1X9YA

The prostaphopain b structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
346
Chain Sequence
KQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGYLEVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords cysteine proteinase
publication title Prostaphopain B structure: a comparison of proregion-mediated and staphostatin-mediated protease inhibition.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 116
structure length 346
sequence length 357
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.-:
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
A PF14731 Staphopain_pro Staphopain proregion
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.500.10 Alpha Beta Roll prostaphopain b, domain 1 Staphopain proregion domain 1x9yA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1x9yA02
1CS8A 2CIOA 1NPZA 1EWLA 4I07A 3IMAA 2DCAA 1KHQA 2AUXA 1PPPA 2Y5BA 2YJCA 2R6NA 2P86A 2HXZA 3RVVA 2FT2A 3H6SA 4KLBA 3KX1A 4PP1A 2DJGB 4WA6A 4BPVA 3LXSA 4OEMA 3K24A 2NQGA 1EF7A 3IUTA 3I3TA 4YYVA 3HD3A 1F29A 2E01A 5FPWA 1AIMA 1MIRA 3I06A 1NB3A 1GMYA 4I05A 2R9MA 2AYOA 2PNSA 1XKGA 2YJBA 5CHVA 4AXLA 4X6HA 3PDFA 2FYEA 4W5CA 4ZUXU 3CH2X 4AXMA 1KFXL 4N79A 4BS6A 3GCBA 3CH3X 7PCKA 1CQDA 4X6IA 1EWMA 1CVZA 1YVBA 3ERVA 4CDEB 4MZSA 8PCHA 3H8CA 3USVA 4FK5A 3O1GA 1CJLA 3CBKA 1MEGA 1SNKA 4OELA 4MSXA 5J94A 2OP3A 3PBHA 3AI8A 4YV8A 1GCBA 1VJVA 2PADA 2G6DA 1AECA 1GECE 1CSBB 4X6JA 1AU0A 4P6EA 1CPJA 2E02A 3WXFA 3RVWA 3WXGA 3H7DA 4PI3A 2WBFX 3IHPA 1U9XA 4DMXA 2ACTA 4CDCB 1PADA 3P5UA 9PAPA 2DJFB 2AU1A 2FRAA 3D6SA 4HWYA 1U9WA 1YK8A 1BGOA 1ATKA 2BDZA 2FO5A 5K16A 3P5VA 1STFE 3BPFA 2FTDA 3KWBX 1IWDA 4N4ZA 1TL9A 2OZ2A 1ZIVA 2IPPB 4CZWA 2CB5A 1MDWA 1ME3A 1BY8A 3N3KA 1Q6KA 1DEUA 2AYNA 2NQDB 3K8UA 3OISA 1PBHA 4QRVA 2XU3A 3HHIA 4XUIA 4QRXA 4W4UA 4Q8GA 1NQCA 2NQIA 5PADA 2ATOA 1ITOA 1QOLA 2P0RA 2IBIA 1QMYA 2FRQA 5EF4A 3IOQA 2ARYA 3LFYA 1MHWA 2AIMA 3BWKA 4YYWA 4Q8HA 3KKUA 1KHPA 1O0EA 2P7UA 5A24A 4FJCA 1ICFA 1PPDA 2PBHA 4YYSA 3PNRA 3PW3A 4QRGA 2B1NA 2C0YA 2DCCA 1BP4A 3OF9A 2OULA 3P5WA 5CVMA 3TNXA 3QJ3A 6PADA 1THEA 1HUCB 2XU5A 1AYUA 1Y08A 2DC7A 1GLOA 2F7DA 2G8JA 4BSQA 2AS8A 3K9MA 1TU6A 1MEMA 1MS6A 4K7CA 3NHEA 1KFUL 1A6RA 3H89A 3QT4A 3QSDA 1AYVA 1AYWA 4BQVA 2R9NA 4DMYA 1F2CA 4PP2E 1NL6A 2F1GA 1PIPA 2DC8A 2R9OA 3OF8A 3BCNA 2PREA 1BQIA 3E1ZB 3V6EA 1KXRA 1M6DA 1CV8A 4CDFB 2HD5A 2VHSA 3S3QA 1YT7A 2E00A 1F2AA 3F5VA 3MHSA 3O0UA 3BOWA 2B1MA 4XR7A 1YK7A 2HHNA 2YJ9A 3KW9A 1AU2A 4QH6A 3N4CA 2G7YA 2GHUA 4P6GA 4QBBA 1U9VA 3MORA 1SP4B 