2JQFR

Full length leader protease of foot and mouth disease virus c51a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
173
structure length
166
Chain Sequence
b'MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain o1)
molecule tags Viral protein
total genus 30
structure length 166
sequence length 173
chains with identical sequence S
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2jqfR00
3H6SA 2NQAA 4YV8A 1KXRA 4BQVA 4FK5A 2AYOA 1CSBB 2B1NA 1U5IA 1TU6A 3WXGA 3I3TA 4I07A 3HD3A 2F7DA 5EF4A 5CHVA 1AECA 4FJCA 2BDZA 1NB3A 1ZCMA 2AIMA 2FT2A 4Q8HA 2ACTA 2G7YA 2FRAA 1GLOA 1PADA 7PCKA 5F02A 2HD5A 2FRQA 5CHTA 3H89A 1PXVA 4X6HA 2YJBA 3IV2A 1PBHA 4RY2A 3ZUAA 2R6NA 4BPVA 1X9YA 2P0RA 2ATOA 3CH2X 3BPFA 4AXLA 2C0YA 1U9WA 1YK8A 4MSXA 3KWBX 2B1MA 1AYWA 3OVXA 3QSDA 1PPDA 4PP2E 3E1ZB 2P86A 3BCNA 1F2AA 3PW3A 4X6JA 3BWKA 2XU4A 2DCDA 1JQPA 4OELA 2R9NA 3MORA 1CVZA 1U9XA 3ERVA 3BC3A 4QRGA 3DF0A 3P5VA 1IWDA 3H8CA 1CPJA 4P6GA 2OULA 3BPMA 3P5UA 2CIOA 1CS8A 2FTDA 1U9VA 3KKUA 1ICFA 3B79A 2G8EA 2AS8A 4YVAA 4YYVA 1EWLA 1DEUA 3CH3X 4DMXA 3I06A 1PPPA 1NLJA 1F29A 1AU0A 1MIRA 2DZYA 4P6EA 3N3KA 1EWOA 2NQIA 1M6DA 3H7DA 2XU1A 1PIPA 2OP3A 1ATKA 2AU1A 1THEA 1CQDA 2HHNA 2NQDB 3HWNA 2YJ8A 1SP4B 3K24A 1AYVA 1NPZA 4G54A 2E03A 1S4VA 4CDEB 4K7CA 4QRXA 3USVA 2E01A 4XUIA 4PADA 1F2CA 3IHPA 3OF9A 1EWMA 2DCBA 2P7UA 6PADA 3N3GA 1KFUL 3HHAA 2OZ2A 4YYQA 1A6RA 3KSEA 2YJCA 2ARYA 3QT4A 2VHFA 2DC7A 2AUXA 2R9OA 4QRVA 3P5WA 2HH5A 2H7JA 3KX1A 3BOWA 2XU3A 4BS5A 3MHSA 4W4UA 3PDFA 3KW9A 3P5XA 3IOQA 1TLOA 2G8JA 4W5BA 4ZUXU 3RVVA 4HWYA 4QBBA 1SNKA 2GFOA 2WBFX 3O0UA 3LFYA 4DMYA 5J94A 3CBJA 3LXSA 3HHIA 1PCIA 3U8EA 1CB5A 5FPWA 1BGOA 5EGWA 1NL6A 4YYRA 4FIPA 2DZZA 2DJGB 4PI3A 5JA7A 2DC6A 3O1GA 1KFXL 3AI8A 3OVZA 2PNSA 1QXPA 2JQGR 4YYUA 1NQCA 3F5VA 3MHHA 2Y5BA 1EWPA 5JH3A 1AU2A 3RVXA 2BDLA 1ITOA 2YJ2A 1Y4HA 2CB5A 4N79A 4I04A 1BQIA 2FYEA 2AVWA 3KFQA 8PCHA 4CDDB 1DF0A 3RVWA 2PADA 2AUZA 1ZIVA 2DC9A 3OF8A 4BS6A 2VHSA 1QOLA 1KHQA 2XU5A 3OISA 1GCBA 2E02A 5K16A 3WXEA 1HUCB 4CDCB 1CTEA 1Y08A 3WXFA 1CV8A 3QJ3A 3IMAA 4X6IA 1Q6KA 3N4CA 1AYUA 1YVBA 3F75A 1VSNA 1K3BB 3H8BA 5PADA 3PBHA 4KLBA 3D6SA 4N4ZA 2E00A 4MZSA 4QH6A 1BY8A 1ME4A 2JQFR 4I05A 1POPA 3C9EA 1QDQA 1TL9A 1U9QX 3PNRA 1MHWA 3K9MA 4Q8GA 1O0EA 1PPNA 2DCAA 2PBHA 2DJFB 3IUTA 3MTNA 2Y6EA 3K8UA 4CZWA 3KWZA 1MEMA 4YYSA 4CDFB 3CBKA 2IBIA 2G6DA 1YK7A 4YYWA 1KHPA 2DC8A 2FUDA 5A24A 2R9CA 5CVOB 4W5CA 2HXZA 1AU3A 1AIMA 3S3QA 3V6EA 2YJ9A 3GCBA 4N8WA 2FQ9A 1MEGA 5CVNB 4BSQA 1PE6A 1MS6A 2O6XA 1GMYA 3M99A 4AXMA 4PP1A 1NB5A 4XR7A 2PREA 1VJVA 1XKGA 9PAPA 2R9MA 1F2BA 1STFE 1MDWA 1CJLA 2GHUA 3IEJA 4OEMA 1EF7A 4MZOA 3S3RA 1YALA 1AU4A 1BP4A 1QMYA 1FH0A 3TNXA 1ME3A 4WA6A 2NQGA 3NHEA 3V6CA 1GECE 2FO5A 5CVMA 1PPOA 2DCCA 2AYNA 1YT7A 2R9FA 2IPPB 2F1GA
