1X9YA

The prostaphopain b structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
346
Chain Sequence
KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cysteine proteinase
publication title Prostaphopain B structure: a comparison of proregion-mediated and staphostatin-mediated protease inhibition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 116
structure length 346
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
A PF14731 Staphopain_pro Staphopain proregion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.500.10 Alpha Beta Roll prostaphopain b, domain 1 Staphopain proregion domain 1x9yA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1x9yA02
3HHIA 1M6DA 5K16A 2AYNA 2R9MA 1TLOA 1AU4A 2CB5A 2B1NA 3CH2X 4AXLA 2FO5A 1AU0A 2XU1A 1GMYA 2YJCA 3KKUA 1CQDA 1ME4A 3WXEA 2H7JA 2E01A 3H8CA 3IMAA 4MSXA 2ATOA 3WXFA 2E00A 4BPVA 4I04A 1POPA 4QRVA 1EWLA 3H89A 3OISA 4FIPA 1PCIA 1AYWA 3B79A 1KHPA 1SNKA 1AU2A 2O6XA 4ZUXU 2AYOA 2R9NA 1MDWA 2AIMA 3MTNA 1PPOA 1Y4HA 1GLOA 3KWBX 4YYQA 4G54A 3KX1A 4X6JA 3H8BA 1MIRA 1ATKA 3N4CA 1U9WA 3K8UA 4K7CA 1F2CA 9PAPA 5CHTA 4CZWA 1CVZA 3HD3A 1YK7A 2F7DA 1F2BA 1PPDA 2P86A 4WA6A 1ICFA 4PP2E 1NLJA 3IOQA 2HXZA 3USVA 1U9XA 2AS8A 1CJLA 2Y5BA 2Y6EA 3I06A 3KSEA 1CTEA 1YALA 1TU6A 1CV8A 3S3QA 2DCDA 2CIOA 3AI8A 2OP3A 1PPPA 3PNRA 1BY8A 1DEUA 2YJ9A 1K3BB 1PADA 1KHQA 3MHHA 4N79A 3BPFA 3CBJA 1BP4A 1ZIVA 4CDEB 4YYSA 1PPNA 1NQCA 4YYVA 2GFOA 2DC6A 4XUIA 2PBHA 2DZYA 3QT4A 5CVOB 1S4VA 4BQVA 4KLBA 1FH0A 7PCKA 1PIPA 2JQGR 4P6EA 1CPJA 2FRQA 3KWZA 2BDZA 2FYEA 3OVXA 3H7DA 2XU5A 1PXVA 3BCNA 2XU3A 1THEA 1KXRA 5F02A 2OULA 3S3RA 1XKGA 2DCCA 3ERVA 4OEMA 1CB5A 2DCAA 3OF8A 2VHSA 1U9VA 4PI3A 2GHUA 2R6NA 1AYVA 1DF0A 1AIMA 4QRXA 3KFQA 3I3TA 4QRGA 2YJ8A 4DMXA 3IV2A 3HWNA 2R9CA 3P5WA 1F29A 1A6RA 3V6EA 1U9QX 3BPMA 3WXGA 1NPZA 1TL9A 1KFXL 2G8EA 2HHNA 3O0UA 1AECA 4X6HA 3TNXA 1PE6A 2NQIA 2G8JA 3IUTA 2DC7A 4FJCA 3PDFA 2YJ2A 3OF9A 1BGOA 2G6DA 3H6SA 1SP4B 3LFYA 3M99A 1NB3A 2R9OA 1KFUL 3BOWA 5A24A 3OVZA 5FPWA 1PBHA 1QMYA 2B1MA 2HH5A 2IBIA 2PREA 3MHSA 1ZCMA 3DF0A 4YYRA 3CH3X 2HD5A 1YK8A 4QH6A 3PBHA 4BS5A 3NHEA 1QDQA 3BC3A 3IHPA 2AUXA 5EF4A 1U5IA 4YYUA 3GCBA 1F2AA 3ZUAA 1Y08A 2R9FA 4P6GA 4I07A 1VSNA 1JQPA 4W5CA 4W4UA 2IPPB 3E1ZB 5CVNB 5PADA 4CDDB 4MZSA 2AUZA 1QOLA 3KW9A 1VJVA 2NQGA 1EF7A 3LXSA 3N3KA 4CDCB 1STFE 4XR7A 5J94A 1MEGA 2FT2A 2G7YA 4N4ZA 1ITOA 3U8EA 2OZ2A 3O1GA 3C9EA 1X9YA 2NQDB 3F5VA 3D6SA 3P5UA 3V6CA 3CBKA 2AU1A 3P5XA 1EWOA 1AYUA 2DC8A 2F1GA 2P0RA 4HWYA 3RVVA 1AU3A 