2JQFR

Full length leader protease of foot and mouth disease virus c51a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain o1)
molecule tags Viral protein
molecule keywords Genome polyprotein
total genus 30
structure length 166
sequence length 173
chains with identical sequence S
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2jqfR00
4MZOA 3LFYA 1AIMA 3IEJA 1U9VA 2B1NA 3KFQA 3AI8A 5CVOB 1U9XA 2NQDB 3H8CA 1CB5A 1FH0A 3MORA 3PW3A 2NQAA 3P5UA 1K3BB 3IV2A 1U5IA 2DC8A 5EF4A 1KXRA 4X6IA 3V6CA 3I06A 1GECE 4N79A 1EWPA 1BGOA 4ZUXU 4Q8GA 4YVAA 4CDEB 5JA7A 3M99A 2NQIA 4BS5A 3OF9A 1MEGA 1EWOA 2FYEA 3HHIA 1AYWA 3WXFA 2YJCA 2B1MA 4G54A 2NQGA 3BC3A 3KX1A 2JQGR 1GMYA 1MHWA 1PXVA 4X6HA 1S4VA 2AU1A 4FJCA 2PBHA 1KFXL 2Y6EA 3C9EA 3KWZA 4YYQA 1AECA 3S3RA 7PCKA 1KHQA 4PI3A 2BDZA 1A6RA 2P0RA 4MZSA 1NLJA 1ZCMA 4BPVA 4BQVA 4FK5A 1NB3A 2DCAA 1GLOA 1BQIA 1PADA 1CSBB 1BY8A 1PCIA 3ERVA 3QSDA 2FO5A 1EWMA 2E03A 3O0UA 1NPZA 2ACTA 2OULA 2AUZA 2R9NA 1ZIVA 2ARYA 4QRVA 3H6SA 1THEA 2VHSA 3H8BA 1DF0A 3USVA 2Y5BA 1F2BA 3CH3X 4OEMA 1AU0A 2AIMA 1CQDA 1AYVA 1PPNA 3OF8A 1U9QX 2P86A 3IOQA 2YJBA 3N3KA 3QJ3A 4YYVA 3IUTA 1JQPA 3N4CA 3BCNA 4I05A 1SNKA 2R9OA 1O0EA 1YK8A 3I3TA 3RVVA 4YYUA 1GCBA 1Q6KA 3PNRA 4QBBA 1M6DA 1PPDA 3WXEA 1U9WA 2AYNA 4DMYA 1MEMA 1YK7A 1CJLA 3LXSA 1QXPA 1AU4A 2WBFX 2R9FA 3CH2X 3HWNA 4PP2E 5CHVA 1Y4HA 2DJFB 1PIPA 4BS6A 2FT2A 2FRAA 2H7JA 2DC7A 2PADA 2HD5A 3PDFA 3MHHA 3WXGA 4AXLA 3PBHA 3P5VA 4HWYA 1QOLA 2G6DA 4W5CA 1DEUA 4YYSA 1NB5A 3QT4A 4YYRA 1VJVA 4RY2A 5K16A 1AYUA 3K8UA 4CDDB 4AXMA 2DCDA 1ATKA 1ME3A 4DMXA 1ICFA 1IWDA 2R9CA 4W4UA 3OVXA 5CVMA 4WA6A 2FQ9A 1TL9A 2XU1A 1NQCA 2DJGB 1KHPA 5F02A 2HXZA 4CDFB 1QDQA 4CZWA 1Y08A 2E02A 1QMYA 4YV8A 2AUXA 1TLOA 2YJ8A 4Q8HA 2IBIA 1YT7A 3D6SA 2XU4A 2FUDA 3BWKA 4N8WA 4YYWA 4KLBA 3E1ZB 4K7CA 3P5XA 3V6EA 1MIRA 1NL6A 1STFE 3HHAA 1CTEA 2DC6A 2JQFR 2PNSA 2ATOA 2VHFA 3OVZA 2O6XA 2FRQA 2DZZA 2OZ2A 2G8JA 1AU2A 4P6GA 5CHTA 4QH6A 2G7YA 4OELA 3KKUA 3KW9A 1ITOA 5A24A 2HHNA 1PBHA 3MTNA 3K9MA 2HH5A 4BSQA 1YVBA 3O1GA 2R9MA 3TNXA 2F1GA 4CDCB 3OISA 3RVWA 5EGWA 2CB5A 3U8EA 4I04A 1CVZA 2AYOA 2CIOA 5FPWA 1PPOA 4X6JA 9PAPA 2DC9A 1EWLA 3ZUAA 2BDLA 3MHSA 1POPA 4PADA 4W5BA 1PPPA 2PREA 3P5WA 4PP1A 2DZYA 2YJ2A 1SP4B 1HUCB 1MS6A 1EF7A 1CV8A 5CVNB 8PCHA 3CBKA 2FTDA 3KSEA 4MSXA 2DCBA 3H7DA 1CPJA 5J94A 3K24A 2XU3A 2AVWA 3BOWA 3IHPA 1KFUL 3BPMA 1BP4A 3HD3A 6PADA 1XKGA 2E01A 2E00A 1F2CA 2YJ9A 4N4ZA 2XU5A 3BPFA 5PADA 1CS8A 3H89A 2OP3A 1PE6A 3NHEA 4P6EA 2G8EA 2GFOA 2AS8A 4XR7A 3IMAA 3GCBA 4FIPA 2R6NA 1VSNA 3KWBX 3N3GA 1AU3A 2GHUA 4QRXA 1F2AA 2IPPB 1X9YA 3DF0A 4QRGA 2DCCA 3CBJA 3F5VA 2F7DA 1MDWA 4I07A 1YALA 1ME4A 3B79A 1TU6A 1F29A 3S3QA 2P7UA 3F75A 2C0YA 5JH3A 4XUIA 3RVXA