3S3RA 2O6XA 2R9FA 2AVWA 4FIPA 2R9CA 5F02A 1CB5A 4YYQA 2G8EA 1PPOA 1U5IA 1VSNA 2YJ2A 3C9EA 2Y6EA 5JA7A 1QDQA 2DZYA 4N8WA 3IV2A 4MZOA 5JH3A 3MTNA 2BDLA 3IEJA 1Y4HA 1NLJA 4PADA 1AU3A 2H7JA 3F75A 1AU4A 3KWZA 4YYUA 1FH0A 3MHHA 5EGWA 2E03A 3KFQA 4YYRA 1EWPA 2AUZA 3HHAA 3OVZA 3RVXA 5CVOB 1F2BA 1NB5A 2DZZA 4W5BA 2HH5A 1JQPA 1X9YA 2FQ9A 4YVAA 2XU1A 2DC9A 1PXVA 4CDDB 1ME4A 4I04A 2JQGR 3V6CA 5CHTA 2NQAA 1POPA 1PCIA 2VHFA 1U9QX 1YALA 1EWOA 1ZCMA 2JQFR 1PPNA 1QXPA 4BS5A 3BC3A 3CBJA 2DCDA 3OVXA 3B79A 2GFOA 5CVNB 3M99A 2DC6A 1CTEA 2DCBA 4RY2A 1DF0A 3P5XA 1PE6A 4G54A 3H8BA 3ZUAA 3U8EA 2YJ8A 3N3GA 2XU4A 1TLOA 3KSEA 3BPMA 2FUDA 3DF0A 3HWNA 1S4VA 3WXEA 1K3BB
chains in the Genus database with same CATH superfamily
1CS8A 2CIOA 1NPZA 1EWLA 4I07A 2AGAA 1PVJA 3IMAA 2DCAA 3PRPA 4RNAA 1KHQA 2AUXA 3C0RA 1PPPA 2Y5BA 2YJCA 2R6NA 2J7QA 2HXZA 2P86A 2BU3A 3RVVA 2FT2A 3H6SA 4KLBA 3KX1A 4PP1A 2DJGB 4WA6A 4BPVA 3LXSA 4OEMA 3K24A 2NQGA 1EF7A 3W30A 3IUTA 3I3TA 4YYVA 3HD3A 1F29A 2E01A 4BOPA 5FPWA 3MJ5A 5E6JA 1AIMA 1MIRA 3I06A 3B21A 1NB3A 1GMYA 4I05A 2R9MA 4RF0A 2AYOA 2PNSA 1XKGA 2YJBA 5CHVA 4AXLA 4X6HA 3PDFA 2FYEA 4W5CA 4ZUXU 4RF1A 3CH2X 4AXMA 1KFXL 4N79A 4BS6A 3GCBA 3CH3X 5EZQA 7PCKA 1CQDA 3BB7A 4X6IA 3E9SA 4HXDB 1EWMA 4XZXA 1CVZA 1YVBA 3ERVA 4CDEB 2JRIA 4MZSA 8PCHA 3H8CA 3USVA 4FK5A 3O1GA 1CJLA 3CBKA 1MEGA 1SNKA 4OELA 3MTVA 4MSXA 5J94A 2OP3A 3PBHA 3AI8A 4YV8A 1GCBA 1VJVA 2PADA 2G6DA 3O65A 1AECA 1GECE 4WURA 1CSBB 4X6JA 1AU0A 4P6EA 1CPJA 2E02A 3WXFA 3RVWA 3WXGA 3H7DA 4PI3A 2WBFX 3IHPA 1U9XA 4DMXA 2ACTA 4CDCB 1PADA 3P5UA 9PAPA 2DJFB 2AU1A 2FRAA 3D6SA 4HWYA 1U9WA 1YK8A 1BGOA 1ATKA 2BDZA 2FO5A 5K16A 3P5VA 1STFE 3BPFA 2FTDA 3PHUA 3KWBX 1IWDA 4N4ZA 1TL9A 2OZ2A 1ZIVA 2IPPB 4P16A 4CZWA 2CB5A 3PT2A 1MDWA 1ME3A 1BY8A 3N3KA 4M0WA 1Q6KA 1DEUA 2AYNA 2NQDB 3K8UA 3OISA 1PBHA 4QRVA 2XU3A 3HHIA 1YZBA 4XUIA 4QRXA 4W4UA 4Q8GA 1NQCA 2NQIA 4BOZA 3IFUA 5PADA 2ATOA 1ITOA 1QOLA 2P0RA 2IBIA 1QMYA 2FRQA 5EF4A 3IOQA 4PT5A 2ARYA 3LFYA 1MHWA 2AIMA 3BWKA 4YYWA 4Q8HA 3KKUA 4IUMA 1KHPA 1O0EA 2P7UA 4BOUA 5A24A 4FJCA 1ICFA 1PPDA 2PBHA 4YYSA 3PNRA 3PW3A 2UZJA 4QRGA 2B1NA 2C0YA 4D8IA 2DCCA 1BP4A 3OF9A 2BTWA 2OULA 3P5WA 5CVMA 3TNXA 3QJ3A 6PADA 2BTWB 1THEA 4OVZA 3W31A 1HUCB 2XU5A 3PRMA 1AYUA 4OVZB 1Y08A 2DC7A 1GLOA 2F7DA 2G8JA 3BBAA 4BSQA 2AS8A 3K9MA 1TU6A 1MEMA 5EZSA 1MS6A 4K7CA 3NHEA 1KFUL 1A6RA 3H89A 3QT4A 3QSDA 1AYVA 1AYWA 4BQVA 2R9NA 4DMYA 1F2CA 4GUAA 4PP2E 1NL6A 2F1GA 1PIPA 4OW0A 2DC8A 2R9OA 3OF8A 3BCNA 2PREA 1BQIA 3E1ZB 3V6EA 1KXRA 1M6DA 1CV8A 4CDFB 2HD5A 