4QBBA 1GCBA 5JH3A 1QXPA 1CSBB 3IEJA 2BDLA 2XU4A 1IWDA 1MEMA 2FTDA 4BS6A 2WBFX 4MZOA 3BWKA 2DZZA 3RVWA 4PP1A 1MHWA 4CDFB 1CS8A 2JQFR 4PADA 2P7UA 4AXMA 3QJ3A 4OELA 3PW3A 2E02A 2PNSA 4DMYA 5EGWA 1YVBA 4Q8HA 1HUCB 1EWMA 2DCBA 2E03A 2DC9A 3RVXA 4YV8A 4RY2A 4FK5A 2FRAA 2C0YA 1ME3A 6PADA 2ARYA 2AVWA 4YYWA 3P5VA 3K9MA 1MS6A 2YJBA 4Q8GA 2PADA 1BQIA 3K24A 4W5BA 4N8WA 1NL6A 1O0EA 1YT7A 2VHFA 4X6IA 5CHVA 5CVMA 1EWPA 2FUDA 4BSQA 4I05A 2FQ9A 2ACTA 1NB5A 3N3GA 3F75A 1Q6KA 8PCHA 4YVAA 5JA7A 2DJGB 1GECE 3HHAA 2NQAA 2DJFB 3QSDA 3MORA
chains in the Genus database with same CATH superfamily
3HHIA 1M6DA 5K16A 3IFUA 2AYNA 2R9MA 1TLOA 1AU4A 2CB5A 2B1NA 3CH2X 4AXLA 2FO5A 1AU0A 2XU1A 1GMYA 2YJCA 3KKUA 1CQDA 4BOUA 1ME4A 3WXEA 2H7JA 2E01A 3H8CA 3IMAA 4MSXA 2ATOA 3WXFA 1UKFA 2E00A 4BPVA 4I04A 1POPA 4QRVA 1EWLA 2J7QA 3H89A 3OISA 4RKXA 4FIPA 1PCIA 1AYWA 3E9SA 4RF0A 3B79A 1KHPA 1SNKA 1AU2A 2O6XA 4ZUXU 2AYOA 2R9NA 1MDWA 2AIMA 3MTNA 1PPOA 1Y4HA 1GLOA 3KWBX 4YYQA 4G54A 3KX1A 4X6JA 3H8BA 3MJ5A 1MIRA 1ATKA 3N4CA 4R3DA 1U9WA 3K8UA 4K7CA 1F2CA 9PAPA 5CHTA 4CZWA 1CVZA 3HD3A 1YK7A 2F7DA 1F2BA 1PPDA 2P86A 4WA6A 1ICFA 4PP2E 1NLJA 3IOQA 2HXZA 3USVA 1U9XA 2AS8A 3O65A 1CJLA 2Y5BA 2Y6EA 3I06A 3KSEA 1CTEA 1YALA 1TU6A 1CV8A 3S3QA 5E6JA 1PVJA 2DCDA 2CIOA 1DKIA 4RNAA 3BY4A 4PT5A 3AI8A 2FE8A 2OP3A 1PPPA 3PNRA 1BY8A 3W30A 1DEUA 2YJ9A 1K3BB 1PADA 1KHQA 3MHHA 4N79A 3BPFA 3CBJA 1BP4A 2UZJA 1ZIVA 4CDEB 3TMPA 4YYSA 1PPNA 4BOZA 1NQCA 4YYVA 4REZA 2GFOA 3OQCA 5EZSA 4P16A 2DC6A 4XUIA 2PBHA 2DZYA 3QT4A 5CVOB 1S4VA 4BQVA 4KLBA 4BOSA 1FH0A 7PCKA 1PIPA 2JQGR 4P6EA 4OVZA 1CPJA 3C0RA 2FRQA 3KWZA 2BDZA 3TRKA 2FYEA 3OVXA 4GUAA 3H7DA 2XU5A 1PXVA 3BCNA 2XU3A 1THEA 1KXRA 5F02A 2HWKA 4D8IA 2OULA 3S3RA 1XKGA 2DCCA 3ERVA 4OEMA 1CB5A 2DCAA 3OF8A 2VHSA 2AGAA 1U9VA 4PI3A 2GHUA 2R6NA 1AYVA 1DF0A 1AIMA 4QRXA 3KFQA 3I3TA 4QRGA 2YJ8A 3W31A 4DMXA 3IV2A 3HWNA 2R9CA 4IUMA 4HXDB 3P5WA 1F29A 3RNVA 1A6RA 3PRPA 3V6EA 1U9QX 3BPMA 3WXGA 1NPZA 1TL9A 1KFXL 2G8EA 2HHNA 3O0UA 1AECA 4X6HA 3TNXA 1PE6A 2NQIA 4MM3B 2G8JA 3IUTA 2DC7A 4FJCA 2BTWB 3PDFA 2JTCA 4WURA 2YJ2A 3OF9A 1BGOA 2G6DA 3H6SA 1SP4B 3LFYA 4M0WA 3M99A 1NB3A 2R9OA 1KFUL 3BOWA 5A24A 3OVZA 5FPWA 1PBHA 3BBAA 3ZNHA 1QMYA 2B1MA 2HH5A 2IBIA 2PREA 3MHSA 1ZCMA 3DF0A 3MTVA 4YYRA 3CH3X 2HD5A 1YK8A 4QH6A 3PBHA 4BS5A 3NHEA 1QDQA 3BC3A 3IHPA 2AUXA 5EF4A 1U5IA 4IP3A 3GCBA 1F2AA 4YYUA 3ZUAA 1Y08A 2R9FA 4P6GA 4I07A 4RF1A 1VSNA 1JQPA 4W5CA 5EZQA 4W4UA 2IPPB 3E1ZB 5JZEA 2Z84A 5CVNB 5PADA 4CDDB 4MZSA 2AUZA 1QOLA 3KW9A 1VJVA 