3BCNA

Crystal structure of a papain-like cysteine protease ervatamin-a complexed with irreversible inhibitor e-64
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
209
structure length
209
Chain Sequence
LPEHVDWRAKGAVIPLKNQGKCGSCWAFSTVTTVESINQIRTGNLISLSEQQLVDCSKKNHGCKGGYFDRAYQYIIANGGIDTEANYPYKAFQGPCRAAKKVVRIDGCKGVPQCNENALKNAVASQPSVVAIDASSKQFQHYKGGIFTGPCGTKLNHGVVIVGYGKDYWIVRNSWGRHWGEQGYTRMKRVGGCGLCGIARLPFYPTKAX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Ervatamin-A
total genus 44
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3bcnA00
3E1ZB 2AUXA 1PPDA 3S3QA 2AIMA 2AU1A 3KSEA 4QRXA 4P6GA 3IMAA 2DC6A 4K7CA 3K8UA 2HD5A 1ICFA 4X6JA 3GCBA 4CZWA 3IV2A 3P5VA 3MTNA 2NQGA 4FIPA 4Q8GA 3WXFA 1BP4A 1THEA 1AU0A 5F02A 1PE6A 3P5UA 2XU1A 1CV8A 2DCBA 2DCCA 2JQGR 1S4VA 4X6HA 2DJGB 2P0RA 3MHHA 3N4CA 4XR7A 1F2BA 1AU4A 1CJLA 4W4UA 2IBIA 4CDFB 1EWMA 3N3KA 4RY2A 3KWBX 2FRAA 3KW9A 1EWLA 2G8JA 1DEUA 3I06A 3CBJA 1U9WA 3H8BA 3WXEA 3S3RA 1NB3A 2DC9A 5CVOB 5PADA 3D6SA 3H8CA 1KFXL 2R9OA 4PI3A 3OISA 1F2AA 1NQCA 1PBHA 2PADA 2VHFA 2G8EA 1CS8A 4BPVA 2ATOA 1A6RA 2OP3A 3M99A 4QH6A 1GMYA 1AU3A 1U9QX 2DCDA 2VHSA 2WBFX 2YJBA 5A24A 2AVWA 1KHQA 3O0UA 1BQIA 3KKUA 4CDEB 2NQDB 2YJ2A 2YJCA 4YV8A 3HHIA 1EWPA 1X9YA 3HWNA 2NQAA 4QRVA 1Y4HA 1BY8A 1XKGA 4YYQA 1PPNA 1PCIA 5CHVA 1AYUA 3USVA 3IEJA 3H7DA 3QJ3A 1CSBB 2XU5A 4BS5A 5FPWA 3N3GA 1ME3A 1Y08A 1CPJA 5J94A 4MZSA 1CTEA 3P5XA 2FRQA 4FK5A 1POPA 3C9EA 2FO5A 2R9NA 4MZOA 1ZCMA 4G54A 4YYVA 1SP4B 3OF9A 2R9CA 4PADA 1NPZA 1AYWA 4OELA 1GCBA 2GFOA 4YYRA 2BDZA 5CHTA 1ATKA 2IPPB 3RVVA 1EWOA 3H6SA 4X6IA 1MEMA 1PADA 4XUIA 3V6EA 2O6XA 4YYWA 2DJFB 1MHWA 3ZUAA 1PIPA 1PPOA 2FYEA 1KFUL 4WA6A 1U5IA 4YYUA 4AXLA 4AXMA 3O1GA 3MHSA 2FUDA 5EGWA 3KWZA 4ZUXU 3TNXA 1YALA 1F2CA 3NHEA 2G7YA 1DF0A 2Y6EA 3AI8A 3CBKA 4OEMA 3CH3X 3V6CA 2ACTA 4CDCB 1QDQA 8PCHA 1NB5A 3OF8A 4YVAA 1YVBA 3H89A 2AS8A 1ITOA 4YYSA 2FTDA 1QMYA 2DZYA 2DCAA 1HUCB 1AU2A 2YJ9A 3PDFA 2AYOA 2CB5A 3PBHA 3I3TA 4QBBA 5JH3A 3KX1A 1IWDA 2F7DA 1JQPA 5EF4A 2YJ8A 3QSDA 1NL6A 2DC8A 3WXGA 7PCKA 2DZZA 5JA7A 1TU6A 4N4ZA 1U9XA 3K24A 2E00A 4HWYA 4BSQA 1TL9A 4N79A 2PNSA 1YT7A 1BGOA 3F5VA 3HD3A 1GLOA 1MEGA 4CDDB 1EF7A 3QT4A 3ERVA 1K3BB 4KLBA 1Q6KA 3LXSA 3KFQA 3K9MA 1SNKA 4DMYA 3BPMA 1MS6A 3HHAA 3DF0A 1ME4A 1M6DA 5CVMA 2PBHA 4W5BA 1TLOA 2F1GA 1ZIVA 1QXPA 1STFE 3IUTA 2GHUA 1NLJA 1VJVA 2E02A 3F75A 1PPPA 2R9MA 1KHPA 1MDWA 2HXZA 2ARYA 1CB5A 3BCNA 1F29A 3PW3A 1QOLA 4PP1A 2AYNA 3U8EA 1CVZA 2E01A 5CVNB 2NQIA 1MIRA 9PAPA 3PNRA 