chains in the Genus database with same CATH superfamily
3H6SA 2NQAA 4YV8A 1KXRA 3PRPA 4BQVA 4FK5A 2AYOA 1CSBB 2B1NA 1U5IA 1TU6A 3WXGA 2JTCA 3I3TA 4I07A 4RF1A 5EZQA 3HD3A 2F7DA 5EF4A 5CHVA 1AECA 4FJCA 2BDZA 1NB3A 1ZCMA 2AIMA 5E6JA 2FT2A 4Q8HA 4RKXA 2ACTA 2UZJA 4BOSA 2G7YA 2FRAA 1GLOA 1PADA 7PCKA 5F02A 2HD5A 3TMPA 2FRQA 5CHTA 3H89A 1PXVA 4X6HA 2YJBA 3IV2A 1PBHA 4RY2A 3ZUAA 2R6NA 4BPVA 1X9YA 2P0RA 4REZA 2ATOA 3CH2X 3BPFA 4AXLA 2C0YA 3B21A 1U9WA 1YK8A 4MSXA 2J7QA 3KWBX 2B1MA 1AYWA 3OVXA 3QSDA 1PPDA 2JRIA 4PP2E 3RNVA 3E1ZB 2P86A 3BCNA 1F2AA 3PW3A 4X6JA 3BWKA 2XU4A 2DCDA 1JQPA 4XZXA 4OELA 2R9NA 3MORA 1CVZA 1U9XA 3PRMA 3ERVA 3BC3A 4QRGA 3DF0A 3P5VA 1IWDA 3H8CA 1CPJA 2FE8A 2OULA 1UKFA 3BPMA 4P6GA 3P5UA 2CIOA 1CS8A 2FTDA 1U9VA 3KKUA 1ICFA 3B79A 2G8EA 3MJ5A 2AS8A 4YVAA 4YYVA 1EWLA 1DEUA 3CH3X 4DMXA 3I06A 1PPPA 1NLJA 1F29A 1AU0A 1MIRA 2DZYA 4P6EA 3N3KA 3TRKA 1EWOA 2NQIA 1M6DA 3H7DA 2BTWB 4P16A 2XU1A 1PIPA 2OP3A 1ATKA 2AU1A 1THEA 1CQDA 2HHNA 2NQDB 3HWNA 2YJ8A 3PHXA 3E9SA 1SP4B 3K24A 1AYVA 3ZNHA 1NPZA 4G54A 2E03A 1DKIA 1S4VA 3MTVA 4CDEB 4K7CA 4QRXA 3USVA 2E01A 2Z84A 2AGAA 4XUIA 4PADA 1F2CA 3IHPA 3OF9A 1EWMA 2DCBA 2P7UA 6PADA 3W30A 3N3GA 1KFUL 3HHAA 2OZ2A 4YYQA 1A6RA 3KSEA 2YJCA 4HXDB 4OVZB 2ARYA 3QT4A 2VHFA 2DC7A 4D8BA 2AUXA 3BB7A 3PSEA 2R9OA 4QRVA 3P5WA 2HH5A 2H7JA 3KX1A 3BOWA 2XU3A 4BS5A 3MHSA 4W4UA 3PDFA 5EZSA 3KW9A 3P5XA 3IOQA 1TLOA 2G8JA 4W5BA 4ZUXU 3RVVA 4HWYA 4QBBA 1SNKA 2GFOA 2WBFX 3O0UA 3LFYA 4DMYA 4MI7A 3MP2A 5J94A 3IFUA 4PT5A 3CBJA 3LXSA 3HHIA 1PCIA 3U8EA 1CB5A 5FPWA 1BGOA 5EGWA 1NL6A 4BOUA 4BOZA 4YYRA 3O65A 4FIPA 5KO3A 2DZZA 2DJGB 4PI3A 5JA7A 2DC6A 3O1GA 1KFXL 3AI8A 3OVZA 2PNSA 1QXPA 4A5UA 2JQGR 4YYUA 1NQCA 3F5VA 4WURA 3MHHA 1YZBA 2Y5BA 3BY4A 1EWPA 5JH3A 1AU2A 3RVXA 2HWKA 2BDLA 1ITOA 2YJ2A 1Y4HA 2CB5A 4N79A 4I04A 1BQIA 2FYEA 2AVWA 3KFQA 8PCHA 4CDDB 1DF0A 3RVWA 2PADA 2AUZA 1ZIVA 2DC9A 3OF8A 4BS6A 2VHSA 1QOLA 2DOSA 1KHQA 3W31A 2XU5A 3OISA 1GCBA 2E02A 5K16A 3WXEA 3BBAA 1HUCB 4CDCB 1CTEA 1Y08A 4MM3B 3WXFA 1CV8A 3QJ3A 3IMAA 4X6IA 1Q6KA 3N4CA 1AYUA 4GUAA 1YVBA 3F75A 1VSNA 1K3BB 3H8BA 5PADA 3PBHA 4KLBA 3D6SA 4N4ZA 2E00A 4MZSA 4QH6A 4BOQA 1BY8A 1ME4A 1PVJA 2JQFR 4I05A 