2NQGA 1EF7A 3LXSA 3N3KA 4CDCB 1STFE 4XR7A 5J94A 1MEGA 3B21A 2FT2A 2G7YA 4N4ZA 3PRMA 1ITOA 3U8EA 2OZ2A 3O1GA 3C9EA 1YZBA 1X9YA 4D8EA 2NQDB 3F5VA 3D6SA 3PHXA 3P5UA 3PHWA 3V6CA 3CBKA 2AU1A 3P5XA 4MI7A 1EWOA 1AYUA 2DC8A 2F1GA 2P0RA 4XZXA 4HWYA 3MP2A 3RVVA 1AU3A 4QBBA 1GCBA 5JH3A 2J7QC 1QXPA 1CSBB 3IEJA 2BDLA 2XU4A 1IWDA 1MEMA 2FTDA 4BS6A 2WBFX 4MZOA 2BU3A 3BWKA 2DZZA 3RVWA 4PP1A 1MHWA 4CDFB 1CS8A 2JQFR 4PADA 2P7UA 4OVZB 4AXMA 3QJ3A 4OELA 3PW3A 2E02A 2PNSA 4DMYA 5EGWA 1YVBA 4Q8HA 1HUCB 1EWMA 2DCBA 2E03A 3BB7A 2DC9A 4OW0A 3RVXA 4YV8A 4RY2A 4FK5A 2FRAA 2C0YA 1ME3A 6PADA 3PSEA 2ARYA 2AVWA 4YYWA 3P5VA 3K9MA 1MS6A 2YJBA 4Q8GA 2PADA 1BQIA 3K24A 4W5BA 4N8WA 5KO3A 1NL6A 2JRIA 3PHUA 1O0EA 1YT7A 4BOQA 4BOPA 2VHFA 4X6IA 5CHVA 5CVMA 4ZTBA 1EWPA 2FUDA 4BSQA 4I05A 2FQ9A 2ACTA 1NB5A 3N3GA 3F75A 4A5UA 1Q6KA 4D8BA 8PCHA 4YVAA 5JA7A 3PT2A 2DJGB 2BTWA 1GECE 3HHAA 2DOSA 2NQAA 2DJFB 3QSDA 3MORA
chains in the Genus database with same CATH topology
3HHIA 1M6DA 5K16A 2AYNA 2R9MA 1TLOA 1AU4A 2CB5A 2B1NA 3CH2X 4AXLA 2FO5A 1AU0A 2XU1A 1GMYA 2YJCA 3KKUA 1CQDA 1ME4A 3WXEA 2H7JA 2E01A 3H8CA 3IMAA 4MSXA 2ATOA 3WXFA 2E00A 4BPVA 4I04A 1POPA 4QRVA 1EWLA 3H89A 3OISA 4FIPA 1PCIA 1AYWA 3B79A 1KHPA 1SNKA 1AU2A 2O6XA 4ZUXU 2AYOA 2R9NA 1MDWA 2AIMA 3MTNA 1PPOA 1Y4HA 1GLOA 3KWBX 4YYQA 4G54A 3KX1A 4X6JA 3H8BA 1MIRA 1ATKA 3N4CA 1U9WA 3K8UA 4K7CA 1F2CA 9PAPA 5CHTA 4CZWA 1CVZA 3HD3A 1YK7A 2F7DA 1F2BA 1PPDA 2P86A 4WA6A 1ICFA 4PP2E 1NLJA 3IOQA 2HXZA 3USVA 1U9XA 2AS8A 1CJLA 2Y5BA 2Y6EA 3I06A 3KSEA 1CTEA 1YALA 1TU6A 1CV8A 3S3QA 2DCDA 2CIOA 3AI8A 2OP3A 1PPPA 3PNRA 1BY8A 1DEUA 2YJ9A 1K3BB 1PADA 1KHQA 3MHHA 4N79A 3BPFA 3CBJA 1BP4A 1ZIVA 4CDEB 4YYSA 1PPNA 1NQCA 4YYVA 2GFOA 2DC6A 4XUIA 2PBHA 2DZYA 3QT4A 5CVOB 1S4VA 4BQVA 4KLBA 1FH0A 7PCKA 1PIPA 2JQGR 4P6EA 1CPJA 4BGFA 2FRQA 3KWZA 2BDZA 2FYEA 3OVXA 3H7DA 2XU5A 1PXVA 3BCNA 2XU3A 1THEA 1KXRA 5F02A 2OULA 2VFCA 3S3RA 1XKGA 2DCCA 3ERVA 4OEMA 1CB5A 2DCAA 3OF8A 2VHSA 1U9VA 4PI3A 2GHUA 2R6NA 1AYVA 1W5RA 1DF0A 1AIMA 4QRXA 3KFQA 3I3TA 4QRGA 2YJ8A 4DMXA 3IV2A 3HWNA 2R9CA 3P5WA 1F29A 1A6RA 3V6EA 4GUZA 1U9QX 3BPMA 3WXGA 1NPZA 1TL9A 3D9WA 1KFXL 2G8EA 2HHNA 3O0UA 1AECA 4X6HA 3TNXA 1PE6A 2NQIA 2G8JA 3IUTA 2DC7A 4FJCA 3PDFA 4NV8A 2YJ2A 3OF9A 1BGOA 2G6DA 3H6SA 1SP4B 3LFYA 3M99A 1NB3A 2R9OA 1KFUL 3BOWA 5A24A 3OVZA 5FPWA 1PBHA 1QMYA 2B1MA 2HH5A 2IBIA 2PREA 3MHSA 1ZCMA 3DF0A 4YYRA 3CH3X 2HD5A 1YK8A 4QH6A 3PBHA 4BS5A 3NHEA 1QDQA 3BC3A 3IHPA 2AUXA 5EF4A 1U5IA 4YYUA 3GCBA 1F2AA 3ZUAA 1Y08A 2R9FA 4P6GA 4I07A 