chains in the Genus database with same CATH superfamily
4MZOA 3LFYA 1AIMA 1DKIA 3IEJA 1U9VA 3TRKA 2B1NA 3KFQA 2AGAA 3AI8A 1UKFA 5CVOB 1U9XA 2NQDB 3H8CA 1CB5A 3ZNHA 1FH0A 3MORA 3PW3A 2NQAA 3P5UA 4GUAA 4BOZA 1K3BB 3IV2A 2J7QC 3PRMA 4IUMA 1U5IA 2DC8A 5EF4A 1KXRA 4X6IA 3V6CA 3I06A 1GECE 4N79A 4REZA 1EWPA 1BGOA 4ZUXU 4Q8GA 4YVAA 4CDEB 5JA7A 3M99A 2NQIA 4BS5A 2JRIA 3OF9A 1MEGA 1EWOA 2FYEA 3HHIA 1AYWA 3WXFA 2YJCA 2B1MA 4G54A 2NQGA 3BC3A 3KX1A 2JQGR 1GMYA 2Z84A 2HWKA 1MHWA 3IFUA 1PXVA 4OW0A 4RF0A 4X6HA 1S4VA 2AU1A 4FJCA 2PBHA 1KFXL 2Y6EA 3C9EA 3KWZA 4YYQA 1AECA 3S3RA 7PCKA 1KHQA 4PI3A 2BDZA 4MI7A 1A6RA 2P0RA 4MZSA 1NLJA 1ZCMA 4BPVA 4BQVA 5EZQA 4FK5A 3W30A 1NB3A 2DCAA 1GLOA 1BQIA 1PADA 1CSBB 1BY8A 1PCIA 3ERVA 3QSDA 2FO5A 1EWMA 2E03A 2DOSA 3O0UA 1NPZA 2ACTA 2OULA 2AUZA 2UZJA 2R9NA 1ZIVA 2ARYA 4QRVA 3H6SA 1THEA 2VHSA 3H8BA 1DF0A 3USVA 2Y5BA 2JTCA 1F2BA 3PHUA 3CH3X 4OEMA 1AU0A 3OQCA 2AIMA 3RNVA 1CQDA 1AYVA 1PPNA 3OF8A 1U9QX 2P86A 3IOQA 2YJBA 3N3KA 3C0RA 4D8BA 3PT2A 3QJ3A 4YYVA 3IUTA 1JQPA 3N4CA 4R3DA 3BCNA 4I05A 1SNKA 5JZEA 2R9OA 1O0EA 1YK8A 3I3TA 3RVVA 4YYUA 5KO3A 1GCBA 1Q6KA 3PNRA 4QBBA 1M6DA 1PPDA 3WXEA 1U9WA 2AYNA 5EZSA 4DMYA 1MEMA 1YK7A 1CJLA 3LXSA 1QXPA 1AU4A 3PRPA 2WBFX 4BOUA 1YZBA 2R9FA 4RKXA 3CH2X 3HWNA 4PP2E 5CHVA 1Y4HA 2DJFB 1PIPA 4BS6A 2FT2A 2FRAA 2H7JA 2DC7A 2PADA 2HD5A 3PDFA 3MHHA 3WXGA 4AXLA 3PBHA 3P5VA 4HWYA 1QOLA 2G6DA 4W5CA 1DEUA 2BU3A 4YYSA 3BB7A 1NB5A 3QT4A 4YYRA 1VJVA 2FE8A 4RY2A 5K16A 1AYUA 3K8UA 4A5UA 4CDDB 4AXMA 4BOQA 2J7QA 2DCDA 4OVZA 1ATKA 1ME3A 4DMXA 1ICFA 1IWDA 2R9CA 4W4UA 3OVXA 5CVMA 4WA6A 2FQ9A 1TL9A 2XU1A 1NQCA 2DJGB 1KHPA 5F02A 2HXZA 4BOSA 4CDFB 1QDQA 4CZWA 1Y08A 2E02A 1QMYA 4YV8A 4WURA 2AUXA 1TLOA 2YJ8A 4Q8HA 2IBIA 4BOPA 1YT7A 3D6SA 2XU4A 2FUDA 3BWKA 4N8WA 4YYWA 4KLBA 3E1ZB 4K7CA 3P5XA 3V6EA 4PT5A 3HHAA 1MIRA 1NL6A 1STFE 4MM3B 1CTEA 2DC6A 2JQFR 3W31A 2PNSA 2ATOA 2VHFA 3OVZA 2O6XA 2FRQA 2DZZA 2OZ2A 2G8JA 1AU2A 4P6GA 5CHTA 2BTWB 4QH6A 2G7YA 4OELA 3KKUA 3KW9A 1ITOA 5A24A 2HHNA 1PBHA 4IP3A 3MTNA 3K9MA 2HH5A 4BSQA 1YVBA 3O1GA 2R9MA 3TNXA 2F1GA 4CDCB 3OISA 5E6JA 3RVWA 4RNAA 1PVJA 5EGWA 2CB5A 3U8EA 4XZXA 4I04A 1CVZA 2AYOA 2CIOA 5FPWA 1PPOA 3BY4A 4X6JA 9PAPA 2DC9A 3B21A 3BBAA 1EWLA 3PSEA 3ZUAA 