2VHSA 2Z84A 4R3DA 1YT7A 3S3QA 4REZA 2E00A 1F2AA 3F5VA 3MHSA 3O0UA 3BOWA 2B1MA 4IP3A 4XR7A 1YK7A 2HHNA 2YJ9A 3KW9A 1AU2A 4QH6A 3N4CA 2G7YA 2GHUA 4P6GA 4QBBA 1U9VA 3MORA 3TMPA 1SP4B 3S3RA 2O6XA 2R9FA 2FE8A 2AVWA 4FIPA 4RKXA 2R9CA 5F02A 1CB5A 4YYQA 2G8EA 1PPOA 1U5IA 3PHWA 1VSNA 2YJ2A 3C9EA 5KO3A 2Y6EA 5JA7A 1QDQA 2DZYA 4N8WA 3IV2A 4D8EA 4MZOA 5JH3A 3MTNA 2BDLA 3IEJA 1Y4HA 4MI7A 1NLJA 4PADA 1AU3A 2H7JA 3F75A 1AU4A 3KWZA 2DOSA 4YYUA 1FH0A 3MHHA 5EGWA 3OQCA 1UKFA 2E03A 3KFQA 4YYRA 1DKIA 1EWPA 2AUZA 3HHAA 3TRKA 3OVZA 3RVXA 5CVOB 2J7QC 1F2BA 1NB5A 2DZZA 4W5BA 4ZTBA 2HH5A 1JQPA 1X9YA 2FQ9A 3ZNHA 4YVAA 2XU1A 2DC9A 1PXVA 4CDDB 1ME4A 4I04A 2JQGR 3MP2A 3V6CA 5CHTA 2NQAA 1POPA 1PCIA 4BOSA 2VHFA 1U9QX 1YALA 1EWOA 3PSEA 1ZCMA 2JQFR 1PPNA 1QXPA 4BS5A 3BC3A 3CBJA 2DCDA 3OVXA 3B79A 2GFOA 5CVNB 3M99A 3RNVA 2DC6A 1CTEA 2DCBA 4RY2A 1DF0A 3P5XA 4A5UA 1PE6A 3H8BA 4G54A 3ZUAA 4MM3B 3U8EA 2YJ8A 3BY4A 2JTCA 3N3GA 2XU4A 4BOQA 1TLOA 3PHXA 3KSEA 3BPMA 2FUDA 2HWKA 3DF0A 3HWNA 5JZEA 1S4VA 3WXEA 4D8BA 1K3BB
chains in the Genus database with same CATH topology
1CS8A 2CIOA 1NPZA 1EWLA 4I07A 3IMAA 2DCAA 1KHQA 2AUXA 1PPPA 2Y5BA 2YJCA 2R6NA 2P86A 2HXZA 3RVVA 2FT2A 3H6SA 4KLBA 3KX1A 4PP1A 2DJGB 4WA6A 4BPVA 3LXSA 4OEMA 3K24A 2NQGA 1EF7A 3IUTA 3I3TA 4YYVA 3HD3A 1F29A 2E01A 5FPWA 1AIMA 1MIRA 3I06A 1NB3A 2VFBA 1GMYA 4I05A 2R9MA 2AYOA 2PNSA 1XKGA 2YJBA 5CHVA 4AXLA 4X6HA 3PDFA 2FYEA 4W5CA 4ZUXU 3CH2X 4AXMA 1KFXL 4N79A 4BS6A 3GCBA 3CH3X 7PCKA 1CQDA 4X6IA 4NV8A 1EWMA 1CVZA 1YVBA 4C5PA 3ERVA 4CDEB 4MZSA 8PCHA 3H8CA 3USVA 4FK5A 3O1GA 1CJLA 3CBKA 1MEGA 1SNKA 4OELA 4MSXA 5J94A 2OP3A 3PBHA 3AI8A 4YV8A 1GCBA 1VJVA 2PADA 2G6DA 1AECA 4GUZA 1GECE 1CSBB 4X6JA 1AU0A 4P6EA 4B55A 1CPJA 2E02A 3WXFA 3RVWA 3WXGA 3H7DA 4PI3A 2WBFX 3IHPA 1U9XA 4DMXA 2ACTA 4CDCB 1PADA 3P5UA 9PAPA 2DJFB 2AU1A 2FRAA 3D6SA 4HWYA 1U9WA 1YK8A 1BGOA 4NV7A 1ATKA 2BDZA 2FO5A 5K16A 3P5VA 1STFE 3BPFA 2FTDA 3KWBX 1IWDA 4N4ZA 1TL9A 2OZ2A 1ZIVA 2IPPB 4CZWA 2CB5A 1MDWA 1ME3A 1BY8A 3N3KA 1Q6KA 1DEUA 2AYNA 2NQDB 3K8UA 3OISA 1PBHA 4QRVA 2XU3A 3HHIA 4XUIA 4QRXA 4W4UA 4Q8GA 1NQCA 2NQIA 5PADA 2ATOA 1ITOA 1QOLA 2P0RA 2IBIA 1QMYA 2FRQA 5EF4A 3IOQA 2ARYA 3LFYA 1MHWA 2AIMA 3BWKA 4YYWA 4Q8HA 3KKUA 1KHPA 1O0EA 2P7UA 5A24A 4FJCA 1ICFA 1PPDA 2PBHA 4YYSA 3PNRA 3PW3A 4QRGA 2B1NA 2C0YA 1W6FA 2DCCA 1BP4A 3OF9A 2OULA 3P5WA 5CVMA 3TNXA 3QJ3A 1W5RA 6PADA 1THEA 1HUCB 2XU5A 1AYUA 1Y08A 2DC7A 1GLOA 2F7DA 2G8JA 4BSQA 2AS8A 3K9MA 1TU6A 1MEMA 1MS6A 4K7CA 3NHEA 1KFUL 1A6RA 3H89A 3QT4A 3QSDA 1AYVA 1AYWA 4BQVA 2R9NA 