1VSNA 1JQPA 4W5CA 4W4UA 2IPPB 3E1ZB 5CVNB 5PADA 4CDDB 4MZSA 2AUZA 1QOLA 3KW9A 1VJVA 2NQGA 1EF7A 1GX3A 3LXSA 3N3KA 4CDCB 1STFE 4XR7A 5J94A 1MEGA 2FT2A 2G7YA 4N4ZA 1ITOA 3LTWA 3U8EA 2OZ2A 3O1GA 3C9EA 1X9YA 2NQDB 3F5VA 3D6SA 3P5UA 3V6CA 3CBKA 2AU1A 3P5XA 1EWOA 2VFBA 1AYUA 2DC8A 2F1GA 2P0RA 4HWYA 3RVVA 1AU3A 4QBBA 1W4TA 1GCBA 5JH3A 1W6FA 1QXPA 1CSBB 3IEJA 2BDLA 2XU4A 1IWDA 1MEMA 2FTDA 4BS6A 2WBFX 4MZOA 3BWKA 2DZZA 3RVWA 4PP1A 1MHWA 4CDFB 1CS8A 2JQFR 4NV7A 4PADA 2P7UA 4AXMA 3QJ3A 4OELA 3PW3A 2E02A 2PNSA 4DMYA 5EGWA 1YVBA 4Q8HA 1HUCB 1EWMA 2DCBA 1E2TA 2E03A 4B55A 2DC9A 3RVXA 4YV8A 4RY2A 4FK5A 2FRAA 2C0YA 1ME3A 6PADA 2ARYA 2AVWA 4YYWA 3P5VA 3K9MA 1MS6A 2YJBA 4Q8GA 2PADA 1BQIA 3K24A 4W5BA 4C5PA 4N8WA 1NL6A 1O0EA 1YT7A 2BSZA 2VHFA 4X6IA 5CHVA 5CVMA 1EWPA 2FUDA 4BSQA 4I05A 2FQ9A 2ACTA 1NB5A 3N3GA 3F75A 1Q6KA 8PCHA 4YVAA 5JA7A 2DJGB 1GECE 3HHAA 2NQAA 2DJFB 3QSDA 3MORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHI A;  1M6D A;  5K16 A;  2AYN A;  2R9M A;  1TLO A;  1AU4 A;  2CB5 A;  2B1N A;  3CH2 X;  4AXL A;  2FO5 A;  1AU0 A;  2XU1 A;  1GMY A;  2YJC A;  3KKU A;  1CQD A;  1ME4 A;  3WXE A;  2H7J A;  2E01 A;  3H8C A;  3IMA A;  4MSX A;  2ATO A;  3WXF A;  2E00 A;  4BPV A;  4I04 A;  1POP A;  4QRV A;  1EWL A;  3H89 A;  3OIS A;  4FIP A;  1PCI A;  1AYW A;  3B79 A;  1KHP A;  1SNK A;  1AU2 A;  2O6X A;  4ZUX U;  2AYO A;  2R9N A;  1MDW A;  2AIM A;  3MTN A;  1PPO A;  1Y4H A;  1GLO A;  3KWB X;  4YYQ A;  4G54 A;  3KX1 A;  4X6J A;  3H8B A;  1MIR A;  1ATK A;  3N4C A;  1U9W A;  3K8U A;  4K7C A;  1F2C A;  9PAP A;  5CHT A;  4CZW A;  1CVZ A;  3HD3 A;  1YK7 A;  2F7D A;  1F2B A;  1PPD A;  2P86 A;  4WA6 A;  1ICF A;  4PP2 E;  1NLJ A;  3IOQ A;  2HXZ A;  3USV A;  1U9X A;  2AS8 A;  1CJL A;  2Y5B A;  2Y6E A;  3I06 A;  3KSE A;  1CTE A;  1YAL A;  1TU6 A;  1CV8 A;  3S3Q A;  2DCD A;  2CIO A;  3AI8 A;  2OP3 A;  1PPP A;  3PNR A;  1BY8 A;  1DEU A;  2YJ9 A;  1K3B B;  1PAD A;  1KHQ A;  3MHH A;  4N79 A;  3BPF A;  3CBJ A;  1BP4 A;  1ZIV A;  4CDE B;  4YYS A;  1PPN A;  1NQC A;  4YYV A;  2GFO A;  2DC6 A;  4XUI A;  2PBH A;  2DZY A;  3QT4 A;  5CVO B;  1S4V A;  4BQV A;  4KLB A;  1FH0 A;  7PCK A;  1PIP A;  2JQG R;  4P6E A;  1CPJ A;  2FRQ A;  3KWZ A;  2BDZ A;  2FYE A;  3OVX A;  3H7D A;  2XU5 A;  1PXV A;  3BCN A;  2XU3 A;  1THE A;  1KXR A;  5F02 A;  2OUL A;  3S3R A;  1XKG A;  2DCC A;  3ERV A;  4OEM A;  1CB5 A;  2DCA A;  3OF8 A;  2VHS A;  1U9V A;  4PI3 A;  2GHU A;  2R6N A;  1AYV A;  1DF0 A;  1AIM A;  4QRX A;  3KFQ A;  3I3T A;  