2JQFR

Full length leader protease of foot and mouth disease virus c51a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain o1)
molecule tags Viral protein
molecule keywords Genome polyprotein
total genus 30
structure length 166
sequence length 173
chains with identical sequence S
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2jqfR00
4W4UA 2ACTA 2FO5A 4I05A 1SP4B 1NQCA 3N3KA 1KHQA 2NQIA 2R6NA 2F1GA 2GFOA 2DC7A 3H89A 1O0EA 1YT7A 1HUCB 4KLBA 3OVZA 3B79A 3P5XA 3H8BA 3PDFA 1F2AA 3KKUA 1Q6KA 2DJGB 4HWYA 4PI3A 5CHVA 7PCKA 2DCCA 1AU4A 1GCBA 1DEUA 2YJ9A 3P5VA 4YYQA 4I04A 3WXGA 1K3BB 1DF0A 4X6JA 1CSBB 1AYVA 1TU6A 2FRAA 2G8JA 1YK7A 2IBIA 3QJ3A 1CVZA 2XU5A 4MSXA 3IOQA 3RVVA 1NPZA 2AS8A 3MORA 3H6SA 1QMYA 2XU1A 2B1MA 1XKGA 1U5IA 4XUIA 3V6EA 3DF0A 2HD5A 2DZYA 1STFE 4QRXA 2CIOA 4DMYA 1CB5A 4YVAA 4N79A 4K7CA 3TNXA 2FTDA 9PAPA 2DJFB 3IV2A 2FYEA 2R9FA 2E03A 2NQDB 1NLJA 3PBHA 4YV8A 1F2CA 3KSEA 3OVXA 4BPVA 1TLOA 2XU4A 4BS6A 3KFQA 4PADA 1S4VA 1CQDA 2E02A 2PBHA 2PNSA 3K24A 2P86A 2WBFX 1PPDA 1EWMA 4I07A 2HXZA 1CPJA 4X6HA 2AYNA 1MHWA 2OP3A 3CH3X 1CV8A 1EWPA 1YALA 2AVWA 3I06A 2F7DA 4AXMA 1F29A 2PADA 2Y6EA 2IPPB 1PADA 4W5CA 3BPMA 1EWOA 2AUXA 5PADA 2DC8A 2R9CA 2BDLA 4CDDB 1VSNA 3KW9A 1YK8A 1M6DA 3GCBA 2Y5BA 1PCIA 4BSQA 1PPNA 1QDQA 3CH2X 3MTNA 3S3RA 3CBJA 2YJCA 1U9WA 2H7JA 3H8CA 4QRVA 4QBBA 2R9NA 4QH6A 1EF7A 1U9QX 1MIRA 2G8EA 3CBKA 2HH5A 1PPPA 4P6EA 1PBHA 4MZOA 5F02A 2PREA 2B1NA 1X9YA 3E1ZB 2G7YA 3P5WA 1ATKA 2GHUA 3QSDA 3M99A 3IMAA 4WA6A 2E00A 1MEGA 3ZUAA 2OULA 1CJLA 1PPOA 2O6XA 4YYSA 2ATOA 3N3GA 2C0YA 1FH0A 3ERVA 5K16A 3U8EA 2OZ2A 1AU0A 4W5BA 1POPA 3QT4A 2AYOA 4CZWA 2YJBA 1AU3A 1KFXL 4G54A 4FK5A 3PW3A 2DCAA 4CDFB 1U9VA 2ARYA 4OEMA 3BWKA 4AXLA 2P0RA 5J94A 3WXEA 1NL6A 2HHNA 3USVA 5CHTA 1AYWA 2G6DA 1KFUL 3BPFA 