4DMYA 1F2CA 4PP2E 1NL6A 2F1GA 1PIPA 1E2TA 2DC8A 2R9OA 3OF8A 3BCNA 2PREA 2VFCA 1BQIA 3E1ZB 3V6EA 1KXRA 1M6DA 1CV8A 4CDFB 2HD5A 2VHSA 3S3QA 1YT7A 1W4TA 2E00A 1F2AA 3F5VA 3MHSA 3O0UA 3BOWA 2B1MA 4XR7A 1YK7A 2HHNA 2YJ9A 3KW9A 1AU2A 4QH6A 3N4CA 2G7YA 2GHUA 4P6GA 4QBBA 1U9VA 3MORA 1SP4B 3S3RA 2O6XA 2R9FA 2AVWA 4FIPA 2R9CA 5F02A 1CB5A 4YYQA 2G8EA 1PPOA 1U5IA 1VSNA 2YJ2A 3C9EA 2Y6EA 5JA7A 1QDQA 2DZYA 4N8WA 3IV2A 4MZOA 5JH3A 3MTNA 4BGFA 2BDLA 3IEJA 1Y4HA 1NLJA 4PADA 1AU3A 2H7JA 3F75A 1AU4A 3KWZA 4YYUA 1FH0A 3MHHA 5EGWA 3D9WA 2E03A 3KFQA 4YYRA 1EWPA 2AUZA 3HHAA 2BSZA 3OVZA 3RVXA 5CVOB 1F2BA 1NB5A 2DZZA 4W5BA 2HH5A 1JQPA 1X9YA 2FQ9A 4YVAA 1GX3A 2XU1A 2DC9A 1PXVA 4CDDB 1ME4A 4I04A 2JQGR 3V6CA 5CHTA 2NQAA 1POPA 1PCIA 2VHFA 1U9QX 1YALA 1EWOA 1ZCMA 2JQFR 1PPNA 1QXPA 4BS5A 3BC3A 3CBJA 2DCDA 3OVXA 3B79A 2GFOA 3LTWA 5CVNB 3M99A 2DC6A 1CTEA 2DCBA 4RY2A 1DF0A 3P5XA 1PE6A 4G54A 3H8BA 3ZUAA 3U8EA 2YJ8A 3N3GA 2XU4A 1TLOA 3KSEA 3BPMA 2FUDA 3DF0A 3HWNA 1S4VA 3WXEA 1K3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CS8 A;  2CIO A;  1NPZ A;  1EWL A;  4I07 A;  3IMA A;  2DCA A;  1KHQ A;  2AUX A;  1PPP A;  2Y5B A;  2YJC A;  2R6N A;  2P86 A;  2HXZ A;  3RVV A;  2FT2 A;  3H6S A;  4KLB A;  3KX1 A;  4PP1 A;  2DJG B;  4WA6 A;  4BPV A;  3LXS A;  4OEM A;  3K24 A;  2NQG A;  1EF7 A;  3IUT A;  3I3T A;  4YYV A;  3HD3 A;  1F29 A;  2E01 A;  5FPW A;  1AIM A;  1MIR A;  3I06 A;  1NB3 A;  1GMY A;  4I05 A;  2R9M A;  2AYO A;  2PNS A;  1XKG A;  2YJB A;  5CHV A;  4AXL A;  4X6H A;  3PDF A;  2FYE A;  4W5C A;  4ZUX U;  3CH2 X;  4AXM A;  1KFX L;  4N79 A;  4BS6 A;  3GCB A;  3CH3 X;  7PCK A;  1CQD A;  4X6I A;  1EWM A;  1CVZ A;  1YVB A;  3ERV A;  4CDE B;  4MZS A;  8PCH A;  3H8C A;  3USV A;  4FK5 A;  3O1G A;  1CJL A;  3CBK A;  1MEG A;  1SNK A;  4OEL A;  4MSX A;  5J94 A;  2OP3 A;  3PBH A;  3AI8 A;  4YV8 A;  1GCB A;  1VJV A;  2PAD A;  2G6D A;  1AEC A;  1GEC E;  1CSB B;  4X6J A;  1AU0 A;  4P6E A;  1CPJ A;  2E02 A;  3WXF A;  3RVW A;  3WXG A;  3H7D A;  4PI3 A;  2WBF X;  3IHP A;  1U9X A;  4DMX A;  2ACT A;  4CDC B;  1PAD A;  3P5U A;  9PAP A;  2DJF B;  2AU1 A;  2FRA A;  3D6S A;  4HWY A;  1U9W A;  1YK8 A;  1BGO A;  1ATK A;  2BDZ A;  2FO5 A;  5K16 A;  3P5V A;  1STF E;  3BPF A;  2FTD A;  3KWB X;  1IWD A;  4N4Z A;  1TL9 A;  2OZ2 A;  1ZIV A;  2IPP B;  4CZW A;  2CB5 A;  1MDW A;  1ME3 A;  1BY8 A;  3N3K A;  1Q6K A;  1DEU A;  2AYN A;  2NQD B;  3K8U A;  3OIS A;  1PBH A;  4QRV A;  2XU3 A;  3HHI A;  4XUI A;  4QRX A;  4W4U A;  4Q8G A;  1NQC A;  2NQI A;  5PAD A;  