4PP2E 2P86A 1VSNA 1YK7A 3CH2X 4W5CA 2OZ2A 3OVXA 4I04A 3OVZA 4I07A 2FT2A 4N8WA 6PADA 1YK8A 3P5WA 1AYVA 3MORA 2P7UA 2BDLA 3RVXA 2DC7A 3BPFA 2R9FA 1GECE 2AUZA 4DMXA 1AIMA 4BQVA 4P6EA 1U9VA 2C0YA 2G6DA 1CQDA 3RVWA 3BWKA 2JQFR 4I05A 3BOWA 1O0EA 2OULA 4MSXA 2XU3A 2HHNA 2CIOA 2FQ9A 1KXRA 3BC3A 3IHPA 2PREA 1PXVA 3IOQA 4QRGA 2B1MA 2H7JA 4BS6A 4Q8HA 5K16A 1FH0A 3LFYA 2HH5A 4FJCA 2E03A 3B79A 2XU4A 1AECA 2B1NA 2R6NA 2Y5BA
chains in the Genus database with same CATH superfamily
3E1ZB 2AUXA 3OQCA 1PPDA 1UKFA 3S3QA 2AIMA 2AU1A 3KSEA 4QRXA 4P6GA 3IMAA 2DC6A 4K7CA 3K8UA 2HD5A 1ICFA 4X6JA 3GCBA 4CZWA 3IV2A 3P5VA 3MTVA 4D8EA 3MTNA 2NQGA 4FIPA 4Q8GA 3WXFA 1BP4A 1THEA 1AU0A 5F02A 1PE6A 3P5UA 4GUAA 5EZQA 2BTWB 2BU3A 2XU1A 1CV8A 2DCBA 2DCCA 2JQGR 1S4VA 4X6HA 4A5UA 2DJGB 2P0RA 3MHHA 3N4CA 4XR7A 1F2BA 1AU4A 1CJLA 4W4UA 2IBIA 1DKIA 4CDFB 1EWMA 3N3KA 4RY2A 3KWBX 2FRAA 3KW9A 1EWLA 2G8JA 1DEUA 3I06A 3CBJA 4OVZB 1U9WA 3H8BA 3WXEA 3C0RA 3S3RA 1NB3A 2DC9A 5CVOB 5EZSA 5PADA 3D6SA 3H8CA 1KFXL 2R9OA 4PI3A 3OISA 1F2AA 1NQCA 1PBHA 2PADA 2VHFA 2G8EA 1CS8A 4BPVA 2ATOA 3BBAA 1A6RA 2OP3A 3PSEA 3M99A 4QH6A 1GMYA 1AU3A 1U9QX 2DCDA 2VHSA 2WBFX 2YJBA 4D8BA 5A24A 2AVWA 1KHQA 3O0UA 4P16A 1BQIA 3KKUA 4CDEB 4RNAA 4RF0A 2NQDB 2FE8A 2YJ2A 2YJCA 4YV8A 3HHIA 1EWPA 3PRPA 3RNVA 1X9YA 3HWNA 2NQAA 2J7QA 4QRVA 1Y4HA 4PT5A 1BY8A 1XKGA 4YYQA 1PPNA 1PCIA 5CHVA 1AYUA 1PVJA 3USVA 3IEJA 3H7DA 3QJ3A 2HWKA 1CSBB 2XU5A 4BS5A 5FPWA 3N3GA 1ME3A 1Y08A 1CPJA 5KO3A 5J94A 4XZXA 4MZSA 1CTEA 3P5XA 2FRQA 4FK5A 1POPA 3C9EA 2FO5A 2Z84A 2R9NA 4MZOA 1ZCMA 4D8IA 4G54A 2JTCA 4YYVA 1SP4B 3OF9A 2R9CA 4PADA 1NPZA 1AYWA 4OELA 5JZEA 1GCBA 2GFOA 4YYRA 2BDZA 5CHTA 1ATKA 2IPPB 3RVVA 1EWOA 3H6SA 3TRKA 4X6IA 1MEMA 1PADA 4XUIA 3V6EA 2O6XA 3PRMA 4YYWA 2DJFB 1MHWA 3ZUAA 1PIPA 1PPOA 2FYEA 1KFUL 4WA6A 1U5IA 4YYUA 4HXDB 4AXLA 4AXMA 3ZNHA 3O1GA 3MHSA 2FUDA 5EGWA 4BOPA 3KWZA 4ZUXU 3TNXA 1YALA 1F2CA 3NHEA 3PHWA 2G7YA 1DF0A 4IUMA 2Y6EA 3AI8A 3CBKA 4OEMA 3CH3X 3V6CA 2ACTA 4CDCB 1QDQA 8PCHA 1NB5A 3OF8A 4RF1A 4YVAA 1YVBA 3H89A 2AS8A 1ITOA 4YYSA 3W30A 2FTDA 1QMYA 2DZYA 2DCAA 1HUCB 1AU2A 2YJ9A 3PDFA 2AYOA 2CB5A 3PBHA 3I3TA 4QBBA 5JH3A 3KX1A 1IWDA 2F7DA 1YZBA 1JQPA 5EF4A 2YJ8A 3QSDA 1NL6A 2DC8A 4MM3B 3WXGA 3TMPA 7PCKA 2DZZA 3MP2A 3W31A 5JA7A 1TU6A 4N4ZA 1U9XA 2DOSA 3K24A 2E00A 3PHUA 4HWYA 3IFUA 4BSQA 1TL9A 4N79A 2PNSA 1YT7A 1BGOA 3F5VA 3HD3A 4BOQA 1GLOA 1MEGA 4CDDB 1EF7A 3QT4A 3ERVA 1K3BB 4KLBA 1Q6KA 5E6JA 3LXSA 3KFQA 3K9MA 4WURA 1SNKA 4DMYA 3BPMA 1MS6A 3HHAA 