2BDLA 3MHSA 1POPA 4PADA 4W5BA 4D8IA 1PPPA 2PREA 3P5WA 4PP1A 2DZYA 2YJ2A 1SP4B 1HUCB 1MS6A 1EF7A 1CV8A 4ZTBA 5CVNB 8PCHA 3CBKA 2FTDA 3KSEA 4MSXA 3MJ5A 2DCBA 3O65A 3H7DA 1CPJA 5J94A 3K24A 2XU3A 2AVWA 3BOWA 3IHPA 3TMPA 4HXDB 4D8EA 1KFUL 3BPMA 1BP4A 3HD3A 6PADA 1XKGA 2E01A 2E00A 1F2CA 4N4ZA 2YJ9A 2XU5A 4P16A 3E9SA 3BPFA 5PADA 1CS8A 3H89A 2OP3A 1PE6A 3NHEA 4P6EA 4RF1A 2G8EA 2GFOA 2AS8A 4XR7A 3IMAA 3GCBA 4FIPA 2R6NA 1VSNA 3KWBX 3N3GA 1AU3A 2GHUA 4QRXA 1F2AA 2IPPB 1X9YA 3DF0A 4QRGA 2DCCA 3CBJA 3F5VA 2F7DA 1MDWA 4I07A 1YALA 3PHWA 1ME4A 3B79A 4OVZB 2BTWA 1TU6A 3PHXA 1F29A 3S3QA 2P7UA 3F75A 3MP2A 3MTVA 4M0WA 2C0YA 5JH3A 4XUIA 3RVXA
chains in the Genus database with same CATH topology
4MZOA 3LFYA 1AIMA 3IEJA 1U9VA 2B1NA 3KFQA 3AI8A 5CVOB 1U9XA 2NQDB 3H8CA 1CB5A 1FH0A 3MORA 3PW3A 2NQAA 3P5UA 1K3BB 3IV2A 1U5IA 2DC8A 5EF4A 1KXRA 4X6IA 3V6CA 3I06A 1GECE 4N79A 4GUZA 1EWPA 1BGOA 4ZUXU 4Q8GA 4YVAA 4CDEB 5JA7A 3M99A 2NQIA 4BS5A 3OF9A 4NV7A 1MEGA 1EWOA 2FYEA 3HHIA 1AYWA 3WXFA 2YJCA 2B1MA 4G54A 2NQGA 3BC3A 3KX1A 2JQGR 1GMYA 1MHWA 1PXVA 4X6HA 1S4VA 2AU1A 4FJCA 2PBHA 1KFXL 2Y6EA 3C9EA 3KWZA 4YYQA 1AECA 3S3RA 7PCKA 1KHQA 4PI3A 2BDZA 1A6RA 2P0RA 4MZSA 1NLJA 1ZCMA 4BPVA 4BQVA 4FK5A 1NB3A 2DCAA 1GLOA 1BQIA 1PADA 2VFCA 1CSBB 1BY8A 1PCIA 3ERVA 3QSDA 2FO5A 1EWMA 2E03A 3O0UA 1NPZA 2ACTA 2OULA 2AUZA 2R9NA 1ZIVA 2ARYA 4QRVA 3H6SA 1THEA 2VHSA 3H8BA 1DF0A 3USVA 2Y5BA 1F2BA 3CH3X 1W4TA 4OEMA 1AU0A 2AIMA 1CQDA 1AYVA 1PPNA 3OF8A 1U9QX 2P86A 3IOQA 2YJBA 3N3KA 1W6FA 3QJ3A 4YYVA 3IUTA 1JQPA 3N4CA 3BCNA 4I05A 1SNKA 2R9OA 1O0EA 1YK8A 3I3TA 3RVVA 4YYUA 1GCBA 1Q6KA 3PNRA 4QBBA 1M6DA 1PPDA 3WXEA 1U9WA 2AYNA 4DMYA 1MEMA 1YK7A 1CJLA 3LXSA 1QXPA 1AU4A 2WBFX 2R9FA 3CH2X 3HWNA 4PP2E 5CHVA 1Y4HA 2DJFB 1PIPA 4BS6A 2FT2A 2FRAA 2H7JA 2DC7A 2PADA 2HD5A 3PDFA 3MHHA 3WXGA 4AXLA 3PBHA 3P5VA 4HWYA 1QOLA 2G6DA 4W5CA 1DEUA 4YYSA 1NB5A 3QT4A 4YYRA 1VJVA 4RY2A 5K16A 1AYUA 3K8UA 4CDDB 4AXMA 2DCDA 1ATKA 1ME3A 4C5PA 1ICFA 4DMXA 1IWDA 2R9CA 4W4UA 3OVXA 3LTWA 5CVMA 4WA6A 2FQ9A 1TL9A 2XU1A 1NQCA 2DJGB 1KHPA 5F02A 2HXZA 4CDFB 1QDQA 4CZWA 1Y08A 1E2TA 2E02A 1QMYA 4YV8A 2AUXA 1TLOA 2YJ8A 4Q8HA 2IBIA 1YT7A 3D6SA 2XU4A 2FUDA 3BWKA 4N8WA 4YYWA 4KLBA 3E1ZB 4K7CA 3P5XA 2BSZA 3V6EA 1MIRA 1NL6A 1STFE 3HHAA 1CTEA 2DC6A 2JQFR 2PNSA 2ATOA 2VHFA 3OVZA 2O6XA 2FRQA 2DZZA 2OZ2A 2G8JA 1AU2A 4P6GA 5CHTA 4QH6A 2G7YA 4OELA 3KKUA 3KW9A 1ITOA 5A24A 2HHNA 1PBHA 3MTNA 3K9MA 2HH5A 4BSQA 1YVBA 3O1GA 2R9MA 3TNXA 2F1GA 4CDCB 