  2VHF A;  4BS5 A;  4Q8G A;  3HHI A;  2R9M A;  3P5U A;  1DEU A;  4AXM A;  3OIS A;  2JQG R;  2PBH A;  1K3B B;  5CVM A;  4CDF B;  4GUA A;  2JTC A;  2J7Q C;  3IOQ A;  1O0E A;  3S3Q A;  1SP4 B;  1KFX L;  4BOP A;  1AU3 A;  1PVJ A;  3RNV A;  3N3G A;  1Y08 A;  2OZ2 A;  3KKU A;  3ZUA A;  1TU6 A;  4W5C A;  1XKG A;  2YJ2 A;  3PT2 A;  2G7Y A;  4FIP A;  1CJL A;  3AI8 A;  2DJF B;  3BY4 A;  3IV2 A;  2FO5 A;  3BWK A;  1A6R A;  4I07 A;  2DCC A;  5EF4 A;  3OF9 A;  3V6C A;  2AUZ A;  2YJC A;  4YYQ A;  3PDF A;  1MDW A;  2AIM A;  3PBH A;  3MHH A;  3WXE A;  3IUT A;  1CB5 A;  1BP4 A;  4P6E A;  4PP2 E;  1CQD A;  1AU0 A;  1YK7 A;  3H6S A;  1PAD A;  2R9N A;  1YZB A;  5EGW A;  3P5W A;  2PRE A;  5JZE A;  1M6D A;  2OP3 A;  1S4V A;  5CVO B;  1GMY A;  4YYW A;  2AGA A;  3IFU A;  3V6E A;  4QRV A;  1NL6 A;  3C0R A;  1PPO A;  4BOU A;  4RNA A;  1QMY A;  1MHW A;  4FJC A;  2R9O A;  1F29 A;  2UZJ A;  1EWM A;  2BDZ A;  2IBI A;  3MP2 A;  2DC7 A;  2E03 A;  4CDD B;  4D8I A;  4QRG A;  2DJG B;  2HH5 A;  1U5I A;  4XUI A;  4KLB A;  1AEC A;  5J94 A;  4N79 A;  2YJ8 A;  1AYV A;  2P0R A;  4BSQ A;  3BPF A;  4MSX A;  2E00 A;  1CV8 A;  3LFY A;  2XU3 A;  1AYU A;  2P7U A;  1U9W A;  3PNR A;  4BOZ A;  2DOS A;  3K24 A;  4IP3 A;  2G6D A;  3BC3 A;  3K9M A;  3C9E A;  1YVB A;  1FH0 A;  4BOQ A;  3E1Z B;  1GLO A;  4P16 A;  5CHV A;  3PHU A;  3H89 A;  4RF0 A;  3DF0 A;  2HWK A;  3IEJ A;  4MM3 B;  3S3R A;  3PSE A;  4G54 A;  4QRX A;  4MZO A;  1VSN A;  4RY2 A;  4CZW A;  1PBH A;  2CB5 A;  4FK5 A;  4N4Z A;  2AYN A;  4XZX A;  1ICF A;  2G8J A;  2XU1 A;  3QSD A;  3RVW A;  3RVV A;  2ACT A;  1F2A A;  3OVZ A;  1QXP A;  3TRK A;  2JRI A;  4OEM A;  4DMY A;  1MS6 A;  3PHW A;  4PT5 A;  4REZ A;  2F1G A;  4MI7 A;  1PPD A;  2AU1 A;  2DC6 A;  4OVZ A;  2AVW A;  2HHN A;  2BU3 A;  2G8E A;  2NQG A;  2H7J A;  1KHP A;  2DC8 A;  1ME4 A;  1X9Y A;  5EZS A;  3QJ3 A;  3H7D A;  5CVN B;  4YV8 A;  2Y6E A;  2DCB A;  3BB7 A;  3W31 A;  3U8E A;  3HWN A;  4WUR A;  3PRP A;  3RVX A;  2XU4 A;  3BPM A;  3MTN A;  2JQF R;  3H8C A;  4YYU A;  3CH2 X;  3E9S A;  3OVX A;  2P86 A;  3KW9 A;  8PCH A;  1PXV A;  1CVZ A;  4W4U A;  4XR7 A;  3CBK A;  2NQA A;  3HHA A;  2FRA A;  4X6I A;  2C0Y A;  2E01 A;  3ZNH A;  4ZUX U;  4YYR A;  1AU2 A;  5A24 A;  3MOR A;  1F2C A;  4AXL A;  4PP1 A;  2R9F A;  2DC9 A;  3OQC A;  1YT7 