1PE6A 1ME4A 2E01A 3RVWA 3IEJA 3I3TA 4FJCA 2DZZA 4YYUA 4FIPA 1A6RA 4OELA 1JQPA 4PP2E 3KWZA 3WXFA 5FPWA 2P7UA 3F75A 1KXRA 3PNRA 5EGWA 3IUTA 2YJ2A 1VJVA 3NHEA 4QRGA 1GLOA 3BOWA 3OF9A 3KWBX 1PXVA 4BQVA 2BDZA 2CB5A 5CVMA 6PADA 5JH3A 2AU1A 3S3QA 4MZSA 3BC3A 4N4ZA 2AUZA 1AYUA 1AIMA 4YYVA 2FQ9A 3HHIA 4ZUXU 2DCDA 2FRQA 4XR7A 4P6GA 3BCNA 2DC9A 4Q8HA 3K8UA 1CTEA 2DC6A 4DMXA 1THEA 4CDCB 1BGOA 2JQFR 3LFYA 3N4CA 3O1GA 4PP1A 1TL9A 1BQIA 3MHHA 1GECE 2JQGR 3KX1A 1ICFA 1Y4HA 3O0UA 3K9MA 8PCHA 2VHFA 1NB3A 1MEMA 3C9EA 4RY2A 3IHPA 1CS8A 1MDWA 4X6IA 1Y08A 1KHPA 2NQGA 2FUDA 3AI8A 1F2BA 2R9OA 1ZCMA 3H7DA 3V6CA 3F5VA 4YYWA 4BS5A 1SNKA 4CDEB 5CVNB 1AECA 1MS6A 1PIPA 3HHAA 4Q8GA 5CVOB 1EWLA 5A24A 1BP4A 3RVXA 4YYRA 5EF4A 1GMYA 1NB5A 1IWDA 1AU2A 3OF8A 3HD3A 2FT2A 2XU3A 2DCBA 3HWNA 2AIMA 3OISA 1ZIVA 3MHSA 2VHSA 4N8WA 5JA7A 2R9MA 1YVBA 1ME3A 1ITOA 3LXSA 1U9XA 1QOLA 2YJ8A 1BY8A 3P5UA 1QXPA 2NQAA 3D6SA
chains in the Genus database with same CATH superfamily
4W4UA 2ACTA 2FO5A 2Z84A 4I05A 1SP4B 1NQCA 3W31A 3N3KA 1KHQA 2NQIA 3ZNHA 2R6NA 2F1GA 4D8IA 2GFOA 2DC7A 3H89A 1O0EA 4P16A 1YT7A 1HUCB 4RKXA 4KLBA 3OVZA 3B79A 3P5XA 3H8BA 3PDFA 1F2AA 2FE8A 3KKUA 1Q6KA 2DJGB 4HWYA 4PI3A 5CHVA 7PCKA 2DCCA 3TMPA 1AU4A 1GCBA 1DEUA 2YJ9A 3P5VA 4YYQA 4I04A 2BTWA 4HXDB 3WXGA 1K3BB 1DF0A 4X6JA 1CSBB 1AYVA 1TU6A 3E9SA 2FRAA 2G8JA 1YK7A 2IBIA 3QJ3A 1CVZA 2XU5A 4MSXA 3IOQA 3RVVA 1NPZA 2AS8A 3MORA 4BOZA 3H6SA 1QMYA 2XU1A 4GUAA 2B1MA 1XKGA 1U5IA 4XUIA 3V6EA 3DF0A 2HD5A 2DZYA 1STFE 4BOPA 4QRXA 2CIOA 4PT5A 4DMYA 1CB5A 4YVAA 4N79A 2BTWB 4K7CA 3TNXA 2FTDA 9PAPA 4A5UA 2DJFB 3IV2A 3MJ5A 4OW0A 2FYEA 2R9FA 2E03A 2NQDB 1NLJA 3PBHA 4YV8A 1F2CA 3KSEA 3OVXA 4BPVA 4RF0A 1TLOA 2XU4A 4BS6A 3KFQA 4PADA 1S4VA 3PSEA 1CQDA 2E02A 2PBHA 2PNSA 3K24A 2P86A 4M0WA 2WBFX 1PPDA 1EWMA 