3OISA 4B55A 3RVWA 5EGWA 2CB5A 3U8EA 3D9WA 4I04A 1CVZA 2AYOA 2CIOA 5FPWA 1PPOA 4X6JA 9PAPA 2DC9A 4BGFA 1EWLA 3ZUAA 2BDLA 3MHSA 1POPA 4PADA 4W5BA 1PPPA 2PREA 3P5WA 4PP1A 2DZYA 2YJ2A 1SP4B 1HUCB 1GX3A 1MS6A 1EF7A 1CV8A 5CVNB 8PCHA 3CBKA 2FTDA 3KSEA 4MSXA 2VFBA 2DCBA 3H7DA 1CPJA 5J94A 3K24A 2XU3A 2AVWA 3BOWA 3IHPA 1KFUL 3BPMA 1BP4A 3HD3A 6PADA 1XKGA 2E01A 2E00A 1F2CA 2YJ9A 4N4ZA 2XU5A 3BPFA 5PADA 1CS8A 3H89A 2OP3A 1PE6A 3NHEA 4P6EA 2G8EA 2GFOA 2AS8A 4XR7A 3IMAA 4NV8A 3GCBA 4FIPA 2R6NA 1VSNA 3KWBX 3N3GA 1AU3A 2GHUA 1W5RA 4QRXA 1F2AA 2IPPB 1X9YA 3DF0A 4QRGA 2DCCA 3CBJA 3F5VA 2F7DA 1MDWA 4I07A 1YALA 1ME4A 3B79A 1TU6A 1F29A 3S3QA 2P7UA 3F75A 2C0YA 5JH3A 4XUIA 3RVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZO A;  3LFY A;  1AIM A;  3IEJ A;  1U9V A;  2B1N A;  3KFQ A;  3AI8 A;  5CVO B;  1U9X A;  2NQD B;  3H8C A;  1CB5 A;  1FH0 A;  3MOR A;  3PW3 A;  2NQA A;  3P5U A;  1K3B B;  3IV2 A;  1U5I A;  2DC8 A;  5EF4 A;  1KXR A;  4X6I A;  3V6C A;  3I06 A;  1GEC E;  4N79 A;  1EWP A;  1BGO A;  4ZUX U;  4Q8G A;  4YVA A;  4CDE B;  5JA7 A;  3M99 A;  2NQI A;  4BS5 A;  3OF9 A;  1MEG A;  1EWO A;  2FYE A;  3HHI A;  1AYW A;  3WXF A;  2YJC A;  2B1M A;  4G54 A;  2NQG A;  3BC3 A;  3KX1 A;  2JQG R;  1GMY A;  1MHW A;  1PXV A;  4X6H A;  1S4V A;  2AU1 A;  4FJC A;  2PBH A;  1KFX L;  2Y6E A;  3C9E A;  3KWZ A;  4YYQ A;  1AEC A;  3S3R A;  7PCK A;  1KHQ A;  4PI3 A;  2BDZ A;  1A6R A;  2P0R A;  4MZS A;  1NLJ A;  1ZCM A;  4BPV A;  4BQV A;  4FK5 A;  1NB3 A;  2DCA A;  1GLO A;  1BQI A;  1PAD A;  1CSB B;  1BY8 A;  1PCI A;  3ERV A;  3QSD A;  2FO5 A;  1EWM A;  2E03 A;  3O0U A;  1NPZ A;  2ACT A;  2OUL A;  2AUZ A;  2R9N A;  1ZIV A;  2ARY A;  4QRV A;  3H6S A;  1THE A;  2VHS A;  3H8B A;  1DF0 A;  3USV A;  2Y5B A;  1F2B A;  3CH3 X;  4OEM A;  1AU0 A;  2AIM A;  1CQD A;  1AYV A;  1PPN A;  3OF8 A;  1U9Q X;  2P86 A;  3IOQ A;  2YJB A;  3N3K A;  3QJ3 A;  4YYV A;  3IUT A;  1JQP A;  3N4C A;  3BCN A;  4I05 A;  1SNK A;  2R9O A;  1O0E A;  1YK8 A;  3I3T A;  3RVV A;  4YYU A;  1GCB A;  1Q6K A;  3PNR A;  4QBB A;  1M6D A;  1PPD A;  3WXE A;  1U9W A;  2AYN A;  4DMY A;  1MEM A;  1YK7 A;  1CJL A;  3LXS A;  1QXP A;  1AU4 A;  2WBF X;  2R9F A;  3CH2 X;  3HWN A;  4PP2 E;  5CHV A;  1Y4H A;  2DJF B;  1PIP A;  4BS6 A;  2FT2 A;  2FRA A;  2H7J A;  2DC7 A;  2PAD A;  2HD5 A;  3PDF A;  3MHH A;  3WXG A;  4AXL A;  3PBH A;  3P5V A;  4HWY A;  1QOL A;  2G6D A;  4W5C A;  1DEU A;  4YYS A;  1NB5 A;  3QT4 A;  4YYR A;  1VJV