A;  4BQV A;  3N4C A;  3B79 A;  1DKI A;  4IUM A;  4R3D A;  5KO3 A;  3ERV A;  4WA6 A;  1PE6 A;  1SNK A;  5EZQ A;  4N8W A;  2J7Q A;  3KWZ A;  2FT2 A;  1EWP A;  1CS8 A;  1PPN A;  4K7C A;  2Z84 A;  2GFO A;  3KFQ A;  4OVZ B;  5FPW A;  3USV A;  4YYV A;  2FE8 A;  4X6J A;  3OF8 A;  6PAD A;  1ZIV A;  3I3T A;  2AUX A;  2E02 A;  3QT4 A;  2ATO A;  3I06 A;  1PPP A;  3KX1 A;  4RKX A;  1QOL A;  1UKF A;  2CIO A;  2R6N A;  2PNS A;  3F75 A;  1MEM A;  1NQC A;  3MTV A;  3PW3 A;  1AIM A;  3PRM A;  2O6X A;  2FUD A;  1CSB B;  1NB3 A;  3MJ5 A;  1AYW A;  3O0U A;  2HXZ A;  2B1N A;  2DCA A;  3TMP A;  4BS6 A;  3IHP A;  1ZCM A;  4OEL A;  4ZTB A;  4D8B A;  3O1G A;  2FTD A;  1IWD A;  5CHT A;  2GHU A;  1AU4 A;  1U9V A;  1KHQ A;  5F02 A;  2PAD A;  1NPZ A;  1F2B A;  4BOS A;  1JQP A;  3GCB A;  4D8E A;  1MEG A;  2DZZ A;  2NQI A;  9PAP A;  3P5X A;  2WBF X; 
#chains in the Genus database with same CATH homology
 1CPJ A;  2OUL A;  3HD3 A;  1ITO A;  4C5P A;  3KWB X;  1YAL A;  4HWY A;  2FQ9 A;  3BOW A;  2BSZ A;  1U9Q X;  1ATK A;  1TL9 A;  4PI3 A;  4CDE B;  2ARY A;  4W5B A;  5PAD A;  3BCN A;  1PCI A;  4YYS A;  1U9X A;  4CDC B;  1BQI A;  1YK8 A;  3NHE A;  2R9C A;  4P6G A;  1KFU L;  2Y5B A;  1EWL A;  3D6S A;  1VJV A;  7PCK A;  5JA7 A;  4YVA A;  4QBB A;  1Y4H A;  1QDQ A;  2FYE A;  4MZS A;  4QH6 A;  3MHS A;  3M99 A;  3CH3 X;  4I05 A;  3K8U A;  1EF7 A;  4Q8H A;  1POP A;  3P5V A;  1CTE A;  1ME3 A;  1BY8 A;  1Q6K A;  2FRQ A;  1DF0 A;  2HD5 A;  3TNX A;  2DZY A;  2NQD B;  1BGO A;  2B1M A;  3F5V A;  3WXG A;  2YJB A;  1GEC E;  1TLO A;  3LXS A;  4PAD A;  3KSE A;  2VHS A;  5K16 A;  5JH3 A;  4DMX A;  2IPP B;  3N3K A;  1PIP A;  3CBJ A;  4I04 A;  4BPV A;  1MIR A;  3H8B A;  2YJ9 A;  2F7D A;  2BDL A;  1EWO A;  2AS8 A;  2AYO A;  1THE A;  1KXR A;  3WXF A;  1NB5 A;  4X6H A;  1GCB A;  2XU5 A;  3IMA A;  1NLJ A;  1HUC B;  1STF E;  2DCD A;  2VHF A;  4BS5 A;  4Q8G A;  3HHI A;  2R9M A;  3P5U A;  1DEU A;  4AXM A;  4GUZ A;  3OIS A;  2JQG R;  2PBH A;  1K3B B;  5CVM A;  4CDF B;  3IOQ A;  1O0E A;  3S3Q A;  1SP4 B;  1KFX L;  1AU3 A;  3N3G A;  1Y08 A;  2OZ2 A;  3KKU A;  3ZUA A;  1TU6 A;  4W5C A;  1XKG A;  2YJ2 A;  2G7Y A;  4FIP A;  1CJL A;  3AI8 A;  2DJF B;  3IV2 A;  2FO5 A;  3BWK A;  1A6R A;  4I07 A;  2DCC A;  5EF4 A;  3OF9 A;  3V6C A;  1W4T A;  2AUZ A;  2YJC A;  4YYQ A;  3PDF A;  1MDW A;  2AIM A;  3PBH A;  3MHH A;  3WXE A;  3IUT A;  1CB5 A;  1BP4 A;  4P6E A;  4PP2 E;  1CQD A;  4B55 A;  1AU0 A;  1YK7 A;  4NV7 A;  3H6S A;  1PAD A;  2R9N A;  5EGW A;  3P5W A;  2PRE A;  1M6D A;  2OP3 A;  1S4V A;  5CVO B;  1GMY A;  4YYW A;  3V6E A;  4QRV A;  3D9W A;  1NL6 A;  1PPO A;  1E2T A;  1QMY A;  1MHW A;  4FJC A;  2R9O A;  1F29 A;  1EWM A;  2BDZ A;  2IBI A;  2DC7 A;  2E03 A;  4CDD B;  2VFB A;  4QRG A;  2DJG B;  2HH5 A;  1U5I A;  4XUI A;  4KLB A;  1AEC A;  5J94 A;  4N79 A;  2YJ8 A;  1AYV A;  2P0R A;  4BSQ A;  3BPF A;  4MSX A;  2VFC A;  2E00 A;  1CV8 A;  3LFY A;  2XU3 A;  1AYU A;  2P7U A;  1U9W A;  3PNR A;  3K24 A;  2G6D A;  3BC3 A;  3K9M A;  3C9E A;  1YVB A;  1FH0 A;  3E1Z B;  1GX3 A;  1GLO A;  5CHV A;  3LTW A;  3H89 A;  3DF0 A;  3IEJ A;  3S3R A;  4G54 A;  4QRX A;  4MZO A;  1VSN A;  4RY2 A;  4CZW A;  1PBH A;  2CB5 A;  4FK5 A;  4N4Z A;  2AYN A;  1W6F A;  1ICF A;  2G8J A;  2XU1 A;  3QSD A;  3RVW A;  4BGF A;  3RVV A;  2ACT A;  1F2A A;  3OVZ A;  1QXP A;  4OEM A;  4DMY A;  1MS6 A;  2F1G A;  1PPD A;  2AU1 A;  2DC6 A;  1W5R A;  2AVW A;  2HHN A;  2G8E A;  2NQG A;  2H7J A;  1KHP A;  2DC8 A;  1ME4 A;  1X9Y A;  3QJ3 A;  3H7D A;  5CVN B;  4YV8 A;  2Y6E A;  2DCB A;  3U8E A;  3HWN A;  3RVX A;  2XU4 A;  3BPM A;  3MTN A;  2JQF R;  3H8C A;  4YYU A;  3CH2 X;  3OVX A;  2P86 A;  3KW9 A;  8PCH A;  1PXV A;  1CVZ A;  4W4U A;  4XR7 A;  3CBK A;  2NQA A;  3HHA A;  2FRA A;  4X6I A;  2C0Y A;  2E01 A;  4ZUX U;  4YYR A;  1AU2 A;  5A24 A;  3MOR A;  1F2C A;  4AXL A;  4PP1 A;  2R9F A;  2DC9 A;  4BQV A;  1YT7 A;  3N4C A;  3B79 A;  3ERV A;  4WA6 A;  1PE6 A;  1SNK A;  4N8W A;  3KWZ A;  2FT2 A;  1EWP A;  1CS8 A;  1PPN A;  4K7C A;  2GFO A;  3KFQ A;  5FPW A;  3USV A;  4YYV A;  4X6J A;  3OF8 A;  6PAD A;  1ZIV A;  3I3T A;  2AUX A;  2E02 A;  3QT4 A;  2ATO A;  3I06 A;  1PPP A;  3KX1 A;  1QOL A;  2CIO A;  2R6N A;  2PNS A;  3F75 A;  1MEM A;  1NQC A;  3PW3 A;  1AIM A;  2O6X A;  2FUD A;  1CSB B;  1NB3 A;  1AYW A;  3O0U A;  2HXZ A;  2B1N A;  2DCA A;  4BS6 A;  3IHP A;  1ZCM A;  4OEL A;  3O1G A;  2FTD A;  1IWD A;  4NV8 A;  5CHT A;  2GHU A;  1AU4 A;  1U9V A;  1KHQ A;  5F02 A;  2PAD A;  1NPZ A;  1F2B A;  1JQP A;  3GCB A;  1MEG A;  2DZZ A;  2NQI A;  9PAP A;  3P5X A;  2WBF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...