4D8IA 1POPA 3C9EA 4M0WA 1QDQA 1TL9A 1U9QX 2J7QC 3PHUA 3PNRA 1MHWA 3K9MA 4Q8GA 4D8EA 1O0EA 1PPNA 2DCAA 3PT2A 2PBHA 2DJFB 3IUTA 3MTNA 2Y6EA 3K8UA 4CZWA 3KWZA 1MEMA 4YYSA 4CDFB 3CBKA 2IBIA 4RF0A 2G6DA 3C0RA 1YK7A 4YYWA 1KHPA 2DC8A 2FUDA 5A24A 2R9CA 5CVOB 4IUMA 4W5CA 2BU3A 2HXZA 1AU3A 1AIMA 3S3QA 3V6EA 2YJ9A 3GCBA 4N8WA 2FQ9A 1MEGA 5CVNB 4BSQA 1PE6A 1MS6A 2O6XA 1GMYA 2BTWA 3M99A 4AXMA 4PP1A 1NB5A 4XR7A 2PREA 1VJVA 4IP3A 1XKGA 9PAPA 2R9MA 1F2BA 1STFE 1MDWA 1CJLA 4R3DA 2GHUA 3IEJA 4OEMA 1EF7A 4MZOA 3S3RA 1YALA 1AU4A 1BP4A 4RNAA 1QMYA 1FH0A 3OQCA 3TNXA 1ME3A 4WA6A 2NQGA 3NHEA 4BOPA 3V6CA 1GECE 2FO5A 4OW0A 5CVMA 1PPOA 4OVZA 4ZTBA 2DCCA 2AYNA 1YT7A 2R9FA 3PHWA 2IPPB 2F1GA 5JZEA
chains in the Genus database with same CATH topology
3H6SA 2NQAA 4YV8A 1KXRA 4BQVA 4FK5A 2AYOA 1CSBB 2B1NA 1U5IA 1TU6A 3WXGA 3I3TA 4I07A 3HD3A 2F7DA 5EF4A 5CHVA 1AECA 4FJCA 2BDZA 1NB3A 1ZCMA 2AIMA 2FT2A 4Q8HA 2ACTA 2G7YA 2FRAA 1GLOA 1PADA 7PCKA 5F02A 2HD5A 2FRQA 5CHTA 3H89A 1PXVA 4X6HA 2YJBA 3IV2A 1PBHA 4RY2A 3ZUAA 2R6NA 4BPVA 1W6FA 1X9YA 2P0RA 2ATOA 3CH2X 3BPFA 4AXLA 2C0YA 1U9WA 1YK8A 4MSXA 3KWBX 2B1MA 1AYWA 3OVXA 3QSDA 1PPDA 4PP2E 3E1ZB 2P86A 3BCNA 1F2AA 3PW3A 4X6JA 3BWKA 2XU4A 2DCDA 1JQPA 4OELA 2R9NA 3MORA 1CVZA 1U9XA 3ERVA 4NV8A 3BC3A 4QRGA 4NV7A 3DF0A 4C5PA 3P5VA 1IWDA 3H8CA 1CPJA 4P6GA 2OULA 3BPMA 3P5UA 2CIOA 1CS8A 2FTDA 1U9VA 3KKUA 1ICFA 3B79A 2G8EA 2AS8A 4YVAA 4YYVA 1EWLA 1DEUA 3CH3X 4DMXA 1W5RA 1PPPA 3I06A 1NLJA 1F29A 1AU0A 1MIRA 2DZYA 4P6EA 3N3KA 1EWOA 2NQIA 1M6DA 3H7DA 2XU1A 1PIPA 2OP3A 1ATKA 2AU1A 1THEA 1CQDA 2HHNA 2NQDB 1E2TA 3HWNA 2YJ8A 1SP4B 3K24A 1AYVA 1NPZA 4G54A 2E03A 1S4VA 4CDEB 4K7CA 4QRXA 3USVA 2E01A 4XUIA 4PADA 1F2CA 3IHPA 3OF9A 1EWMA 2DCBA 2P7UA 6PADA 2VFCA 3N3GA 1KFUL 3HHAA 2OZ2A 1GX3A 4YYQA 1A6RA 3KSEA 2YJCA 2ARYA 3QT4A 2VHFA 2DC7A 2AUXA 2R9OA 4QRVA 3P5WA 2HH5A 2H7JA 3KX1A 3BOWA 2XU3A 4BS5A 3MHSA 4W4UA 3PDFA 3KW9A 3P5XA 3IOQA 1TLOA 2G8JA 4W5BA 4ZUXU 3RVVA 2BSZA 4HWYA 4QBBA 1SNKA 2GFOA 2WBFX 3O0UA 3LFYA 4DMYA 5J94A 3CBJA 3LXSA 3HHIA 1PCIA 3U8EA 1CB5A 5FPWA 1BGOA 5EGWA 1NL6A 4YYRA 4FIPA 2DZZA 2DJGB 4PI3A 5JA7A 2DC6A 3O1GA 2VFBA 1KFXL 3AI8A 3OVZA 2PNSA 1QXPA 2JQGR 4YYUA 1NQCA 3F5VA 3MHHA 2Y5BA 4B55A 1EWPA 5JH3A 1AU2A 3RVXA 2BDLA 1ITOA 2YJ2A 3D9WA 1Y4HA 2CB5A 4N79A 4I04A 1BQIA 2FYEA 2AVWA 3KFQA 4GUZA 8PCHA 4CDDB 1DF0A 3RVWA 2PADA 2AUZA 1ZIVA 2DC9A 3OF8A 4BS6A 2VHSA 1QOLA 1KHQA 2XU5A 3OISA 1GCBA 2E02A 5K16A 3WXEA 1HUCB 4CDCB 1CTEA 1Y08A 3WXFA 1CV8A 3QJ3A 