A;  4RY2 A;  5K16 A;  1AYU A;  3K8U A;  4CDD B;  4AXM A;  2DCD A;  1ATK A;  1ME3 A;  4DMX A;  1ICF A;  1IWD A;  2R9C A;  4W4U A;  3OVX A;  5CVM A;  4WA6 A;  2FQ9 A;  1TL9 A;  2XU1 A;  1NQC A;  2DJG B;  1KHP A;  5F02 A;  2HXZ A;  4CDF B;  1QDQ A;  4CZW A;  1Y08 A;  2E02 A;  1QMY A;  4YV8 A;  2AUX A;  1TLO A;  2YJ8 A;  4Q8H A;  2IBI A;  1YT7 A;  3D6S A;  2XU4 A;  2FUD A;  3BWK A;  4N8W A;  4YYW A;  4KLB A;  3E1Z B;  4K7C A;  3P5X A;  3V6E A;  1MIR A;  1NL6 A;  1STF E;  3HHA A;  1CTE A;  2DC6 A;  2JQF R;  2PNS A;  2ATO A;  2VHF A;  3OVZ A;  2O6X A;  2FRQ A;  2DZZ A;  2OZ2 A;  2G8J A;  1AU2 A;  4P6G A;  5CHT A;  4QH6 A;  2G7Y A;  4OEL A;  3KKU A;  3KW9 A;  1ITO A;  5A24 A;  2HHN A;  1PBH A;  3MTN A;  3K9M A;  2HH5 A;  4BSQ A;  1YVB A;  3O1G A;  2R9M A;  3TNX A;  2F1G A;  4CDC B;  3OIS A;  3RVW A;  5EGW A;  2CB5 A;  3U8E A;  4I04 A;  1CVZ A;  2AYO A;  2CIO A;  5FPW A;  1PPO A;  4X6J A;  9PAP A;  2DC9 A;  1EWL A;  3ZUA A;  2BDL A;  3MHS A;  1POP A;  4PAD A;  4W5B A;  1PPP A;  2PRE A;  3P5W A;  4PP1 A;  2DZY A;  2YJ2 A;  1SP4 B;  1HUC B;  1MS6 A;  1EF7 A;  1CV8 A;  5CVN B;  8PCH A;  3CBK A;  2FTD A;  3KSE A;  4MSX A;  2DCB A;  3H7D A;  1CPJ A;  5J94 A;  3K24 A;  2XU3 A;  2AVW A;  3BOW A;  3IHP A;  1KFU L;  3BPM A;  1BP4 A;  3HD3 A;  6PAD A;  1XKG A;  2E01 A;  2E00 A;  1F2C A;  2YJ9 A;  4N4Z A;  2XU5 A;  3BPF A;  5PAD A;  1CS8 A;  3H89 A;  2OP3 A;  1PE6 A;  3NHE A;  4P6E A;  2G8E A;  2GFO A;  2AS8 A;  4XR7 A;  3IMA A;  3GCB A;  4FIP A;  2R6N A;  1VSN A;  3KWB X;  3N3G A;  1AU3 A;  2GHU A;  4QRX A;  1F2A A;  2IPP B;  1X9Y A;  3DF0 A;  4QRG A;  2DCC A;  3CBJ A;  3F5V A;  2F7D A;  1MDW A;  4I07 A;  1YAL A;  1ME4 A;  3B79 A;  1TU6 A;  1F29 A;  3S3Q A;  2P7U A;  3F75 A;  2C0Y A;  5JH3 A;  4XUI A;  3RVX A; 
#chains in the Genus database with same CATH topology
 4MZO A;  3LFY A;  1AIM A;  1DKI A;  3IEJ A;  1U9V A;  3TRK A;  2B1N A;  3KFQ A;  2AGA A;  3AI8 A;  1UKF A;  5CVO B;  1U9X A;  2NQD B;  3H8C A;  1CB5 A;  3ZNH A;  1FH0 A;  3MOR A;  3PW3 A;  2NQA A;  3P5U A;  4GUA A;  4BOZ A;  1K3B B;  3IV2 A;  2J7Q C;  3PRM A;  4IUM A;  1U5I A;  2DC8 A;  5EF4 A;  1KXR A;  4X6I A;  3V6C A;  3I06 A;  1GEC E;  4N79 A;  4REZ A;  1EWP A;  1BGO A;  4ZUX U;  4Q8G A;  4YVA A;  4CDE B;  5JA7 A;  3M99 A;  2NQI A;  4BS5 A;  2JRI A;  3OF9 A;  1MEG A;  1EWO A;  2FYE A;  3HHI A;  1AYW A;  3WXF A;  2YJC A;  2B1M A;  4G54 A;  2NQG A;  3BC3 A;  3KX1 A;  2JQG R;  1GMY A;  