2ATO A;  1ITO A;  1QOL A;  2P0R A;  2IBI A;  1QMY A;  2FRQ A;  5EF4 A;  3IOQ A;  2ARY A;  3LFY A;  1MHW A;  2AIM A;  3BWK A;  4YYW A;  4Q8H A;  3KKU A;  1KHP A;  1O0E A;  2P7U A;  5A24 A;  4FJC A;  1ICF A;  1PPD A;  2PBH A;  4YYS A;  3PNR A;  3PW3 A;  4QRG A;  2B1N A;  2C0Y A;  2DCC A;  1BP4 A;  3OF9 A;  2OUL A;  3P5W A;  5CVM A;  3TNX A;  3QJ3 A;  6PAD A;  1THE A;  1HUC B;  2XU5 A;  1AYU A;  1Y08 A;  2DC7 A;  1GLO A;  2F7D A;  2G8J A;  4BSQ A;  2AS8 A;  3K9M A;  1TU6 A;  1MEM A;  1MS6 A;  4K7C A;  3NHE A;  1KFU L;  1A6R A;  3H89 A;  3QT4 A;  3QSD A;  1AYV A;  1AYW A;  4BQV A;  2R9N A;  4DMY A;  1F2C A;  4PP2 E;  1NL6 A;  2F1G A;  1PIP A;  2DC8 A;  2R9O A;  3OF8 A;  3BCN A;  2PRE A;  1BQI A;  3E1Z B;  3V6E A;  1KXR A;  1M6D A;  1CV8 A;  4CDF B;  2HD5 A;  2VHS A;  3S3Q A;  1YT7 A;  2E00 A;  1F2A A;  3F5V A;  3MHS A;  3O0U A;  3BOW A;  2B1M A;  4XR7 A;  1YK7 A;  2HHN A;  2YJ9 A;  3KW9 A;  1AU2 A;  4QH6 A;  3N4C A;  2G7Y A;  2GHU A;  4P6G A;  4QBB A;  1U9V A;  3MOR A;  1SP4 B;  3S3R A;  2O6X A;  2R9F A;  2AVW A;  4FIP A;  2R9C A;  5F02 A;  1CB5 A;  4YYQ A;  2G8E A;  1PPO A;  1U5I A;  1VSN A;  2YJ2 A;  3C9E A;  2Y6E A;  5JA7 A;  1QDQ A;  2DZY A;  4N8W A;  3IV2 A;  4MZO A;  5JH3 A;  3MTN A;  2BDL A;  3IEJ A;  1Y4H A;  1NLJ A;  4PAD A;  1AU3 A;  2H7J A;  3F75 A;  1AU4 A;  3KWZ A;  4YYU A;  1FH0 A;  3MHH A;  5EGW A;  2E03 A;  3KFQ A;  4YYR A;  1EWP A;  2AUZ A;  3HHA A;  3OVZ A;  3RVX A;  5CVO B;  1F2B A;  1NB5 A;  2DZZ A;  4W5B A;  2HH5 A;  1JQP A;  1X9Y A;  2FQ9 A;  4YVA A;  2XU1 A;  2DC9 A;  1PXV A;  4CDD B;  1ME4 A;  4I04 A;  2JQG R;  3V6C A;  5CHT A;  2NQA A;  1POP A;  1PCI A;  2VHF A;  1U9Q X;  1YAL A;  1EWO A;  1ZCM A;  2JQF R;  1PPN A;  1QXP A;  4BS5 A;  3BC3 A;  3CBJ A;  2DCD A;  3OVX A;  3B79 A;  2GFO A;  5CVN B;  3M99 A;  2DC6 A;  1CTE A;  2DCB A;  4RY2 A;  1DF0 A;  3P5X A;  1PE6 A;  4G54 A;  3H8B A;  3ZUA A;  3U8E A;  2YJ8 A;  3N3G A;  2XU4 A;  1TLO A;  3KSE A;  3BPM A;  2FUD A;  3DF0 A;  3HWN A;  1S4V A;  3WXE A;  1K3B B; 
#chains in the Genus database with same CATH topology
 1CS8 A;  2CIO A;  1NPZ A;  1EWL A;  4I07 A;  2AGA A;  1PVJ A;  3IMA A;  2DCA A;  3PRP A;  4RNA A;  1KHQ A;  2AUX A;  3C0R A;  1PPP A;  2Y5B A;  2YJC A;  2R6N A;  2J7Q A;  2HXZ A;  2P86 A;  2BU3 A;  3RVV A;  2FT2 A;  3H6S A;  4KLB A;  3KX1 A;  4PP1 A;  2DJG B;  4WA6 A;  4BPV A;  3LXS A;  4OEM A;  3K24 A;  2NQG A;  1EF7 A;  3W30 A;  3IUT A;  3I3T A;  4YYV A;  3HD3 A;  1F29 A;  2E01 A;  4BOP A;  5FPW A;  3MJ5 A;  