2JRIA 4BOSA 3DF0A 1ME4A 3PHXA 1M6DA 3BY4A 5CVMA 2PBHA 4W5BA 1TLOA 2F1GA 4REZA 1ZIVA 1QXPA 1STFE 3IUTA 2GHUA 1NLJA 1VJVA 2E02A 3F75A 1PPPA 2R9MA 1KHPA 1MDWA 2HXZA 3O65A 2ARYA 1CB5A 3BCNA 4ZTBA 1F29A 3PW3A 1QOLA 4PP1A 2AYNA 3U8EA 1CVZA 3MJ5A 2E01A 5CVNB 2NQIA 1MIRA 4M0WA 9PAPA 3PNRA 4PP2E 2P86A 1VSNA 1YK7A 3CH2X 4W5CA 2OZ2A 3OVXA 3PT2A 4I04A 3OVZA 4I07A 2FT2A 3B21A 4N8WA 6PADA 1YK8A 3P5WA 1AYVA 3MORA 2P7UA 2BDLA 3RVXA 2DC7A 3BPFA 4BOZA 2R9FA 1GECE 2AUZA 2BTWA 1AIMA 4DMXA 2J7QC 4BQVA 4P6EA 1U9VA 3E9SA 2C0YA 2G6DA 2AGAA 4RKXA 1CQDA 3RVWA 3BB7A 3BWKA 2JQFR 4MI7A 4I05A 3BOWA 1O0EA 2OULA 4MSXA 2XU3A 4OW0A 2HHNA 2CIOA 2FQ9A 4IP3A 1KXRA 3BC3A 3IHPA 2PREA 4BOUA 1PXVA 4R3DA 3IOQA 4QRGA 2B1MA 2H7JA 4BS6A 4Q8HA 5K16A 4OVZA 1FH0A 3LFYA 2HH5A 4FJCA 2E03A 3B79A 2XU4A 1AECA 2B1NA 2R6NA 2UZJA 2Y5BA
chains in the Genus database with same CATH topology
3E1ZB 2AUXA 1PPDA 3S3QA 2AIMA 2AU1A 3KSEA 4QRXA 4P6GA 4GUZA 3IMAA 2DC6A 4K7CA 3K8UA 2HD5A 1ICFA 4X6JA 3GCBA 4CZWA 3IV2A 3P5VA 3MTNA 2NQGA 4FIPA 4Q8GA 3WXFA 1BP4A 1THEA 1AU0A 5F02A 1PE6A 3P5UA 2XU1A 1CV8A 2DCBA 2DCCA 1W5RA 2JQGR 1S4VA 4X6HA 2DJGB 2P0RA 3MHHA 3N4CA 4XR7A 1F2BA 1AU4A 1CJLA 4W4UA 2IBIA 4CDFB 1EWMA 3N3KA 4RY2A 3KWBX 2FRAA 3KW9A 1EWLA 2G8JA 1DEUA 3I06A 1GX3A 3CBJA 1U9WA 3H8BA 3WXEA 3S3RA 1NB3A 2DC9A 5CVOB 5PADA 3D6SA 3H8CA 1KFXL 2R9OA 4PI3A 3OISA 1F2AA 1NQCA 1PBHA 2PADA 2VHFA 2G8EA 1CS8A 4NV8A 4BPVA 2ATOA 1A6RA 2OP3A 3M99A 4QH6A 1GMYA 1AU3A 1U9QX 2DCDA 2VHSA 2WBFX 2YJBA 5A24A 2AVWA 1KHQA 3O0UA 1BQIA 3KKUA 4CDEB 2NQDB 2YJ2A 2YJCA 4YV8A 3HHIA 1EWPA 1X9YA 3HWNA 2NQAA 4QRVA 1Y4HA 1BY8A 1XKGA 4YYQA 1PPNA 1PCIA 5CHVA 1AYUA 3USVA 3IEJA 3H7DA 3QJ3A 4B55A 1CSBB 2XU5A 4BS5A 5FPWA 3N3GA 1ME3A 1Y08A 1CPJA 5J94A 4MZSA 1CTEA 3P5XA 2FRQA 4FK5A 1POPA 3C9EA 2FO5A 2R9NA 4MZOA 1ZCMA 4G54A 4YYVA 1SP4B 3OF9A 2R9CA 4PADA 1NPZA 1AYWA 4OELA 1GCBA 2GFOA 4YYRA 2BDZA 5CHTA 1ATKA 2IPPB 4C5PA 3RVVA 1EWOA 3H6SA 4X6IA 1MEMA 1PADA 4XUIA 3V6EA 2O6XA 4YYWA 2DJFB 1MHWA 3ZUAA 1PIPA 1PPOA 2FYEA 1KFUL 4WA6A 1U5IA 4YYUA 4AXLA 4AXMA 3O1GA 3MHSA 2FUDA 5EGWA 3KWZA 4ZUXU 3TNXA 1YALA 1F2CA 2VFCA 3NHEA 2G7YA 1DF0A 2Y6EA 3AI8A 3CBKA 4OEMA 3CH3X 3V6CA 2ACTA 4CDCB 1QDQA 8PCHA 1E2TA 1NB5A 3OF8A 4YVAA 1YVBA 3H89A 2AS8A 1ITOA 4YYSA 2FTDA 1QMYA 3D9WA 2DZYA 2DCAA 1HUCB 1AU2A 2YJ9A 3PDFA 2AYOA 2CB5A 3PBHA 3I3TA 4QBBA 5JH3A 3KX1A 1IWDA 2F7DA 1JQPA 5EF4A 4BGFA 2YJ8A 3QSDA 1NL6A 2DC8A 3WXGA 7PCKA 2DZZA 5JA7A 1TU6A 4N4ZA 1U9XA 3K24A 2E00A 2BSZA 4HWYA 4BSQA 1TL9A 4N79A 2PNSA 