2Z84 A;  2HWK A;  1MHW A;  3IFU A;  1PXV A;  4OW0 A;  4RF0 A;  4X6H A;  1S4V A;  2AU1 A;  4FJC A;  2PBH A;  1KFX L;  2Y6E A;  3C9E A;  3KWZ A;  4YYQ A;  1AEC A;  3S3R A;  7PCK A;  1KHQ A;  4PI3 A;  2BDZ A;  4MI7 A;  1A6R A;  2P0R A;  4MZS A;  1NLJ A;  1ZCM A;  4BPV A;  4BQV A;  5EZQ A;  4FK5 A;  3W30 A;  1NB3 A;  2DCA A;  1GLO A;  1BQI A;  1PAD A;  1CSB B;  1BY8 A;  1PCI A;  3ERV A;  3QSD A;  2FO5 A;  1EWM A;  2E03 A;  2DOS A;  3O0U A;  1NPZ A;  2ACT A;  2OUL A;  2AUZ A;  2UZJ A;  2R9N A;  1ZIV A;  2ARY A;  4QRV A;  3H6S A;  1THE A;  2VHS A;  3H8B A;  1DF0 A;  3USV A;  2Y5B A;  2JTC A;  1F2B A;  3PHU A;  3CH3 X;  4OEM A;  1AU0 A;  3OQC A;  2AIM A;  3RNV A;  1CQD A;  1AYV A;  1PPN A;  3OF8 A;  1U9Q X;  2P86 A;  3IOQ A;  2YJB A;  3N3K A;  3C0R A;  4D8B A;  3PT2 A;  3QJ3 A;  4YYV A;  3IUT A;  1JQP A;  3N4C A;  4R3D A;  3BCN A;  4I05 A;  1SNK A;  5JZE A;  2R9O A;  1O0E A;  1YK8 A;  3I3T A;  3RVV A;  4YYU A;  5KO3 A;  1GCB A;  1Q6K A;  3PNR A;  4QBB A;  1M6D A;  1PPD A;  3WXE A;  1U9W A;  2AYN A;  5EZS A;  4DMY A;  1MEM A;  1YK7 A;  1CJL A;  3LXS A;  1QXP A;  1AU4 A;  3PRP A;  2WBF X;  4BOU A;  1YZB A;  2R9F A;  4RKX A;  3CH2 X;  3HWN A;  4PP2 E;  5CHV A;  1Y4H A;  2DJF B;  1PIP A;  4BS6 A;  2FT2 A;  2FRA A;  2H7J A;  2DC7 A;  2PAD A;  2HD5 A;  3PDF A;  3MHH A;  3WXG A;  4AXL A;  3PBH A;  3P5V A;  4HWY A;  1QOL A;  2G6D A;  4W5C A;  1DEU A;  2BU3 A;  4YYS A;  3BB7 A;  1NB5 A;  3QT4 A;  4YYR A;  1VJV A;  2FE8 A;  4RY2 A;  5K16 A;  1AYU A;  3K8U A;  4A5U A;  4CDD B;  4AXM A;  4BOQ A;  2J7Q A;  2DCD A;  4OVZ A;  1ATK A;  1ME3 A;  4DMX A;  1ICF A;  1IWD A;  2R9C A;  4W4U A;  3OVX A;  5CVM A;  4WA6 A;  2FQ9 A;  1TL9 A;  2XU1 A;  1NQC A;  2DJG B;  1KHP A;  5F02 A;  2HXZ A;  4BOS A;  4CDF B;  1QDQ A;  4CZW A;  1Y08 A;  2E02 A;  1QMY A;  4YV8 A;  4WUR A;  2AUX A;  1TLO A;  2YJ8 A;  4Q8H A;  2IBI A;  4BOP A;  1YT7 A;  3D6S A;  2XU4 A;  2FUD A;  3BWK A;  4N8W A;  4YYW A;  4KLB A;  3E1Z B;  4K7C A;  3P5X A;  3V6E A;  4PT5 A;  3HHA A;  1MIR A;  1NL6 A;  1STF E;  4MM3 B;  1CTE A;  2DC6 A;  2JQF R;  3W31 A;  2PNS A;  2ATO A;  2VHF A;  3OVZ A;  2O6X A;  2FRQ A;  2DZZ A;  2OZ2 A;  2G8J A;  1AU2 A;  4P6G A;  5CHT A;  2BTW B;  4QH6 A;  2G7Y A;  4OEL A;  3KKU A;  3KW9 A;  1ITO A;  5A24 A;  2HHN A;  1PBH A;  4IP3 A;  3MTN A;  3K9M A;  2HH5 A;  4BSQ A;  1YVB A;  3O1G A;  2R9M A;  3TNX A;  2F1G A;  4CDC B;  3OIS A;  5E6J A;  3RVW A;  4RNA A;  1PVJ A;  5EGW