3IMAA 4X6IA 1Q6KA 1W4TA 3N4CA 1AYUA 1YVBA 3F75A 1VSNA 1K3BB 3H8BA 5PADA 3PBHA 4KLBA 3D6SA 4N4ZA 2E00A 4MZSA 4QH6A 1BY8A 1ME4A 2JQFR 4I05A 1POPA 3C9EA 1QDQA 1TL9A 1U9QX 3PNRA 1MHWA 3K9MA 4Q8GA 1O0EA 1PPNA 2DCAA 2PBHA 3LTWA 2DJFB 3IUTA 3MTNA 2Y6EA 3K8UA 4CZWA 3KWZA 1MEMA 4YYSA 4CDFB 3CBKA 2IBIA 2G6DA 1YK7A 4YYWA 1KHPA 2DC8A 2FUDA 5A24A 2R9CA 5CVOB 4W5CA 2HXZA 1AU3A 1AIMA 3S3QA 3V6EA 2YJ9A 3GCBA 4N8WA 2FQ9A 1MEGA 5CVNB 4BSQA 1PE6A 1MS6A 2O6XA 1GMYA 3M99A 4BGFA 4AXMA 4PP1A 1NB5A 4XR7A 2PREA 1VJVA 1XKGA 9PAPA 2R9MA 1F2BA 1STFE 1MDWA 1CJLA 2GHUA 3IEJA 4OEMA 1EF7A 4MZOA 3S3RA 1YALA 1AU4A 1BP4A 1QMYA 1FH0A 3TNXA 1ME3A 4WA6A 2NQGA 3NHEA 3V6CA 1GECE 2FO5A 5CVMA 1PPOA 2DCCA 2AYNA 1YT7A 2R9FA 2IPPB 2F1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6S A;  2NQA A;  4YV8 A;  1KXR A;  4BQV A;  4FK5 A;  2AYO A;  1CSB B;  2B1N A;  1U5I A;  1TU6 A;  3WXG A;  3I3T A;  4I07 A;  3HD3 A;  2F7D A;  5EF4 A;  5CHV A;  1AEC A;  4FJC A;  2BDZ A;  1NB3 A;  1ZCM A;  2AIM A;  2FT2 A;  4Q8H A;  2ACT A;  2G7Y A;  2FRA A;  1GLO A;  1PAD A;  7PCK A;  5F02 A;  2HD5 A;  2FRQ A;  5CHT A;  3H89 A;  1PXV A;  4X6H A;  2YJB A;  3IV2 A;  1PBH A;  4RY2 A;  3ZUA A;  2R6N A;  4BPV A;  1X9Y A;  2P0R A;  2ATO A;  3CH2 X;  3BPF A;  4AXL A;  2C0Y A;  1U9W A;  1YK8 A;  4MSX A;  3KWB X;  2B1M A;  1AYW A;  3OVX A;  3QSD A;  1PPD A;  4PP2 E;  3E1Z B;  2P86 A;  3BCN A;  1F2A A;  3PW3 A;  4X6J A;  3BWK A;  2XU4 A;  2DCD A;  1JQP A;  4OEL A;  2R9N A;  3MOR A;  1CVZ A;  1U9X A;  3ERV A;  3BC3 A;  4QRG A;  3DF0 A;  3P5V A;  1IWD A;  3H8C A;  1CPJ A;  4P6G A;  2OUL A;  3BPM A;  3P5U A;  2CIO A;  1CS8 A;  2FTD A;  1U9V A;  3KKU A;  1ICF A;  3B79 A;  2G8E A;  2AS8 A;  4YVA A;  4YYV A;  1EWL A;  1DEU A;  3CH3 X;  4DMX A;  3I06 A;  1PPP A;  1NLJ A;  1F29 A;  1AU0 A;  1MIR A;  2DZY A;  4P6E A;  3N3K A;  1EWO A;  2NQI A;  1M6D A;  3H7D A;  2XU1 A;  1PIP A;  2OP3 A;  1ATK A;  2AU1 A;  1THE A;  1CQD A;  2HHN A;  2NQD B;  3HWN A;  2YJ8 A;  1SP4 B;  3K24 A;  1AYV A;  1NPZ A;  4G54 A;  2E03 A;  1S4V A;  4CDE B;  4K7C A;  4QRX A;  3USV A;  2E01 A;  4XUI A;  4PAD A;  1F2C A;  3IHP A;  3OF9 A;  1EWM A;  2DCB A;  2P7U A;  6PAD A;  3N3G A;  1KFU L;  3HHA A;  2OZ2 A;  4YYQ A;  1A6R A;  3KSE A;  2YJC A;  2ARY A;  3QT4 A;  2VHF A;  2DC7 A;  2AUX A;  2R9O A;  4QRV A;  3P5W A;  2HH5 A;  2H7J A;  3KX1 A;  3BOW A;  2XU3 A;  4BS5 A;  3MHS A;  4W4U A;  3PDF A;  3KW9 A;  3P5X A;  3IOQ A;  1TLO A;  2G8J A;  4W5B A;  4ZUX U;  3RVV A;  4HWY A;  4QBB A;  1SNK A;  2GFO A;  2WBF X;  3O0U A;  3LFY A;  4DMY A;  5J94 A;  3CBJ A;  3LXS A;  3HHI A;  1PCI A;  3U8E A;  1CB5 A;  5FPW A;  1BGO A;  5EGW A;  1NL6 A;  4YYR A;  4FIP A;  2DZZ A;  2DJG B;  4PI3 A;  5JA7 A;  2DC6 A;  3O1G A;  1KFX L;  3AI8 A;  3OVZ A;  2PNS A;  1QXP A;  2JQG R;  4YYU A;  1NQC A;  3F5V A;  3MHH A;  2Y5B A;  1EWP A;  5JH3 A;  1AU2 A;  3RVX A;  2BDL A;  1ITO A;  2YJ2 A;  1Y4H A;  2CB5 A;  4N79 A;  4I04 A;  1BQI A;  2FYE A;  2AVW A;  3KFQ A;  8PCH A;  4CDD B;  1DF0 A;  3RVW A;  2PAD A;  2AUZ A;  1ZIV A;  2DC9 A;  3OF8 A;  4BS6 A;  2VHS A;  1QOL A;  1KHQ A;  2XU5 A;  3OIS A;  1GCB A;  2E02 A;  5K16 A;  3WXE A;  1HUC B;  4CDC B;  1CTE A;  1Y08 A;  3WXF A;  1CV8 A;  3QJ3 A;  3IMA A;  4X6I A;  1Q6K A;  3N4C A;  1AYU A;  1YVB A;  3F75 A;  1VSN A;  1K3B B;  3H8B A;  5PAD A;  3PBH A;  4KLB A;  3D6S A;  4N4Z A;  2E00 A;  4MZS A;  4QH6 A;  1BY8 A;  1ME4 A;  2JQF R;  4I05 A;  1POP A;  3C9E A;  1QDQ A;  1TL9 A;  1U9Q X;  3PNR A;  1MHW A;  3K9M A;  4Q8G A;  1O0E A;  1PPN A;  2DCA A;  2PBH A;  2DJF B;  3IUT A;  3MTN A;  2Y6E A;  3K8U A;  4CZW A;  3KWZ A;  1MEM A;  4YYS A;  4CDF B;  3CBK A;  2IBI A;  2G6D A;  1YK7 A;  4YYW A;  1KHP A;  2DC8 A;  2FUD A;  5A24 A;  2R9C A;  5CVO B;  4W5C A;  2HXZ A;  1AU3 A;  1AIM A;  3S3Q A;  3V6E A;  2YJ9 A;  3GCB A;  4N8W A;  2FQ9 A;  1MEG A;  5CVN B;  4BSQ A;  1PE6 A;  1MS6 A;  2O6X A;  1GMY A;  3M99 A;  4AXM A;  4PP1 A;  1NB5 A;  4XR7 A;  2PRE A;  1VJV A;  1XKG A;  9PAP A;  2R9M A;  1F2B A;  1STF E;  1MDW A;  1CJL A;  2GHU A;  3IEJ A;  4OEM A;  1EF7 A;  4MZO A;  3S3R A;  1YAL A;  1AU4 A;  1BP4 A;  1QMY A;  1FH0 A;  3TNX A;  1ME3 A;  4WA6 A;  2NQG A;  3NHE A;  3V6C A;  1GEC E;  2FO5 A;  5CVM A;  1PPO A;  2DCC A;  2AYN A;  1YT7 A;  2R9F A;  2IPP B;  2F1G A; 
#chains in the Genus database with same CATH topology
 3H6S A;  2NQA A;  4YV8 A;  1KXR A;  3PRP A;  4BQV A;  4FK5 A;  2AYO A;  1CSB B;  2B1N A;  1U5I A;  1TU6 A;  3WXG A;  2JTC A;  3I3T A;  4I07 A;  4RF1 A;  5EZQ A;  3HD3 A;  2F7D A;  5EF4 A;  5CHV A;  1AEC A;  4FJC A;  2BDZ A;  1NB3 A;  1ZCM A;  2AIM A;  5E6J A;  2FT2 A;  4Q8H A;  4RKX A;  2ACT A;  2UZJ A;  4BOS A;  2G7Y A;  2FRA A;  1GLO A;  1PAD A;  7PCK A;  5F02 A;  2HD5 A;  3TMP A;  2FRQ A;  5CHT A;  3H89 A;  1PXV A;  4X6H A;  2YJB A;  3IV2 A;  1PBH A;  4RY2 A;  3ZUA A;  2R6N A;  4BPV A;  1X9Y A;  2P0R A;  4REZ A;  2ATO A;  3CH2 X;  3BPF A;  4AXL A;  2C0Y A;  3B21 