1YT7A 1BGOA 3F5VA 3HD3A 1GLOA 1MEGA 4CDDB 1EF7A 3QT4A 3ERVA 1K3BB 4KLBA 1Q6KA 1W6FA 3LXSA 3KFQA 3K9MA 1SNKA 4DMYA 3BPMA 1MS6A 3HHAA 3DF0A 1ME4A 2VFBA 1M6DA 5CVMA 2PBHA 4W5BA 1TLOA 2F1GA 1ZIVA 1QXPA 1STFE 3IUTA 2GHUA 1NLJA 1VJVA 2E02A 3F75A 1PPPA 2R9MA 1KHPA 1MDWA 2HXZA 2ARYA 1CB5A 3BCNA 1F29A 3PW3A 1QOLA 4PP1A 2AYNA 3U8EA 1CVZA 2E01A 5CVNB 2NQIA 1MIRA 1W4TA 9PAPA 3PNRA 4PP2E 2P86A 1VSNA 1YK7A 3CH2X 4W5CA 2OZ2A 3OVXA 4I04A 3OVZA 4I07A 2FT2A 4N8WA 6PADA 1YK8A 3P5WA 1AYVA 3MORA 2P7UA 2BDLA 3RVXA 2DC7A 3BPFA 2R9FA 1GECE 2AUZA 4DMXA 1AIMA 4BQVA 4P6EA 1U9VA 2C0YA 2G6DA 1CQDA 3RVWA 3BWKA 2JQFR 4I05A 4NV7A 3BOWA 1O0EA 2OULA 4MSXA 2XU3A 2HHNA 2CIOA 2FQ9A 1KXRA 3BC3A 3IHPA 2PREA 1PXVA 3IOQA 4QRGA 2B1MA 2H7JA 4BS6A 4Q8HA 5K16A 1FH0A 3LFYA 2HH5A 4FJCA 2E03A 3B79A 2XU4A 1AECA 2B1NA 2R6NA 3LTWA 2Y5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1Z B;  2AUX A;  1PPD A;  3S3Q A;  2AIM A;  2AU1 A;  3KSE A;  4QRX A;  4P6G A;  3IMA A;  2DC6 A;  4K7C A;  3K8U A;  2HD5 A;  1ICF A;  4X6J A;  3GCB A;  4CZW A;  3IV2 A;  3P5V A;  3MTN A;  2NQG A;  4FIP A;  4Q8G A;  3WXF A;  1BP4 A;  1THE A;  1AU0 A;  5F02 A;  1PE6 A;  3P5U A;  2XU1 A;  1CV8 A;  2DCB A;  2DCC A;  2JQG R;  1S4V A;  4X6H A;  2DJG B;  2P0R A;  3MHH A;  3N4C A;  4XR7 A;  1F2B A;  1AU4 A;  1CJL A;  4W4U A;  2IBI A;  4CDF B;  1EWM A;  3N3K A;  4RY2 A;  3KWB X;  2FRA A;  3KW9 A;  1EWL A;  2G8J A;  1DEU A;  3I06 A;  3CBJ A;  1U9W A;  3H8B A;  3WXE A;  3S3R A;  1NB3 A;  2DC9 A;  5CVO B;  5PAD A;  3D6S A;  3H8C A;  1KFX L;  2R9O A;  4PI3 A;  3OIS A;  1F2A A;  1NQC A;  1PBH A;  2PAD A;  2VHF A;  2G8E A;  1CS8 A;  4BPV A;  2ATO A;  1A6R A;  2OP3 A;  3M99 A;  4QH6 A;  1GMY A;  1AU3 A;  1U9Q X;  2DCD A;  2VHS A;  2WBF X;  2YJB A;  5A24 A;  2AVW A;  1KHQ A;  3O0U A;  1BQI A;  3KKU A;  4CDE B;  2NQD B;  2YJ2 A;  2YJC A;  4YV8 A;  3HHI A;  1EWP A;  1X9Y A;  3HWN A;  2NQA A;  4QRV A;  1Y4H A;  1BY8 A;  1XKG A;  4YYQ A;  1PPN A;  1PCI A;  5CHV A;  1AYU A;  3USV A;  3IEJ A;  3H7D A;  3QJ3 A;  1CSB B;  2XU5 A;  4BS5 A;  5FPW A;  3N3G A;  1ME3 A;  1Y08 A;  1CPJ A;  5J94 A;  4MZS A;  1CTE A;  3P5X A;  2FRQ A;  4FK5 A;  1POP A;  3C9E A;  2FO5 A;  2R9N A;  4MZO A;  1ZCM A;  4G54 A;  4YYV A;  1SP4 B;  3OF9 A;  2R9C A;  4PAD A;  1NPZ A;  1AYW A;  4OEL A;  1GCB A;  2GFO A;  4YYR A;  2BDZ A;  5CHT A;  1ATK A;  2IPP B;  3RVV A;  1EWO A;  3H6S A;  4X6I A;  1MEM A;  1PAD A;  4XUI A;  3V6E A;  2O6X A;  4YYW A;  2DJF B;  1MHW A;  3ZUA A;  1PIP