A;  2CB5 A;  3U8E A;  4XZX A;  4I04 A;  1CVZ A;  2AYO A;  2CIO A;  5FPW A;  1PPO A;  3BY4 A;  4X6J A;  9PAP A;  2DC9 A;  3B21 A;  3BBA A;  1EWL A;  3PSE A;  3ZUA A;  2BDL A;  3MHS A;  1POP A;  4PAD A;  4W5B A;  4D8I A;  1PPP A;  2PRE A;  3P5W A;  4PP1 A;  2DZY A;  2YJ2 A;  1SP4 B;  1HUC B;  1MS6 A;  1EF7 A;  1CV8 A;  4ZTB A;  5CVN B;  8PCH A;  3CBK A;  2FTD A;  3KSE A;  4MSX A;  3MJ5 A;  2DCB A;  3O65 A;  3H7D A;  1CPJ A;  5J94 A;  3K24 A;  2XU3 A;  2AVW A;  3BOW A;  3IHP A;  3TMP A;  4HXD B;  4D8E A;  1KFU L;  3BPM A;  1BP4 A;  3HD3 A;  6PAD A;  1XKG A;  2E01 A;  2E00 A;  1F2C A;  4N4Z A;  2YJ9 A;  2XU5 A;  4P16 A;  3E9S A;  3BPF A;  5PAD A;  1CS8 A;  3H89 A;  2OP3 A;  1PE6 A;  3NHE A;  4P6E A;  4RF1 A;  2G8E A;  2GFO A;  2AS8 A;  4XR7 A;  3IMA A;  3GCB A;  4FIP A;  2R6N A;  1VSN A;  3KWB X;  3N3G A;  1AU3 A;  2GHU A;  4QRX A;  1F2A A;  2IPP B;  1X9Y A;  3DF0 A;  4QRG A;  2DCC A;  3CBJ A;  3F5V A;  2F7D A;  1MDW A;  4I07 A;  1YAL A;  3PHW A;  1ME4 A;  3B79 A;  4OVZ B;  2BTW A;  1TU6 A;  3PHX A;  1F29 A;  3S3Q A;  2P7U A;  3F75 A;  3MP2 A;  3MTV A;  4M0W A;  2C0Y A;  5JH3 A;  4XUI A;  3RVX A; 
#chains in the Genus database with same CATH homology
 4MZO A;  3LFY A;  1AIM A;  3IEJ A;  1U9V A;  2B1N A;  3KFQ A;  3AI8 A;  5CVO B;  1U9X A;  2NQD B;  3H8C A;  1CB5 A;  1FH0 A;  3MOR A;  3PW3 A;  2NQA A;  3P5U A;  1K3B B;  3IV2 A;  1U5I A;  2DC8 A;  5EF4 A;  1KXR A;  4X6I A;  3V6C A;  3I06 A;  1GEC E;  4N79 A;  4GUZ A;  1EWP A;  1BGO A;  4ZUX U;  4Q8G A;  4YVA A;  4CDE B;  5JA7 A;  3M99 A;  2NQI A;  4BS5 A;  3OF9 A;  4NV7 A;  1MEG A;  1EWO A;  2FYE A;  3HHI A;  1AYW A;  3WXF A;  2YJC A;  2B1M A;  4G54 A;  2NQG A;  3BC3 A;  3KX1 A;  2JQG R;  1GMY A;  1MHW A;  1PXV A;  4X6H A;  1S4V A;  2AU1 A;  4FJC A;  2PBH A;  1KFX L;  2Y6E A;  3C9E A;  3KWZ A;  4YYQ A;  1AEC A;  3S3R A;  7PCK A;  1KHQ A;  4PI3 A;  2BDZ A;  1A6R A;  2P0R A;  4MZS A;  1NLJ A;  1ZCM A;  4BPV A;  4BQV A;  4FK5 A;  1NB3 A;  2DCA A;  1GLO A;  1BQI A;  1PAD A;  2VFC A;  1CSB B;  1BY8 A;  1PCI A;  3ERV A;  3QSD A;  2FO5 A;  1EWM A;  2E03 A;  3O0U A;  1NPZ A;  2ACT A;  2OUL A;  2AUZ A;  2R9N A;  1ZIV A;  2ARY A;  4QRV A;  3H6S A;  1THE A;  2VHS A;  3H8B A;  1DF0 A;  3USV A;  2Y5B A;  1F2B A;  3CH3 X;  1W4T A;  4OEM A;  1AU0 A;  2AIM A;  1CQD A;  1AYV A;  1PPN A;  3OF8 A;  1U9Q X;  2P86 A;  3IOQ A;  2YJB A;  3N3K A;  1W6F A;  3QJ3 A;  4YYV A;  3IUT A;  1JQP A;  3N4C A;  3BCN A;  