A;  1U9W A;  1YK8 A;  4MSX A;  2J7Q A;  3KWB X;  2B1M A;  1AYW A;  3OVX A;  3QSD A;  1PPD A;  2JRI A;  4PP2 E;  3RNV A;  3E1Z B;  2P86 A;  3BCN A;  1F2A A;  3PW3 A;  4X6J A;  3BWK A;  2XU4 A;  2DCD A;  1JQP A;  4XZX A;  4OEL A;  2R9N A;  3MOR A;  1CVZ A;  1U9X A;  3PRM A;  3ERV A;  3BC3 A;  4QRG A;  3DF0 A;  3P5V A;  1IWD A;  3H8C A;  1CPJ A;  2FE8 A;  2OUL A;  1UKF A;  3BPM A;  4P6G A;  3P5U A;  2CIO A;  1CS8 A;  2FTD A;  1U9V A;  3KKU A;  1ICF A;  3B79 A;  2G8E A;  3MJ5 A;  2AS8 A;  4YVA A;  4YYV A;  1EWL A;  1DEU A;  3CH3 X;  4DMX A;  3I06 A;  1PPP A;  1NLJ A;  1F29 A;  1AU0 A;  1MIR A;  2DZY A;  4P6E A;  3N3K A;  3TRK A;  1EWO A;  2NQI A;  1M6D A;  3H7D A;  2BTW B;  4P16 A;  2XU1 A;  1PIP A;  2OP3 A;  1ATK A;  2AU1 A;  1THE A;  1CQD A;  2HHN A;  2NQD B;  3HWN A;  2YJ8 A;  3PHX A;  3E9S A;  1SP4 B;  3K24 A;  1AYV A;  3ZNH A;  1NPZ A;  4G54 A;  2E03 A;  1DKI A;  1S4V A;  3MTV A;  4CDE B;  4K7C A;  4QRX A;  3USV A;  2E01 A;  2Z84 A;  2AGA A;  4XUI A;  4PAD A;  1F2C A;  3IHP A;  3OF9 A;  1EWM A;  2DCB A;  2P7U A;  6PAD A;  3W30 A;  3N3G A;  1KFU L;  3HHA A;  2OZ2 A;  4YYQ A;  1A6R A;  3KSE A;  2YJC A;  4HXD B;  4OVZ B;  2ARY A;  3QT4 A;  2VHF A;  2DC7 A;  4D8B A;  2AUX A;  3BB7 A;  3PSE A;  2R9O A;  4QRV A;  3P5W A;  2HH5 A;  2H7J A;  3KX1 A;  3BOW A;  2XU3 A;  4BS5 A;  3MHS A;  4W4U A;  3PDF A;  5EZS A;  3KW9 A;  3P5X A;  3IOQ A;  1TLO A;  2G8J A;  4W5B A;  4ZUX U;  3RVV A;  4HWY A;  4QBB A;  1SNK A;  2GFO A;  2WBF X;  3O0U A;  3LFY A;  4DMY A;  4MI7 A;  3MP2 A;  5J94 A;  3IFU A;  4PT5 A;  3CBJ A;  3LXS A;  3HHI A;  1PCI A;  3U8E A;  1CB5 A;  5FPW A;  1BGO A;  5EGW A;  1NL6 A;  4BOU A;  4BOZ A;  4YYR A;  3O65 A;  4FIP A;  5KO3 A;  2DZZ A;  2DJG B;  4PI3 A;  5JA7 A;  2DC6 A;  3O1G A;  1KFX L;  3AI8 A;  3OVZ A;  2PNS A;  1QXP A;  4A5U A;  2JQG R;  4YYU A;  1NQC A;  3F5V A;  4WUR A;  3MHH A;  1YZB A;  2Y5B A;  3BY4 A;  1EWP A;  5JH3 A;  1AU2 A;  3RVX A;  2HWK A;  2BDL A;  1ITO A;  2YJ2 A;  1Y4H A;  2CB5 A;  4N79 A;  4I04 A;  1BQI A;  2FYE A;  2AVW A;  3KFQ A;  8PCH A;  4CDD B;  1DF0 A;  3RVW A;  2PAD A;  2AUZ A;  1ZIV A;  2DC9 A;  3OF8 A;  4BS6 A;  2VHS A;  1QOL A;  2DOS A;  1KHQ A;  3W31 A;  2XU5 A;  3OIS A;  1GCB A;  2E02 A;  5K16 A;  3WXE A;  3BBA A;  1HUC B;  4CDC B;  1CTE A;  1Y08 A;  4MM3 B;  3WXF A;  1CV8 A;  3QJ3 A;  3IMA A;  4X6I A;  1Q6K A;  3N4C A;  1AYU A;  4GUA A;  1YVB A;  3F75 A;  1VSN A;  1K3B B;  3H8B A;  5PAD A;  3PBH A;  