4I07A 2HXZA 4D8EA 1CPJA 4X6HA 2AYNA 1MHWA 2OP3A 1DKIA 4OVZA 3CH3X 1CV8A 1EWPA 1YALA 2AVWA 3I06A 2F7DA 4AXMA 1F29A 2PADA 2Y6EA 4R3DA 2IPPB 2DOSA 4ZTBA 1PADA 4W5CA 3BPMA 1EWOA 4REZA 2AUXA 5PADA 2DC8A 2R9CA 2BDLA 4CDDB 1VSNA 3KW9A 1YK8A 1M6DA 3GCBA 2Y5BA 1PCIA 4BSQA 1PPNA 1QDQA 3CH2X 3PRPA 3MTNA 3S3RA 3CBJA 2YJCA 1U9WA 2H7JA 3H8CA 4QRVA 4QBBA 2R9NA 4QH6A 1EF7A 1U9QX 1MIRA 2G8EA 3CBKA 2HH5A 3OQCA 1PPPA 4P6EA 5EZQA 1PBHA 4MZOA 5F02A 2PREA 2B1NA 4MI7A 1X9YA 3E1ZB 4BOQA 1YZBA 2G7YA 3P5WA 1ATKA 2GHUA 3QSDA 3M99A 3IMAA 4WA6A 2E00A 5JZEA 1MEGA 3ZUAA 2OULA 1CJLA 1PPOA 2O6XA 4MM3B 4YYSA 2ATOA 3N3GA 2C0YA 1FH0A 3ERVA 3IFUA 5K16A 3U8EA 2OZ2A 1AU0A 4W5BA 1POPA 3QT4A 2AYOA 4OVZB 4CZWA 2YJBA 1AU3A 1KFXL 4G54A 4FK5A 3PW3A 2DCAA 4CDFB 2J7QC 1U9VA 2ARYA 4OEMA 2J7QA 3BWKA 4AXLA 2P0RA 5J94A 3WXEA 1NL6A 2HHNA 3USVA 5CHTA 4BOSA 1AYWA 2G6DA 4XZXA 1KFUL 3BPFA 1PE6A 2AGAA 1ME4A 2E01A 3MTVA 3RVWA 3IEJA 5KO3A 3I3TA 4FJCA 4RNAA 2DZZA 4YYUA 4FIPA 1A6RA 4OELA 1JQPA 4PP2E 3KWZA 3BY4A 3WXFA 5FPWA 2P7UA 3F75A 4BOUA 1KXRA 3PNRA 5EGWA 2JRIA 3IUTA 2YJ2A 3PRMA 1VJVA 3NHEA 4QRGA 1GLOA 3BOWA 3OF9A 3KWBX 1PXVA 4BQVA 2BDZA 2CB5A 5CVMA 6PADA 5EZSA 5JH3A 3BB7A 2AU1A 3PHXA 3S3QA 4MZSA 3BC3A 3B21A 4N4ZA 2AUZA 1AYUA 1AIMA 4YYVA 2FQ9A 5E6JA 3HHIA 4ZUXU 2DCDA 2FRQA 4XR7A 4WURA 4P6GA 3BCNA 2DC9A 4Q8HA 3K8UA 1CTEA 2DC6A 4DMXA 1THEA 2BU3A 4CDCB 1BGOA 2JQFR 3LFYA 3N4CA 1UKFA 3O1GA 4PP1A 1TL9A 1BQIA 3MHHA 1GECE 2JQGR 3KX1A 3BBAA 1ICFA 1Y4HA 3O0UA 3K9MA 4RF1A 8PCHA 2VHFA 1NB3A 1MEMA 3C0RA 3C9EA 4RY2A 3TRKA 3IHPA 1CS8A 1MDWA 4X6IA 3PT2A 1Y08A 1KHPA 2NQGA 2FUDA 3AI8A 1F2BA 2R9OA 1ZCMA 3H7DA 3V6CA 3W30A 3F5VA 4YYWA 2UZJA 4BS5A 1SNKA 4CDEB 5CVNB 1AECA 4IUMA 3MP2A 2JTCA 1MS6A 4IP3A 1PIPA 3HHAA 4D8BA 4Q8GA 5CVOB 1EWLA 5A24A 1BP4A 3RVXA 4YYRA 2HWKA 5EF4A 1GMYA 1NB5A 1IWDA 1AU2A 3OF8A 3HD3A 2FT2A 2XU3A 1PVJA 2DCBA 3HWNA 2AIMA 3OISA 1ZIVA 3PHUA 3O65A 3PHWA 3MHSA 2VHSA 4N8WA 5JA7A 2R9MA 1YVBA 3RNVA 1ME3A 1ITOA 3LXSA 1U9XA 1QOLA 2YJ8A 1BY8A 3P5UA 1QXPA 2NQAA 3D6SA