5E6J A;  1AIM A;  1MIR A;  3I06 A;  3B21 A;  1NB3 A;  1GMY A;  4I05 A;  2R9M A;  4RF0 A;  2AYO A;  2PNS A;  1XKG A;  2YJB A;  5CHV A;  4AXL A;  4X6H A;  3PDF A;  2FYE A;  4W5C A;  4ZUX U;  4RF1 A;  3CH2 X;  4AXM A;  1KFX L;  4N79 A;  4BS6 A;  3GCB A;  3CH3 X;  5EZQ A;  7PCK A;  1CQD A;  3BB7 A;  4X6I A;  3E9S A;  4HXD B;  1EWM A;  4XZX A;  1CVZ A;  1YVB A;  3ERV A;  4CDE B;  2JRI A;  4MZS A;  8PCH A;  3H8C A;  3USV A;  4FK5 A;  3O1G A;  1CJL A;  3CBK A;  1MEG A;  1SNK A;  4OEL A;  3MTV A;  4MSX A;  5J94 A;  2OP3 A;  3PBH A;  3AI8 A;  4YV8 A;  1GCB A;  1VJV A;  2PAD A;  2G6D A;  3O65 A;  1AEC A;  1GEC E;  4WUR A;  1CSB B;  4X6J A;  1AU0 A;  4P6E A;  1CPJ A;  2E02 A;  3WXF A;  3RVW A;  3WXG A;  3H7D A;  4PI3 A;  2WBF X;  3IHP A;  1U9X A;  4DMX A;  2ACT A;  4CDC B;  1PAD A;  3P5U A;  9PAP A;  2DJF B;  2AU1 A;  2FRA A;  3D6S A;  4HWY A;  1U9W A;  1YK8 A;  1BGO A;  1ATK A;  2BDZ A;  2FO5 A;  5K16 A;  3P5V A;  1STF E;  3BPF A;  2FTD A;  3PHU A;  3KWB X;  1IWD A;  4N4Z A;  1TL9 A;  2OZ2 A;  1ZIV A;  2IPP B;  4P16 A;  4CZW A;  2CB5 A;  3PT2 A;  1MDW A;  1ME3 A;  1BY8 A;  3N3K A;  4M0W A;  1Q6K A;  1DEU A;  2AYN A;  2NQD B;  3K8U A;  3OIS A;  1PBH A;  4QRV A;  2XU3 A;  3HHI A;  1YZB A;  4XUI A;  4QRX A;  4W4U A;  4Q8G A;  1NQC A;  2NQI A;  4BOZ A;  3IFU A;  5PAD A;  2ATO A;  1ITO A;  1QOL A;  2P0R A;  2IBI A;  1QMY A;  2FRQ A;  5EF4 A;  3IOQ A;  4PT5 A;  2ARY A;  3LFY A;  1MHW A;  2AIM A;  3BWK A;  4YYW A;  4Q8H A;  3KKU A;  4IUM A;  1KHP A;  1O0E A;  2P7U A;  4BOU A;  5A24 A;  4FJC A;  1ICF A;  1PPD A;  2PBH A;  4YYS A;  3PNR A;  3PW3 A;  2UZJ A;  4QRG A;  2B1N A;  2C0Y A;  4D8I A;  2DCC A;  1BP4 A;  3OF9 A;  2BTW A;  2OUL A;  3P5W A;  5CVM A;  3TNX A;  3QJ3 A;  6PAD A;  2BTW B;  1THE A;  4OVZ A;  3W31 A;  1HUC B;  2XU5 A;  3PRM A;  1AYU A;  4OVZ B;  1Y08 A;  2DC7 A;  1GLO A;  2F7D A;  2G8J A;  3BBA A;  4BSQ A;  2AS8 A;  3K9M A;  1TU6 A;  1MEM A;  5EZS A;  1MS6 A;  4K7C A;  3NHE A;  1KFU L;  1A6R A;  3H89 A;  3QT4 A;  3QSD A;  1AYV A;  1AYW A;  4BQV A;  2R9N A;  4DMY A;  1F2C A;  4GUA A;  4PP2 E;  1NL6 A;  2F1G A;  1PIP A;  4OW0 A;  2DC8 A;  2R9O A;  3OF8 A;  3BCN A;  2PRE A;  1BQI A;  3E1Z B;  3V6E A;  1KXR A;  1M6D A;  1CV8 A;  4CDF B;  2HD5 A;  2VHS A;  2Z84 A;  4R3D A;  1YT7 A;  3S3Q A;  4REZ A;  2E00 A;  1F2A A;  3F5V A;  3MHS A;  3O0U A;  3BOW A;  2B1M A;  4IP3 A;  4XR7 A;  1YK7 A;  2HHN A;  2YJ9 A;  3KW9 A;  1AU2 A;  4QH6 A;  3N4C A;  2G7Y A;  2GHU A;  4P6G A;  4QBB A;  1U9V A;  3MOR A;  