4QRG A;  2YJ8 A;  4DMX A;  3IV2 A;  3HWN A;  2R9C A;  3P5W A;  1F29 A;  1A6R A;  3V6E A;  1U9Q X;  3BPM A;  3WXG A;  1NPZ A;  1TL9 A;  1KFX L;  2G8E A;  2HHN A;  3O0U A;  1AEC A;  4X6H A;  3TNX A;  1PE6 A;  2NQI A;  2G8J A;  3IUT A;  2DC7 A;  4FJC A;  3PDF A;  2YJ2 A;  3OF9 A;  1BGO A;  2G6D A;  3H6S A;  1SP4 B;  3LFY A;  3M99 A;  1NB3 A;  2R9O A;  1KFU L;  3BOW A;  5A24 A;  3OVZ A;  5FPW A;  1PBH A;  1QMY A;  2B1M A;  2HH5 A;  2IBI A;  2PRE A;  3MHS A;  1ZCM A;  3DF0 A;  4YYR A;  3CH3 X;  2HD5 A;  1YK8 A;  4QH6 A;  3PBH A;  4BS5 A;  3NHE A;  1QDQ A;  3BC3 A;  3IHP A;  2AUX A;  5EF4 A;  1U5I A;  4YYU A;  3GCB A;  1F2A A;  3ZUA A;  1Y08 A;  2R9F A;  4P6G A;  4I07 A;  1VSN A;  1JQP A;  4W5C A;  4W4U A;  2IPP B;  3E1Z B;  5CVN B;  5PAD A;  4CDD B;  4MZS A;  2AUZ A;  1QOL A;  3KW9 A;  1VJV A;  2NQG A;  1EF7 A;  3LXS A;  3N3K A;  4CDC B;  1STF E;  4XR7 A;  5J94 A;  1MEG A;  2FT2 A;  2G7Y A;  4N4Z A;  1ITO A;  3U8E A;  2OZ2 A;  3O1G A;  3C9E A;  1X9Y A;  2NQD B;  3F5V A;  3D6S A;  3P5U A;  3V6C A;  3CBK A;  2AU1 A;  3P5X A;  1EWO A;  1AYU A;  2DC8 A;  2F1G A;  2P0R A;  4HWY A;  3RVV A;  1AU3 A;  4QBB A;  1GCB A;  5JH3 A;  1QXP A;  1CSB B;  3IEJ A;  2BDL A;  2XU4 A;  1IWD A;  1MEM A;  2FTD A;  4BS6 A;  2WBF X;  4MZO A;  3BWK A;  2DZZ A;  3RVW A;  4PP1 A;  1MHW A;  4CDF B;  1CS8 A;  2JQF R;  4PAD A;  2P7U A;  4AXM A;  3QJ3 A;  4OEL A;  3PW3 A;  2E02 A;  2PNS A;  4DMY A;  5EGW A;  1YVB A;  4Q8H A;  1HUC B;  1EWM A;  2DCB A;  2E03 A;  2DC9 A;  3RVX A;  4YV8 A;  4RY2 A;  4FK5 A;  2FRA A;  2C0Y A;  1ME3 A;  6PAD A;  2ARY A;  2AVW A;  4YYW A;  3P5V A;  3K9M A;  1MS6 A;  2YJB A;  4Q8G A;  2PAD A;  1BQI A;  3K24 A;  4W5B A;  4N8W A;  1NL6 A;  1O0E A;  1YT7 A;  2VHF A;  4X6I A;  5CHV A;  5CVM A;  1EWP A;  2FUD A;  4BSQ A;  4I05 A;  2FQ9 A;  2ACT A;  1NB5 A;  3N3G A;  3F75 A;  1Q6K A;  8PCH A;  4YVA A;  5JA7 A;  2DJG B;  1GEC E;  3HHA A;  2NQA A;  2DJF B;  3QSD A;  3MOR A; 
#chains in the Genus database with same CATH topology
 3HHI A;  1M6D A;  5K16 A;  3IFU A;  2AYN A;  2R9M A;  1TLO A;  1AU4 A;  2CB5 A;  2B1N A;  3CH2 X;  4AXL A;  2FO5 A;  1AU0 A;  2XU1 A;  1GMY A;  2YJC A;  3KKU A;  1CQD A;  4BOU A;  1ME4 A;  3WXE A;  2H7J A;  2E01 A;  3H8C A;  3IMA A;  4MSX A;  2ATO A;  3WXF A;  1UKF A;  2E00 A;  4BPV A;  4I04 A;  1POP A;  4QRV A;  1EWL A;  2J7Q A;  3H89 A;  3OIS A;  4RKX A;  4FIP A;  1PCI A;  1AYW A;  3E9S A;  4RF0 A;  3B79 A;  1KHP A;  1SNK A;  1AU2 A;  2O6X A;  4ZUX U;  2AYO A;  2R9N A;  1MDW A;  2AIM A;  3MTN A;  1PPO A;  1Y4H A;  1GLO A;  3KWB X;  4YYQ A;  4G54 A;  3KX1 A;  4X6J A;  3H8B A;  3MJ5 A;  1MIR A;  1ATK A;  3N4C A;  4R3D A;  1U9W A;  3K8U A;  4K7C A;  1F2C A;  9PAP A;  5CHT A;  4CZW A;  1CVZ A;  3HD3 A;  1YK7 A;  2F7D A;  1F2B A;  1PPD A;  2P86 A;  4WA6 A;  1ICF A;  4PP2 E;  1NLJ A;  3IOQ A;  2HXZ A;  3USV A;  1U9X A;  2AS8 A;  3O65 A;  1CJL A;  2Y5B A;  2Y6E A;  3I06 A;  3KSE A;  1CTE A;  1YAL A;  1TU6 A;  1CV8 A;  3S3Q A;  5E6J A;  1PVJ A;  2DCD A;  2CIO A;  1DKI A;  4RNA A;  3BY4 A;  4PT5 A;  3AI8 A;  2FE8 A;  2OP3 A;  1PPP A;  3PNR A;  1BY8 A;  3W30 A;  1DEU A;  2YJ9 A;  1K3B B;  1PAD A;  1KHQ A;  3MHH A;  4N79 A;  3BPF A;  3CBJ A;  1BP4 A;  2UZJ A;  1ZIV A;  4CDE B;  3TMP A;  4YYS A;  1PPN A;  4BOZ A;  1NQC A;  4YYV A;  4REZ A;  2GFO A;  3OQC A;  5EZS A;  4P16 A;  2DC6 A;  4XUI A;  2PBH A;  2DZY A;  3QT4 A;  5CVO B;  1S4V A;  4BQV A;  4KLB A;  4BOS A;  1FH0 A;  7PCK A;  1PIP A;  2JQG R;  4P6E A;  4OVZ A;  1CPJ A;  3C0R A;  2FRQ A;  3KWZ A;  2BDZ A;  3TRK A;  2FYE A;  3OVX A;  4GUA A;  3H7D A;  2XU5 A;  1PXV A;  3BCN A;  2XU3 A;  1THE A;  1KXR A;  5F02 A;  2HWK A;  4D8I A;  2OUL A;  3S3R A;  1XKG A;  2DCC A;  3ERV A;  4OEM A;  1CB5 A;  2DCA A;  3OF8 A;  2VHS A;  2AGA A;  1U9V A;  4PI3 A;  2GHU A;  2R6N A;  1AYV A;  1DF0 A;  1AIM A;  4QRX A;  3KFQ A;  3I3T A;  4QRG A;  2YJ8 A;  3W31 A;  4DMX A;  3IV2 A;  3HWN A;  2R9C A;  4IUM A;  4HXD B;  3P5W A;  1F29 A;  3RNV A;  1A6R A;  3PRP A;  3V6E A;  1U9Q X;  3BPM A;  3WXG A;  1NPZ A;  1TL9 A;  1KFX L;  2G8E A;  2HHN A;  3O0U A;  1AEC A;  4X6H A;  3TNX A;  1PE6 A;  2NQI A;  4MM3 B;  2G8J A;  3IUT A;  2DC7 A;  4FJC A;  2BTW B;  3PDF A;  2JTC A;  4WUR A;  2YJ2 A;  3OF9 A;  1BGO A;  2G6D A;  3H6S A;  1SP4 B;  3LFY A;  4M0W A;  3M99 A;  1NB3 A;  2R9O A;  1KFU L;  3BOW A;  5A24 A;  3OVZ A;  5FPW A;  1PBH A;  3BBA A;  3ZNH A;  1QMY A;  2B1M A;  2HH5 A;  2IBI A;  2PRE A;  3MHS A;  1ZCM A;  3DF0 A;  3MTV A;  4YYR A;  3CH3 X;  2HD5 A;  1YK8 A;  4QH6 A;  3PBH A;  4BS5 A;  3NHE A;  1QDQ A;  3BC3 A;  3IHP A;  2AUX A;  5EF4 A;  1U5I A;  4IP3 A;  3GCB A;  1F2A A;  4YYU A;  3ZUA A;  1Y08 A;  2R9F A;  4P6G A;  4I07 A;  4RF1 A;  1VSN A;  1JQP A;  4W5C A;  5EZQ A;  4W4U A;  2IPP B;  3E1Z B;  5JZE A;  2Z84 A;  5CVN B;  5PAD A;  4CDD B;  4MZS A;  2AUZ A;  1QOL A;  3KW9 A;  1VJV A;  2NQG A;  1EF7 A;  3LXS A;  3N3K A;  4CDC B;  1STF E;  4XR7 A;  5J94 A;  1MEG A;  3B21 A;  2FT2 A;  2G7Y A;  4N4Z A;  3PRM A;  