chains in the Genus database with same CATH topology
4W4UA 2ACTA 2FO5A 4I05A 1SP4B 1NQCA 3N3KA 1KHQA 2NQIA 1E2TA 2R6NA 1GX3A 2F1GA 2GFOA 2DC7A 3H89A 1O0EA 1YT7A 1HUCB 4KLBA 3OVZA 3B79A 3P5XA 3H8BA 3PDFA 1F2AA 3KKUA 1Q6KA 2DJGB 4HWYA 4PI3A 5CHVA 7PCKA 2DCCA 1AU4A 1GCBA 1DEUA 2YJ9A 3P5VA 4YYQA 4I04A 3WXGA 1K3BB 1DF0A 4X6JA 1CSBB 1AYVA 1TU6A 2FRAA 2G8JA 1YK7A 2IBIA 3QJ3A 1CVZA 2XU5A 4MSXA 3IOQA 3RVVA 1NPZA 2AS8A 3MORA 3H6SA 1QMYA 2XU1A 2B1MA 1XKGA 1U5IA 4XUIA 3V6EA 3DF0A 2HD5A 2DZYA 1STFE 4QRXA 2CIOA 4B55A 4DMYA 1CB5A 4YVAA 4N79A 4K7CA 3TNXA 2FTDA 9PAPA 4NV8A 2DJFB 3IV2A 2FYEA 2R9FA 2E03A 2NQDB 1NLJA 3PBHA 4YV8A 1F2CA 3KSEA 3OVXA 4BGFA 4BPVA 1TLOA 2XU4A 4BS6A 3KFQA 4PADA 1S4VA 1CQDA 2E02A 2PBHA 1W5RA 2PNSA 3K24A 2P86A 4C5PA 2WBFX 1PPDA 1EWMA 4I07A 2HXZA 1CPJA 4X6HA 2AYNA 1MHWA 2OP3A 3CH3X 1CV8A 1EWPA 1YALA 2AVWA 3I06A 2F7DA 4AXMA 1F29A 2PADA 2Y6EA 1W6FA 2IPPB 1PADA 4W5CA 3BPMA 1EWOA 2AUXA 5PADA 2DC8A 2R9CA 2BDLA 4CDDB 3KW9A 1VSNA 1YK8A 1M6DA 3GCBA 2Y5BA 1PCIA 4BSQA 1PPNA 1QDQA 3CH2X 3MTNA 3S3RA 3CBJA 2YJCA 1U9WA 2H7JA 3H8CA 4QRVA 4QBBA 2R9NA 4QH6A 1EF7A 1U9QX 1MIRA 2G8EA 3CBKA 2HH5A 1PPPA 4P6EA 1PBHA 4MZOA 5F02A 2PREA 2B1NA 1X9YA 3E1ZB 2G7YA 3P5WA 1ATKA 2GHUA 3QSDA 3M99A 3IMAA 1W4TA 4WA6A 2E00A 1MEGA 3ZUAA 2OULA 1CJLA 1PPOA 2O6XA 4YYSA 2ATOA 3N3GA 2C0YA 1FH0A 3ERVA 5K16A 3U8EA 2OZ2A 1AU0A 4W5BA 1POPA 3QT4A 2AYOA 4CZWA 2YJBA 1AU3A 1KFXL 4G54A 4FK5A 3PW3A 2DCAA 4CDFB 1U9VA 2ARYA 4OEMA 3BWKA 4AXLA 2P0RA 5J94A 3WXEA 1NL6A 2HHNA 3USVA 5CHTA 1AYWA 2G6DA 1KFUL 3BPFA 1PE6A 1ME4A 2E01A 3RVWA 3IEJA 3I3TA 