4I05 A;  1SNK A;  2R9O A;  1O0E A;  1YK8 A;  3I3T A;  3RVV A;  4YYU A;  1GCB A;  1Q6K A;  3PNR A;  4QBB A;  1M6D A;  1PPD A;  3WXE A;  1U9W A;  2AYN A;  4DMY A;  1MEM A;  1YK7 A;  1CJL A;  3LXS A;  1QXP A;  1AU4 A;  2WBF X;  2R9F A;  3CH2 X;  3HWN A;  4PP2 E;  5CHV A;  1Y4H A;  2DJF B;  1PIP A;  4BS6 A;  2FT2 A;  2FRA A;  2H7J A;  2DC7 A;  2PAD A;  2HD5 A;  3PDF A;  3MHH A;  3WXG A;  4AXL A;  3PBH A;  3P5V A;  4HWY A;  1QOL A;  2G6D A;  4W5C A;  1DEU A;  4YYS A;  1NB5 A;  3QT4 A;  4YYR A;  1VJV A;  4RY2 A;  5K16 A;  1AYU A;  3K8U A;  4CDD B;  4AXM A;  2DCD A;  1ATK A;  1ME3 A;  4C5P A;  1ICF A;  4DMX A;  1IWD A;  2R9C A;  4W4U A;  3OVX A;  3LTW A;  5CVM A;  4WA6 A;  2FQ9 A;  1TL9 A;  2XU1 A;  1NQC A;  2DJG B;  1KHP A;  5F02 A;  2HXZ A;  4CDF B;  1QDQ A;  4CZW A;  1Y08 A;  1E2T A;  2E02 A;  1QMY A;  4YV8 A;  2AUX A;  1TLO A;  2YJ8 A;  4Q8H A;  2IBI A;  1YT7 A;  3D6S A;  2XU4 A;  2FUD A;  3BWK A;  4N8W A;  4YYW A;  4KLB A;  3E1Z B;  4K7C A;  3P5X A;  2BSZ A;  3V6E A;  1MIR A;  1NL6 A;  1STF E;  3HHA A;  1CTE A;  2DC6 A;  2JQF R;  2PNS A;  2ATO A;  2VHF A;  3OVZ A;  2O6X A;  2FRQ A;  2DZZ A;  2OZ2 A;  2G8J A;  1AU2 A;  4P6G A;  5CHT A;  4QH6 A;  2G7Y A;  4OEL A;  3KKU A;  3KW9 A;  1ITO A;  5A24 A;  2HHN A;  1PBH A;  3MTN A;  3K9M A;  2HH5 A;  4BSQ A;  1YVB A;  3O1G A;  2R9M A;  3TNX A;  2F1G A;  4CDC B;  3OIS A;  4B55 A;  3RVW A;  5EGW A;  2CB5 A;  3U8E A;  3D9W A;  4I04 A;  1CVZ A;  2AYO A;  2CIO A;  5FPW A;  1PPO A;  4X6J A;  9PAP A;  2DC9 A;  4BGF A;  1EWL A;  3ZUA A;  2BDL A;  3MHS A;  1POP A;  4PAD A;  4W5B A;  1PPP A;  2PRE A;  3P5W A;  4PP1 A;  2DZY A;  2YJ2 A;  1SP4 B;  1HUC B;  1GX3 A;  1MS6 A;  1EF7 A;  1CV8 A;  5CVN B;  8PCH A;  3CBK A;  2FTD A;  3KSE A;  4MSX A;  2VFB A;  2DCB A;  3H7D A;  1CPJ A;  5J94 A;  3K24 A;  2XU3 A;  2AVW A;  3BOW A;  3IHP A;  1KFU L;  3BPM A;  1BP4 A;  3HD3 A;  6PAD A;  1XKG A;  2E01 A;  2E00 A;  1F2C A;  2YJ9 A;  4N4Z A;  2XU5 A;  3BPF A;  5PAD A;  1CS8 A;  3H89 A;  2OP3 A;  1PE6 A;  3NHE A;  4P6E A;  2G8E A;  2GFO A;  2AS8 A;  4XR7 A;  3IMA A;  4NV8 A;  3GCB A;  4FIP A;  2R6N A;  1VSN A;  3KWB X;  3N3G A;  1AU3 A;  2GHU A;  1W5R A;  4QRX A;  1F2A A;  2IPP B;  1X9Y A;  3DF0 A;  4QRG A;  2DCC A;  3CBJ A;  3F5V A;  2F7D A;  1MDW A;  4I07 A;  1YAL A;  1ME4 A;  3B79 A;  1TU6 A;  1F29 A;  3S3Q A;  2P7U A;  3F75 A;  2C0Y A;  5JH3 A;  4XUI A;  3RVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...