A;  1PPO A;  2FYE A;  1KFU L;  4WA6 A;  1U5I A;  4YYU A;  4AXL A;  4AXM A;  3O1G A;  3MHS A;  2FUD A;  5EGW A;  3KWZ A;  4ZUX U;  3TNX A;  1YAL A;  1F2C A;  3NHE A;  2G7Y A;  1DF0 A;  2Y6E A;  3AI8 A;  3CBK A;  4OEM A;  3CH3 X;  3V6C A;  2ACT A;  4CDC B;  1QDQ A;  8PCH A;  1NB5 A;  3OF8 A;  4YVA A;  1YVB A;  3H89 A;  2AS8 A;  1ITO A;  4YYS A;  2FTD A;  1QMY A;  2DZY A;  2DCA A;  1HUC B;  1AU2 A;  2YJ9 A;  3PDF A;  2AYO A;  2CB5 A;  3PBH A;  3I3T A;  4QBB A;  5JH3 A;  3KX1 A;  1IWD A;  2F7D A;  1JQP A;  5EF4 A;  2YJ8 A;  3QSD A;  1NL6 A;  2DC8 A;  3WXG A;  7PCK A;  2DZZ A;  5JA7 A;  1TU6 A;  4N4Z A;  1U9X A;  3K24 A;  2E00 A;  4HWY A;  4BSQ A;  1TL9 A;  4N79 A;  2PNS A;  1YT7 A;  1BGO A;  3F5V A;  3HD3 A;  1GLO A;  1MEG A;  4CDD B;  1EF7 A;  3QT4 A;  3ERV A;  1K3B B;  4KLB A;  1Q6K A;  3LXS A;  3KFQ A;  3K9M A;  1SNK A;  4DMY A;  3BPM A;  1MS6 A;  3HHA A;  3DF0 A;  1ME4 A;  1M6D A;  5CVM A;  2PBH A;  4W5B A;  1TLO A;  2F1G A;  1ZIV A;  1QXP A;  1STF E;  3IUT A;  2GHU A;  1NLJ A;  1VJV A;  2E02 A;  3F75 A;  1PPP A;  2R9M A;  1KHP A;  1MDW A;  2HXZ A;  2ARY A;  1CB5 A;  3BCN A;  1F29 A;  3PW3 A;  1QOL A;  4PP1 A;  2AYN A;  3U8E A;  1CVZ A;  2E01 A;  5CVN B;  2NQI A;  1MIR A;  9PAP A;  3PNR A;  4PP2 E;  2P86 A;  1VSN A;  1YK7 A;  3CH2 X;  4W5C A;  2OZ2 A;  3OVX A;  4I04 A;  3OVZ A;  4I07 A;  2FT2 A;  4N8W A;  6PAD A;  1YK8 A;  3P5W A;  1AYV A;  3MOR A;  2P7U A;  2BDL A;  3RVX A;  2DC7 A;  3BPF A;  2R9F A;  1GEC E;  2AUZ A;  4DMX A;  1AIM A;  4BQV A;  4P6E A;  1U9V A;  2C0Y A;  2G6D A;  1CQD A;  3RVW A;  3BWK A;  2JQF R;  4I05 A;  3BOW A;  1O0E A;  2OUL A;  4MSX A;  2XU3 A;  2HHN A;  2CIO A;  2FQ9 A;  1KXR A;  3BC3 A;  3IHP A;  2PRE A;  1PXV A;  3IOQ A;  4QRG A;  2B1M A;  2H7J A;  4BS6 A;  4Q8H A;  5K16 A;  1FH0 A;  3LFY A;  2HH5 A;  4FJC A;  2E03 A;  3B79 A;  2XU4 A;  1AEC A;  2B1N A;  2R6N A;  2Y5B A; 
#chains in the Genus database with same CATH topology
 3E1Z B;  2AUX A;  3OQC A;  1PPD A;  1UKF A;  3S3Q A;  2AIM A;  2AU1 A;  3KSE A;  4QRX A;  4P6G A;  3IMA A;  2DC6 A;  4K7C A;  3K8U A;  2HD5 A;  1ICF A;  4X6J A;  3GCB A;  4CZW A;  3IV2 A;  3P5V A;  3MTV A;  4D8E A;  3MTN A;  2NQG A;  4FIP A;  4Q8G A;  3WXF A;  1BP4 A;  1THE A;  1AU0 A;  5F02 A;  1PE6 A;  3P5U A;  4GUA A;  5EZQ A;  2BTW B;  2BU3 A;  2XU1 A;  1CV8 A;  2DCB A;  2DCC A;  2JQG R;  1S4V A;  4X6H A;  4A5U A;  2DJG B;  2P0R A;  3MHH A;  3N4C A;  4XR7 A;  1F2B A;  1AU4 A;  1CJL A;  4W4U A;  2IBI A;  