1ITO A;  3U8E A;  2OZ2 A;  3O1G A;  3C9E A;  1YZB A;  1X9Y A;  4D8E A;  2NQD B;  3F5V A;  3D6S A;  3PHX A;  3P5U A;  3PHW A;  3V6C A;  3CBK A;  2AU1 A;  3P5X A;  4MI7 A;  1EWO A;  1AYU A;  2DC8 A;  2F1G A;  2P0R A;  4XZX A;  4HWY A;  3MP2 A;  3RVV A;  1AU3 A;  4QBB A;  1GCB A;  5JH3 A;  2J7Q C;  1QXP A;  1CSB B;  3IEJ A;  2BDL A;  2XU4 A;  1IWD A;  1MEM A;  2FTD A;  4BS6 A;  2WBF X;  4MZO A;  2BU3 A;  3BWK A;  2DZZ A;  3RVW A;  4PP1 A;  1MHW A;  4CDF B;  1CS8 A;  2JQF R;  4PAD A;  2P7U A;  4OVZ B;  4AXM A;  3QJ3 A;  4OEL A;  3PW3 A;  2E02 A;  2PNS A;  4DMY A;  5EGW A;  1YVB A;  4Q8H A;  1HUC B;  1EWM A;  2DCB A;  2E03 A;  3BB7 A;  2DC9 A;  4OW0 A;  3RVX A;  4YV8 A;  4RY2 A;  4FK5 A;  2FRA A;  2C0Y A;  1ME3 A;  6PAD A;  3PSE A;  2ARY A;  2AVW A;  4YYW A;  3P5V A;  3K9M A;  1MS6 A;  2YJB A;  4Q8G A;  2PAD A;  1BQI A;  3K24 A;  4W5B A;  4N8W A;  5KO3 A;  1NL6 A;  2JRI A;  3PHU A;  1O0E A;  1YT7 A;  4BOQ A;  4BOP A;  2VHF A;  4X6I A;  5CHV A;  5CVM A;  4ZTB A;  1EWP A;  2FUD A;  4BSQ A;  4I05 A;  2FQ9 A;  2ACT A;  1NB5 A;  3N3G A;  3F75 A;  4A5U A;  1Q6K A;  4D8B A;  8PCH A;  4YVA A;  5JA7 A;  3PT2 A;  2DJG B;  2BTW A;  1GEC E;  3HHA A;  2DOS A;  2NQA A;  2DJF B;  3QSD A;  3MOR A; 
#chains in the Genus database with same CATH homology
 3HHI A;  1M6D A;  5K16 A;  2AYN A;  2R9M A;  1TLO A;  1AU4 A;  2CB5 A;  2B1N A;  3CH2 X;  4AXL A;  2FO5 A;  1AU0 A;  2XU1 A;  1GMY A;  2YJC A;  3KKU A;  1CQD A;  1ME4 A;  3WXE A;  2H7J A;  2E01 A;  3H8C A;  3IMA A;  4MSX A;  2ATO A;  3WXF A;  2E00 A;  4BPV A;  4I04 A;  1POP A;  4QRV A;  1EWL A;  3H89 A;  3OIS A;  4FIP A;  1PCI A;  1AYW A;  3B79 A;  1KHP A;  1SNK A;  1AU2 A;  2O6X A;  4ZUX U;  2AYO A;  2R9N A;  1MDW A;  2AIM A;  3MTN A;  1PPO A;  1Y4H A;  1GLO A;  3KWB X;  4YYQ A;  4G54 A;  3KX1 A;  4X6J A;  3H8B A;  1MIR A;  1ATK A;  3N4C A;  1U9W A;  3K8U A;  4K7C A;  1F2C A;  9PAP A;  5CHT A;  4CZW A;  1CVZ A;  3HD3 A;  1YK7 A;  2F7D A;  1F2B A;  1PPD A;  2P86 A;  4WA6 A;  1ICF A;  4PP2 E;  1NLJ A;  3IOQ A;  2HXZ A;  3USV A;  1U9X A;  2AS8 A;  1CJL A;  2Y5B A;  2Y6E A;  3I06 A;  3KSE A;  1CTE A;  1YAL A;  1TU6 A;  1CV8 A;  3S3Q A;  2DCD A;  2CIO A;  3AI8 A;  2OP3 A;  1PPP A;  3PNR A;  1BY8 A;  1DEU A;  2YJ9 A;  1K3B B;  1PAD A;  1KHQ A;  3MHH A;  4N79 A;  3BPF A;  3CBJ A;  1BP4 A;  1ZIV A;  4CDE B;  4YYS A;  1PPN A;  1NQC A;  4YYV A;  2GFO A;  2DC6 A;  4XUI A;  2PBH A;  2DZY A;  3QT4 A;  5CVO B;  1S4V A;  4BQV A;  4KLB A;  1FH0 A;  7PCK A;  1PIP