3TMP A;  1SP4 B;  3S3R A;  2O6X A;  2R9F A;  2FE8 A;  2AVW A;  4FIP A;  4RKX A;  2R9C A;  5F02 A;  1CB5 A;  4YYQ A;  2G8E A;  1PPO A;  1U5I A;  3PHW A;  1VSN A;  2YJ2 A;  3C9E A;  5KO3 A;  2Y6E A;  5JA7 A;  1QDQ A;  2DZY A;  4N8W A;  3IV2 A;  4D8E A;  4MZO A;  5JH3 A;  3MTN A;  2BDL A;  3IEJ A;  1Y4H A;  4MI7 A;  1NLJ A;  4PAD A;  1AU3 A;  2H7J A;  3F75 A;  1AU4 A;  3KWZ A;  2DOS A;  4YYU A;  1FH0 A;  3MHH A;  5EGW A;  3OQC A;  1UKF A;  2E03 A;  3KFQ A;  4YYR A;  1DKI A;  1EWP A;  2AUZ A;  3HHA A;  3TRK A;  3OVZ A;  3RVX A;  5CVO B;  2J7Q C;  1F2B A;  1NB5 A;  2DZZ A;  4W5B A;  4ZTB A;  2HH5 A;  1JQP A;  1X9Y A;  2FQ9 A;  3ZNH A;  4YVA A;  2XU1 A;  2DC9 A;  1PXV A;  4CDD B;  1ME4 A;  4I04 A;  2JQG R;  3MP2 A;  3V6C A;  5CHT A;  2NQA A;  1POP A;  1PCI A;  4BOS A;  2VHF A;  1U9Q X;  1YAL A;  1EWO A;  3PSE A;  1ZCM A;  2JQF R;  1PPN A;  1QXP A;  4BS5 A;  3BC3 A;  3CBJ A;  2DCD A;  3OVX A;  3B79 A;  2GFO A;  5CVN B;  3M99 A;  3RNV A;  2DC6 A;  1CTE A;  2DCB A;  4RY2 A;  1DF0 A;  3P5X A;  4A5U A;  1PE6 A;  3H8B A;  4G54 A;  3ZUA A;  4MM3 B;  3U8E A;  2YJ8 A;  3BY4 A;  2JTC A;  3N3G A;  2XU4 A;  4BOQ A;  1TLO A;  3PHX A;  3KSE A;  3BPM A;  2FUD A;  2HWK A;  3DF0 A;  3HWN A;  5JZE A;  1S4V A;  3WXE A;  4D8B A;  1K3B B; 
#chains in the Genus database with same CATH homology
 1CS8 A;  2CIO A;  1NPZ A;  1EWL A;  4I07 A;  3IMA A;  2DCA A;  1KHQ A;  2AUX A;  1PPP A;  2Y5B A;  2YJC A;  2R6N A;  2P86 A;  2HXZ A;  3RVV A;  2FT2 A;  3H6S A;  4KLB A;  3KX1 A;  4PP1 A;  2DJG B;  4WA6 A;  4BPV A;  3LXS A;  4OEM A;  3K24 A;  2NQG A;  1EF7 A;  3IUT A;  3I3T A;  4YYV A;  3HD3 A;  1F29 A;  2E01 A;  5FPW A;  1AIM A;  1MIR A;  3I06 A;  1NB3 A;  2VFB A;  1GMY A;  4I05 A;  2R9M A;  2AYO A;  2PNS A;  1XKG A;  2YJB A;  5CHV A;  4AXL A;  4X6H A;  3PDF A;  2FYE A;  4W5C A;  4ZUX U;  3CH2 X;  4AXM A;  1KFX L;  4N79 A;  4BS6 A;  3GCB A;  3CH3 X;  7PCK A;  1CQD A;  4X6I A;  4NV8 A;  1EWM A;  1CVZ A;  1YVB A;  4C5P A;  3ERV A;  4CDE B;  4MZS A;  8PCH A;  3H8C A;  3USV A;  4FK5 A;  3O1G A;  1CJL A;  3CBK A;  1MEG A;  1SNK A;  4OEL A;  4MSX A;  5J94 A;  2OP3 A;  3PBH A;  3AI8 A;  4YV8 A;  1GCB A;  1VJV A;  2PAD A;  2G6D A;  1AEC A;  4GUZ A;  1GEC E;  1CSB B;  4X6J A;  1AU0 A;  4P6E A;  4B55 A;  1CPJ A;  2E02 A;  3WXF A;  3RVW A;  3WXG A;  3H7D A;  4PI3 A;  2WBF X;  3IHP A;  1U9X A;  4DMX A;  2ACT A;  4CDC B;  1PAD A;  3P5U A;  9PAP A;  2DJF B;  2AU1 A;  2FRA A;  3D6S A;  4HWY A;  1U9W A;  1YK8 A;  1BGO A;  4NV7 A;  1ATK A;  2BDZ A;  2FO5 A;  5K16 A;  3P5V A;  1STF E;  3BPF A;  2FTD A;  3KWB X;  1IWD A;  4N4Z A;  1TL9 A;  2OZ2 A;  1ZIV A;  2IPP B;  4CZW A;  2CB5 A;  1MDW A;  1ME3 A;  1BY8 A;  3N3K A;  1Q6K A;  1DEU A;  2AYN A;  2NQD B;  3K8U A;  3OIS A;  1PBH A;  4QRV A;  2XU3 A;  3HHI A;  4XUI A;  4QRX A;  4W4U A;  4Q8G A;  1NQC A;  2NQI A;  5PAD A;  2ATO A;  1ITO A;  1QOL A;  2P0R A;  2IBI A;  1QMY A;  2FRQ A;  5EF4 A;  3IOQ A;  2ARY A;  3LFY A;  1MHW A;  2AIM A;  3BWK A;  4YYW A;  4Q8H A;  3KKU A;  1KHP A;  1O0E A;  2P7U A;  5A24 A;  4FJC A;  1ICF A;  1PPD A;  2PBH A;  4YYS A;  3PNR A;  3PW3 A;  4QRG A;  2B1N A;  2C0Y A;  1W6F A;  2DCC A;  1BP4 A;  3OF9 A;  2OUL A;  3P5W A;  5CVM A;  3TNX A;  3QJ3 A;  1W5R A;  6PAD A;  1THE A;  1HUC B;  2XU5 A;  1AYU A;  1Y08 A;  2DC7 A;  1GLO A;  2F7D A;  2G8J A;  4BSQ A;  2AS8 A;  3K9M A;  1TU6 A;  1MEM A;  1MS6 A;  4K7C A;  3NHE A;  1KFU L;  1A6R A;  3H89 A;  3QT4 A;  3QSD A;  1AYV A;  1AYW A;  4BQV A;  2R9N A;  4DMY A;  1F2C A;  4PP2 E;  1NL6 A;  2F1G A;  1PIP A;  1E2T A;  2DC8 A;  2R9O A;  3OF8 A;  3BCN A;  2PRE A;  2VFC A;  1BQI A;  3E1Z B;  3V6E A;  1KXR A;  1M6D A;  1CV8 A;  4CDF B;  2HD5 A;  2VHS A;  3S3Q A;  1YT7 A;  1W4T A;  2E00 A;  1F2A A;  3F5V A;  3MHS A;  3O0U A;  3BOW A;  2B1M A;  4XR7 A;  1YK7 A;  2HHN A;  2YJ9 A;  3KW9 A;  1AU2 A;  4QH6 A;  3N4C A;  2G7Y A;  2GHU A;  4P6G A;  4QBB A;  1U9V A;  3MOR A;  1SP4 B;  3S3R A;  2O6X A;  2R9F A;  2AVW A;  4FIP A;  2R9C A;  5F02 A;  1CB5 A;  4YYQ A;  2G8E A;  1PPO A;  1U5I A;  1VSN A;  2YJ2 A;  3C9E A;  2Y6E A;  5JA7 A;  1QDQ A;  2DZY A;  4N8W A;  3IV2 A;  4MZO A;  5JH3 A;  3MTN A;  4BGF A;  2BDL A;  3IEJ A;  1Y4H A;  1NLJ A;  4PAD A;  1AU3 A;  2H7J A;  3F75 A;  1AU4 A;  3KWZ A;  4YYU A;  1FH0 A;  3MHH A;  5EGW A;  3D9W A;  2E03 A;  3KFQ A;  4YYR A;  1EWP A;  2AUZ A;  3HHA A;  2BSZ A;  3OVZ A;  3RVX A;  5CVO B;  1F2B A;  1NB5 A;  2DZZ A;  4W5B A;  2HH5 A;  1JQP A;  1X9Y A;  2FQ9 A;  4YVA A;  1GX3 A;  2XU1 A;  2DC9 A;  1PXV A;  4CDD B;  1ME4 A;  4I04 A;  2JQG R;  3V6C A;  5CHT A;  2NQA A;  1POP A;  1PCI A;  2VHF A;  1U9Q X;  1YAL A;  1EWO A;  1ZCM A;  2JQF R;  1PPN A;  1QXP A;  4BS5 A;  3BC3 A;  3CBJ A;  2DCD A;  3OVX A;  3B79 A;  2GFO A;  3LTW A;  5CVN B;  3M99 A;  2DC6 A;  1CTE A;  2DCB A;  4RY2 A;  1DF0 A;  3P5X A;  1PE6 A;  4G54 A;  3H8B A;  3ZUA A;  3U8E A;  2YJ8 A;  3N3G A;  2XU4 A;  1TLO A;  3KSE A;  3BPM A;  2FUD A;  3DF0 A;  3HWN A;  1S4V A;  3WXE A;  1K3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...