4KLB A;  3D6S A;  4N4Z A;  2E00 A;  4MZS A;  4QH6 A;  4BOQ A;  1BY8 A;  1ME4 A;  1PVJ A;  2JQF R;  4I05 A;  4D8I A;  1POP A;  3C9E A;  4M0W A;  1QDQ A;  1TL9 A;  1U9Q X;  2J7Q C;  3PHU A;  3PNR A;  1MHW A;  3K9M A;  4Q8G A;  4D8E A;  1O0E A;  1PPN A;  2DCA A;  3PT2 A;  2PBH A;  2DJF B;  3IUT A;  3MTN A;  2Y6E A;  3K8U A;  4CZW A;  3KWZ A;  1MEM A;  4YYS A;  4CDF B;  3CBK A;  2IBI A;  4RF0 A;  2G6D A;  3C0R A;  1YK7 A;  4YYW A;  1KHP A;  2DC8 A;  2FUD A;  5A24 A;  2R9C A;  5CVO B;  4IUM A;  4W5C A;  2BU3 A;  2HXZ A;  1AU3 A;  1AIM A;  3S3Q A;  3V6E A;  2YJ9 A;  3GCB A;  4N8W A;  2FQ9 A;  1MEG A;  5CVN B;  4BSQ A;  1PE6 A;  1MS6 A;  2O6X A;  1GMY A;  2BTW A;  3M99 A;  4AXM A;  4PP1 A;  1NB5 A;  4XR7 A;  2PRE A;  1VJV A;  4IP3 A;  1XKG A;  9PAP A;  2R9M A;  1F2B A;  1STF E;  1MDW A;  1CJL A;  4R3D A;  2GHU A;  3IEJ A;  4OEM A;  1EF7 A;  4MZO A;  3S3R A;  1YAL A;  1AU4 A;  1BP4 A;  4RNA A;  1QMY A;  1FH0 A;  3OQC A;  3TNX A;  1ME3 A;  4WA6 A;  2NQG A;  3NHE A;  4BOP A;  3V6C A;  1GEC E;  2FO5 A;  4OW0 A;  5CVM A;  1PPO A;  4OVZ A;  4ZTB A;  2DCC A;  2AYN A;  1YT7 A;  2R9F A;  3PHW A;  2IPP B;  2F1G A;  5JZE A; 
#chains in the Genus database with same CATH homology
 3H6S A;  2NQA A;  4YV8 A;  1KXR A;  4BQV A;  4FK5 A;  2AYO A;  1CSB B;  2B1N A;  1U5I A;  1TU6 A;  3WXG A;  3I3T A;  4I07 A;  3HD3 A;  2F7D A;  5EF4 A;  5CHV A;  1AEC A;  4FJC A;  2BDZ A;  1NB3 A;  1ZCM A;  2AIM A;  2FT2 A;  4Q8H A;  2ACT A;  2G7Y A;  2FRA A;  1GLO A;  1PAD A;  7PCK A;  5F02 A;  2HD5 A;  2FRQ A;  5CHT A;  3H89 A;  1PXV A;  4X6H A;  2YJB A;  3IV2 A;  1PBH A;  4RY2 A;  3ZUA A;  2R6N A;  4BPV A;  1W6F A;  1X9Y A;  2P0R A;  2ATO A;  3CH2 X;  3BPF A;  4AXL A;  2C0Y A;  1U9W A;  1YK8 A;  4MSX A;  3KWB X;  2B1M A;  1AYW A;  3OVX A;  3QSD A;  1PPD A;  4PP2 E;  3E1Z B;  2P86 A;  3BCN A;  1F2A A;  3PW3 A;  4X6J A;  3BWK A;  2XU4 A;  2DCD A;  1JQP A;  4OEL A;  2R9N A;  3MOR A;  1CVZ A;  1U9X A;  3ERV A;  4NV8 A;  3BC3 A;  4QRG A;  4NV7 A;  3DF0 A;  4C5P A;  3P5V A;  1IWD A;  3H8C A;  1CPJ A;  4P6G A;  2OUL A;  3BPM A;  3P5U A;  2CIO A;  1CS8 A;  2FTD A;  1U9V A;  3KKU A;  1ICF A;  3B79 A;  2G8E A;  2AS8 A;  4YVA A;  4YYV A;  1EWL A;  1DEU A;  3CH3 X;  4DMX A;  1W5R A;  1PPP A;  3I06 A;  1NLJ A;  1F29 A;  1AU0 A;  1MIR A;  2DZY A;  4P6E A;  3N3K A;  1EWO A;  2NQI A;  1M6D A;  3H7D A;  2XU1 A;  1PIP A;  2OP3 A;  1ATK A;  2AU1 A;  1THE A;  1CQD A;  2HHN A;  2NQD B;  1E2T A;  