A;  2JQG R;  4P6E A;  1CPJ A;  4BGF A;  2FRQ A;  3KWZ A;  2BDZ A;  2FYE A;  3OVX A;  3H7D A;  2XU5 A;  1PXV A;  3BCN A;  2XU3 A;  1THE A;  1KXR A;  5F02 A;  2OUL A;  2VFC A;  3S3R A;  1XKG A;  2DCC A;  3ERV A;  4OEM A;  1CB5 A;  2DCA A;  3OF8 A;  2VHS A;  1U9V A;  4PI3 A;  2GHU A;  2R6N A;  1AYV A;  1W5R A;  1DF0 A;  1AIM A;  4QRX A;  3KFQ A;  3I3T A;  4QRG A;  2YJ8 A;  4DMX A;  3IV2 A;  3HWN A;  2R9C A;  3P5W A;  1F29 A;  1A6R A;  3V6E A;  4GUZ A;  1U9Q X;  3BPM A;  3WXG A;  1NPZ A;  1TL9 A;  3D9W A;  1KFX L;  2G8E A;  2HHN A;  3O0U A;  1AEC A;  4X6H A;  3TNX A;  1PE6 A;  2NQI A;  2G8J A;  3IUT A;  2DC7 A;  4FJC A;  3PDF A;  4NV8 A;  2YJ2 A;  3OF9 A;  1BGO A;  2G6D A;  3H6S A;  1SP4 B;  3LFY A;  3M99 A;  1NB3 A;  2R9O A;  1KFU L;  3BOW A;  5A24 A;  3OVZ A;  5FPW A;  1PBH A;  1QMY A;  2B1M A;  2HH5 A;  2IBI A;  2PRE A;  3MHS A;  1ZCM A;  3DF0 A;  4YYR A;  3CH3 X;  2HD5 A;  1YK8 A;  4QH6 A;  3PBH A;  4BS5 A;  3NHE A;  1QDQ A;  3BC3 A;  3IHP A;  2AUX A;  5EF4 A;  1U5I A;  4YYU A;  3GCB A;  1F2A A;  3ZUA A;  1Y08 A;  2R9F A;  4P6G A;  4I07 A;  1VSN A;  1JQP A;  4W5C A;  4W4U A;  2IPP B;  3E1Z B;  5CVN B;  5PAD A;  4CDD B;  4MZS A;  2AUZ A;  1QOL A;  3KW9 A;  1VJV A;  2NQG A;  1EF7 A;  1GX3 A;  3LXS A;  3N3K A;  4CDC B;  1STF E;  4XR7 A;  5J94 A;  1MEG A;  2FT2 A;  2G7Y A;  4N4Z A;  1ITO A;  3LTW A;  3U8E A;  2OZ2 A;  3O1G A;  3C9E A;  1X9Y A;  2NQD B;  3F5V A;  3D6S A;  3P5U A;  3V6C A;  3CBK A;  2AU1 A;  3P5X A;  1EWO A;  2VFB A;  1AYU A;  2DC8 A;  2F1G A;  2P0R A;  4HWY A;  3RVV A;  1AU3 A;  4QBB A;  1W4T A;  1GCB A;  5JH3 A;  1W6F A;  1QXP A;  1CSB B;  3IEJ A;  2BDL A;  2XU4 A;  1IWD A;  1MEM A;  2FTD A;  4BS6 A;  2WBF X;  4MZO A;  3BWK A;  2DZZ A;  3RVW A;  4PP1 A;  1MHW A;  4CDF B;  1CS8 A;  2JQF R;  4NV7 A;  4PAD A;  2P7U A;  4AXM A;  3QJ3 A;  4OEL A;  3PW3 A;  2E02 A;  2PNS A;  4DMY A;  5EGW A;  1YVB A;  4Q8H A;  1HUC B;  1EWM A;  2DCB A;  1E2T A;  2E03 A;  4B55 A;  2DC9 A;  3RVX A;  4YV8 A;  4RY2 A;  4FK5 A;  2FRA A;  2C0Y A;  1ME3 A;  6PAD A;  2ARY A;  2AVW A;  4YYW A;  3P5V A;  3K9M A;  1MS6 A;  2YJB A;  4Q8G A;  2PAD A;  1BQI A;  3K24 A;  4W5B A;  4C5P A;  4N8W A;  1NL6 A;  1O0E A;  1YT7 A;  2BSZ A;  2VHF A;  4X6I A;  5CHV A;  5CVM A;  1EWP A;  2FUD A;  4BSQ A;  4I05 A;  2FQ9 A;  2ACT A;  1NB5 A;  3N3G A;  3F75 A;  1Q6K A;  8PCH A;  4YVA A;  5JA7 A;  2DJG B;  1GEC E;  3HHA A;  2NQA A;  2DJF B;  3QSD A;  3MOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...