1DKI A;  4CDF B;  1EWM A;  3N3K A;  4RY2 A;  3KWB X;  2FRA A;  3KW9 A;  1EWL A;  2G8J A;  1DEU A;  3I06 A;  3CBJ A;  4OVZ B;  1U9W A;  3H8B A;  3WXE A;  3C0R A;  3S3R A;  1NB3 A;  2DC9 A;  5CVO B;  5EZS A;  5PAD A;  3D6S A;  3H8C A;  1KFX L;  2R9O A;  4PI3 A;  3OIS A;  1F2A A;  1NQC A;  1PBH A;  2PAD A;  2VHF A;  2G8E A;  1CS8 A;  4BPV A;  2ATO A;  3BBA A;  1A6R A;  2OP3 A;  3PSE A;  3M99 A;  4QH6 A;  1GMY A;  1AU3 A;  1U9Q X;  2DCD A;  2VHS A;  2WBF X;  2YJB A;  4D8B A;  5A24 A;  2AVW A;  1KHQ A;  3O0U A;  4P16 A;  1BQI A;  3KKU A;  4CDE B;  4RNA A;  4RF0 A;  2NQD B;  2FE8 A;  2YJ2 A;  2YJC A;  4YV8 A;  3HHI A;  1EWP A;  3PRP A;  3RNV A;  1X9Y A;  3HWN A;  2NQA A;  2J7Q A;  4QRV A;  1Y4H A;  4PT5 A;  1BY8 A;  1XKG A;  4YYQ A;  1PPN A;  1PCI A;  5CHV A;  1AYU A;  1PVJ A;  3USV A;  3IEJ A;  3H7D A;  3QJ3 A;  2HWK A;  1CSB B;  2XU5 A;  4BS5 A;  5FPW A;  3N3G A;  1ME3 A;  1Y08 A;  1CPJ A;  5KO3 A;  5J94 A;  4XZX A;  4MZS A;  1CTE A;  3P5X A;  2FRQ A;  4FK5 A;  1POP A;  3C9E A;  2FO5 A;  2Z84 A;  2R9N A;  4MZO A;  1ZCM A;  4D8I A;  4G54 A;  2JTC A;  4YYV A;  1SP4 B;  3OF9 A;  2R9C A;  4PAD A;  1NPZ A;  1AYW A;  4OEL A;  5JZE A;  1GCB A;  2GFO A;  4YYR A;  2BDZ A;  5CHT A;  1ATK A;  2IPP B;  3RVV A;  1EWO A;  3H6S A;  3TRK A;  4X6I A;  1MEM A;  1PAD A;  4XUI A;  3V6E A;  2O6X A;  3PRM A;  4YYW A;  2DJF B;  1MHW A;  3ZUA A;  1PIP A;  1PPO A;  2FYE A;  1KFU L;  4WA6 A;  1U5I A;  4YYU A;  4HXD B;  4AXL A;  4AXM A;  3ZNH A;  3O1G A;  3MHS A;  2FUD A;  5EGW A;  4BOP A;  3KWZ A;  4ZUX U;  3TNX A;  1YAL A;  1F2C A;  3NHE A;  3PHW A;  2G7Y A;  1DF0 A;  4IUM A;  2Y6E A;  3AI8 A;  3CBK A;  4OEM A;  3CH3 X;  3V6C A;  2ACT A;  4CDC B;  1QDQ A;  8PCH A;  1NB5 A;  3OF8 A;  4RF1 A;  4YVA A;  1YVB A;  3H89 A;  2AS8 A;  1ITO A;  4YYS A;  3W30 A;  2FTD A;  1QMY A;  2DZY A;  2DCA A;  1HUC B;  1AU2 A;  2YJ9 A;  3PDF A;  2AYO A;  2CB5 A;  3PBH A;  3I3T A;  4QBB A;  5JH3 A;  3KX1 A;  1IWD A;  2F7D A;  1YZB A;  1JQP A;  5EF4 A;  2YJ8 A;  3QSD A;  1NL6 A;  2DC8 A;  4MM3 B;  3WXG A;  3TMP A;  7PCK A;  2DZZ A;  3MP2 A;  3W31 A;  5JA7 A;  1TU6 A;  4N4Z A;  1U9X A;  2DOS A;  3K24 A;  2E00 A;  3PHU A;  4HWY A;  3IFU A;  4BSQ A;  1TL9 A;  4N79 A;  2PNS A;  1YT7 A;  1BGO A;  3F5V A;  3HD3 A;  4BOQ A;  1GLO A;  1MEG A;  4CDD B;  1EF7 A;  3QT4 A;  3ERV A;  1K3B B;  4KLB A;  1Q6K A;  5E6J A;  3LXS A;  3KFQ A;  3K9M A;  4WUR A;  1SNK A;  4DMY A;  3BPM A;  1MS6 A;  3HHA A;  2JRI A;  4BOS A;  3DF0 