3HWN A;  2YJ8 A;  1SP4 B;  3K24 A;  1AYV A;  1NPZ A;  4G54 A;  2E03 A;  1S4V A;  4CDE B;  4K7C A;  4QRX A;  3USV A;  2E01 A;  4XUI A;  4PAD A;  1F2C A;  3IHP A;  3OF9 A;  1EWM A;  2DCB A;  2P7U A;  6PAD A;  2VFC A;  3N3G A;  1KFU L;  3HHA A;  2OZ2 A;  1GX3 A;  4YYQ A;  1A6R A;  3KSE A;  2YJC A;  2ARY A;  3QT4 A;  2VHF A;  2DC7 A;  2AUX A;  2R9O A;  4QRV A;  3P5W A;  2HH5 A;  2H7J A;  3KX1 A;  3BOW A;  2XU3 A;  4BS5 A;  3MHS A;  4W4U A;  3PDF A;  3KW9 A;  3P5X A;  3IOQ A;  1TLO A;  2G8J A;  4W5B A;  4ZUX U;  3RVV A;  2BSZ A;  4HWY A;  4QBB A;  1SNK A;  2GFO A;  2WBF X;  3O0U A;  3LFY A;  4DMY A;  5J94 A;  3CBJ A;  3LXS A;  3HHI A;  1PCI A;  3U8E A;  1CB5 A;  5FPW A;  1BGO A;  5EGW A;  1NL6 A;  4YYR A;  4FIP A;  2DZZ A;  2DJG B;  4PI3 A;  5JA7 A;  2DC6 A;  3O1G A;  2VFB A;  1KFX L;  3AI8 A;  3OVZ A;  2PNS A;  1QXP A;  2JQG R;  4YYU A;  1NQC A;  3F5V A;  3MHH A;  2Y5B A;  4B55 A;  1EWP A;  5JH3 A;  1AU2 A;  3RVX A;  2BDL A;  1ITO A;  2YJ2 A;  3D9W A;  1Y4H A;  2CB5 A;  4N79 A;  4I04 A;  1BQI A;  2FYE A;  2AVW A;  3KFQ A;  4GUZ A;  8PCH A;  4CDD B;  1DF0 A;  3RVW A;  2PAD A;  2AUZ A;  1ZIV A;  2DC9 A;  3OF8 A;  4BS6 A;  2VHS A;  1QOL A;  1KHQ A;  2XU5 A;  3OIS A;  1GCB A;  2E02 A;  5K16 A;  3WXE A;  1HUC B;  4CDC B;  1CTE A;  1Y08 A;  3WXF A;  1CV8 A;  3QJ3 A;  3IMA A;  4X6I A;  1Q6K A;  1W4T A;  3N4C A;  1AYU A;  1YVB A;  3F75 A;  1VSN A;  1K3B B;  3H8B A;  5PAD A;  3PBH A;  4KLB A;  3D6S A;  4N4Z A;  2E00 A;  4MZS A;  4QH6 A;  1BY8 A;  1ME4 A;  2JQF R;  4I05 A;  1POP A;  3C9E A;  1QDQ A;  1TL9 A;  1U9Q X;  3PNR A;  1MHW A;  3K9M A;  4Q8G A;  1O0E A;  1PPN A;  2DCA A;  2PBH A;  3LTW A;  2DJF B;  3IUT A;  3MTN A;  2Y6E A;  3K8U A;  4CZW A;  3KWZ A;  1MEM A;  4YYS A;  4CDF B;  3CBK A;  2IBI A;  2G6D A;  1YK7 A;  4YYW A;  1KHP A;  2DC8 A;  2FUD A;  5A24 A;  2R9C A;  5CVO B;  4W5C A;  2HXZ A;  1AU3 A;  1AIM A;  3S3Q A;  3V6E A;  2YJ9 A;  3GCB A;  4N8W A;  2FQ9 A;  1MEG A;  5CVN B;  4BSQ A;  1PE6 A;  1MS6 A;  2O6X A;  1GMY A;  3M99 A;  4BGF A;  4AXM A;  4PP1 A;  1NB5 A;  4XR7 A;  2PRE A;  1VJV A;  1XKG A;  9PAP A;  2R9M A;  1F2B A;  1STF E;  1MDW A;  1CJL A;  2GHU A;  3IEJ A;  4OEM A;  1EF7 A;  4MZO A;  3S3R A;  1YAL A;  1AU4 A;  1BP4 A;  1QMY A;  1FH0 A;  3TNX A;  1ME3 A;  4WA6 A;  2NQG A;  3NHE A;  3V6C A;  1GEC E;  2FO5 A;  5CVM A;  1PPO A;  2DCC A;  2AYN A;  1YT7 A;  2R9F A;  2IPP B;  2F1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...