A;  1ME4 A;  3PHX A;  1M6D A;  3BY4 A;  5CVM A;  2PBH A;  4W5B A;  1TLO A;  2F1G A;  4REZ A;  1ZIV A;  1QXP A;  1STF E;  3IUT A;  2GHU A;  1NLJ A;  1VJV A;  2E02 A;  3F75 A;  1PPP A;  2R9M A;  1KHP A;  1MDW A;  2HXZ A;  3O65 A;  2ARY A;  1CB5 A;  3BCN A;  4ZTB A;  1F29 A;  3PW3 A;  1QOL A;  4PP1 A;  2AYN A;  3U8E A;  1CVZ A;  3MJ5 A;  2E01 A;  5CVN B;  2NQI A;  1MIR A;  4M0W A;  9PAP A;  3PNR A;  4PP2 E;  2P86 A;  1VSN A;  1YK7 A;  3CH2 X;  4W5C A;  2OZ2 A;  3OVX A;  3PT2 A;  4I04 A;  3OVZ A;  4I07 A;  2FT2 A;  3B21 A;  4N8W A;  6PAD A;  1YK8 A;  3P5W A;  1AYV A;  3MOR A;  2P7U A;  2BDL A;  3RVX A;  2DC7 A;  3BPF A;  4BOZ A;  2R9F A;  1GEC E;  2AUZ A;  2BTW A;  1AIM A;  4DMX A;  2J7Q C;  4BQV A;  4P6E A;  1U9V A;  3E9S A;  2C0Y A;  2G6D A;  2AGA A;  4RKX A;  1CQD A;  3RVW A;  3BB7 A;  3BWK A;  2JQF R;  4MI7 A;  4I05 A;  3BOW A;  1O0E A;  2OUL A;  4MSX A;  2XU3 A;  4OW0 A;  2HHN A;  2CIO A;  2FQ9 A;  4IP3 A;  1KXR A;  3BC3 A;  3IHP A;  2PRE A;  4BOU A;  1PXV A;  4R3D A;  3IOQ A;  4QRG A;  2B1M A;  2H7J A;  4BS6 A;  4Q8H A;  5K16 A;  4OVZ A;  1FH0 A;  3LFY A;  2HH5 A;  4FJC A;  2E03 A;  3B79 A;  2XU4 A;  1AEC A;  2B1N A;  2R6N A;  2UZJ A;  2Y5B A; 
#chains in the Genus database with same CATH homology
 3E1Z B;  2AUX A;  1PPD A;  3S3Q A;  2AIM A;  2AU1 A;  3KSE A;  4QRX A;  4P6G A;  4GUZ A;  3IMA A;  2DC6 A;  4K7C A;  3K8U A;  2HD5 A;  1ICF A;  4X6J A;  3GCB A;  4CZW A;  3IV2 A;  3P5V A;  3MTN A;  2NQG A;  4FIP A;  4Q8G A;  3WXF A;  1BP4 A;  1THE A;  1AU0 A;  5F02 A;  1PE6 A;  3P5U A;  2XU1 A;  1CV8 A;  2DCB A;  2DCC A;  1W5R A;  2JQG R;  1S4V A;  4X6H A;  2DJG B;  2P0R A;  3MHH A;  3N4C A;  4XR7 A;  1F2B A;  1AU4 A;  1CJL A;  4W4U A;  2IBI A;  4CDF B;  1EWM A;  3N3K A;  4RY2 A;  3KWB X;  2FRA A;  3KW9 A;  1EWL A;  2G8J A;  1DEU A;  3I06 A;  1GX3 A;  3CBJ A;  1U9W A;  3H8B A;  3WXE A;  3S3R A;  1NB3 A;  2DC9 A;  5CVO B;  5PAD A;  3D6S A;  3H8C A;  1KFX L;  2R9O A;  4PI3 A;  3OIS A;  1F2A A;  1NQC A;  1PBH A;  2PAD A;  2VHF A;  2G8E A;  1CS8 A;  4NV8 A;  4BPV A;  2ATO A;  1A6R A;  2OP3 A;  3M99 A;  4QH6 A;  1GMY A;  1AU3 A;  1U9Q X;  2DCD A;  2VHS A;  2WBF X;  2YJB A;  5A24 A;  2AVW A;  1KHQ A;  3O0U A;  1BQI A;  3KKU A;  4CDE B;  2NQD B;  2YJ2 A;  2YJC A;  4YV8 A;  3HHI A;  1EWP A;  1X9Y A;  3HWN A;  2NQA A;  4QRV A;  1Y4H A;  1BY8 A;  1XKG A;  4YYQ A;  1PPN A;  1PCI A;  5CHV A;  1AYU A;  3USV A;  3IEJ A;  3H7D A;  3QJ3 A;  4B55 A;  1CSB B;  2XU5 A;  4BS5 A;  5FPW A;  3N3G A;  1ME3 A;  1Y08 A;  1CPJ A;  5J94 A;  4MZS A;  1CTE A;  3P5X A;  2FRQ A;  4FK5 A;  1POP A;  3C9E A;  2FO5 A;  2R9N A;  4MZO A;  1ZCM A;  4G54 A;  4YYV A;  1SP4 B;  3OF9 A;  2R9C A;  4PAD A;  1NPZ A;  1AYW A;  4OEL A;  1GCB A;  2GFO A;  4YYR A;  2BDZ A;  5CHT A;  1ATK A;  2IPP B;  4C5P A;  3RVV A;  1EWO A;  3H6S A;  4X6I A;  1MEM A;  1PAD A;  4XUI A;  3V6E A;  2O6X A;  4YYW A;  2DJF B;  1MHW A;  3ZUA A;  1PIP A;  1PPO A;  2FYE A;  1KFU L;  4WA6 A;  1U5I A;  4YYU A;  4AXL A;  4AXM A;  3O1G A;  3MHS A;  2FUD A;  5EGW A;  3KWZ A;  4ZUX U;  3TNX A;  1YAL A;  1F2C A;  2VFC A;  3NHE A;  2G7Y A;  1DF0 A;  2Y6E A;  3AI8 A;  3CBK A;  4OEM A;  3CH3 X;  3V6C A;  2ACT A;  4CDC B;  1QDQ A;  8PCH A;  1E2T A;  1NB5 A;  3OF8 A;  4YVA A;  1YVB A;  3H89 A;  2AS8 A;  1ITO A;  4YYS A;  2FTD A;  1QMY A;  3D9W A;  2DZY A;  2DCA A;  1HUC B;  1AU2 A;  2YJ9 A;  3PDF A;  2AYO A;  2CB5 A;  3PBH A;  3I3T A;  4QBB A;  5JH3 A;  3KX1 A;  1IWD A;  2F7D A;  1JQP A;  5EF4 A;  4BGF A;  2YJ8 A;  3QSD A;  1NL6 A;  2DC8 A;  3WXG A;  7PCK A;  2DZZ A;  5JA7 A;  1TU6 A;  4N4Z A;  1U9X A;  3K24 A;  2E00 A;  2BSZ A;  4HWY A;  4BSQ A;  1TL9 A;  4N79 A;  2PNS A;  1YT7 A;  1BGO A;  3F5V A;  3HD3 A;  1GLO A;  1MEG A;  4CDD B;  1EF7 A;  3QT4 A;  3ERV A;  1K3B B;  4KLB A;  1Q6K A;  1W6F A;  3LXS A;  3KFQ A;  3K9M A;  1SNK A;  4DMY A;  3BPM A;  1MS6 A;  3HHA A;  3DF0 A;  1ME4 A;  2VFB A;  1M6D A;  5CVM A;  2PBH A;  4W5B A;  1TLO A;  2F1G A;  1ZIV A;  1QXP A;  1STF E;  3IUT A;  2GHU A;  1NLJ A;  1VJV A;  2E02 A;  3F75 A;  1PPP A;  2R9M A;  1KHP A;  1MDW A;  2HXZ A;  2ARY A;  1CB5 A;  3BCN A;  1F29 A;  3PW3 A;  1QOL A;  4PP1 A;  2AYN A;  3U8E A;  1CVZ A;  2E01 A;  5CVN B;  2NQI A;  1MIR A;  1W4T A;  9PAP A;  3PNR A;  4PP2 E;  2P86 A;  1VSN A;  1YK7 A;  3CH2 X;  4W5C A;  2OZ2 A;  3OVX A;  4I04 A;  3OVZ A;  4I07 A;  2FT2 A;  4N8W A;  6PAD A;  1YK8 A;  3P5W A;  1AYV A;  3MOR A;  2P7U A;  2BDL A;  3RVX A;  2DC7 A;  3BPF A;  2R9F A;  1GEC E;  2AUZ A;  4DMX A;  1AIM A;  4BQV A;  4P6E A;  1U9V A;  2C0Y A;  2G6D A;  1CQD A;  3RVW A;  3BWK A;  2JQF R;  4I05 A;  4NV7 A;  3BOW A;  1O0E A;  2OUL A;  4MSX A;  2XU3 A;  2HHN A;  2CIO A;  2FQ9 A;  1KXR A;  3BC3 A;  3IHP A;  2PRE A;  1PXV A;  3IOQ A;  4QRG A;  2B1M A;  2H7J A;  4BS6 A;  4Q8H A;  5K16 A;  1FH0 A;  3LFY A;  2HH5 A;  4FJC A;  2E03 A;  3B79 A;  2XU4 A;  1AEC A;  2B1N A;  2R6N A;  3LTW A;  2Y5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...