4FJCA 2DZZA 4YYUA 4FIPA 1A6RA 4OELA 1JQPA 4PP2E 3KWZA 3WXFA 5FPWA 2P7UA 3F75A 2BSZA 1KXRA 3PNRA 5EGWA 3IUTA 2YJ2A 1VJVA 3NHEA 4QRGA 1GLOA 3BOWA 3OF9A 3KWBX 1PXVA 4BQVA 2BDZA 2CB5A 5CVMA 6PADA 5JH3A 4GUZA 2AU1A 3S3QA 4MZSA 3BC3A 4N4ZA 2AUZA 1AYUA 1AIMA 4YYVA 2FQ9A 4NV7A 3HHIA 4ZUXU 2DCDA 2FRQA 4XR7A 4P6GA 3BCNA 2DC9A 4Q8HA 3K8UA 1CTEA 2DC6A 4DMXA 1THEA 4CDCB 1BGOA 2JQFR 3LFYA 3N4CA 3O1GA 4PP1A 1TL9A 1BQIA 3MHHA 1GECE 2JQGR 3KX1A 1ICFA 1Y4HA 3O0UA 3K9MA 8PCHA 2VHFA 1NB3A 1MEMA 3C9EA 4RY2A 3LTWA 3IHPA 1CS8A 1MDWA 4X6IA 1Y08A 1KHPA 2NQGA 2FUDA 3AI8A 1F2BA 2R9OA 1ZCMA 3H7DA 3V6CA 2VFCA 3F5VA 4YYWA 4BS5A 1SNKA 4CDEB 5CVNB 1AECA 1MS6A 2VFBA 1PIPA 3HHAA 4Q8GA 5CVOB 1EWLA 5A24A 1BP4A 3RVXA 4YYRA 5EF4A 1GMYA 1NB5A 1IWDA 1AU2A 3OF8A 3HD3A 2FT2A 2XU3A 2DCBA 3HWNA 2AIMA 3OISA 1ZIVA 3MHSA 2VHSA 4N8WA 5JA7A 2R9MA 1YVBA 1ME3A 1ITOA 3LXSA 1U9XA 1QOLA 2YJ8A 1BY8A 3P5UA 3D9WA 1QXPA 2NQAA 3D6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4U A;  2ACT A;  2FO5 A;  4I05 A;  1SP4 B;  1NQC A;  3N3K A;  1KHQ A;  2NQI A;  2R6N A;  2F1G A;  2GFO A;  2DC7 A;  3H89 A;  1O0E A;  1YT7 A;  1HUC B;  4KLB A;  3OVZ A;  3B79 A;  3P5X A;  3H8B A;  3PDF A;  1F2A A;  3KKU A;  1Q6K A;  2DJG B;  4HWY A;  4PI3 A;  5CHV A;  7PCK A;  2DCC A;  1AU4 A;  1GCB A;  1DEU A;  2YJ9 A;  3P5V A;  4YYQ A;  4I04 A;  3WXG A;  1K3B B;  1DF0 A;  4X6J A;  1CSB B;  1AYV A;  1TU6 A;  2FRA A;  2G8J A;  1YK7 A;  2IBI A;  3QJ3 A;  1CVZ A;  2XU5 A;  4MSX A;  3IOQ A;  3RVV A;  1NPZ A;  2AS8 A;  3MOR A;  3H6S A;  1QMY A;  2XU1 A;  2B1M A;  1XKG A;  1U5I A;  4XUI A;  3V6E A;  3DF0 A;  2HD5 A;  2DZY A;  1STF E;  4QRX A;  2CIO A;  4DMY A;  1CB5 A;  4YVA A;  4N79 A;  4K7C A;  3TNX A;  2FTD A;  9PAP A;  2DJF B;  3IV2 A;  2FYE A;  2R9F A;  2E03 A;  2NQD B;  1NLJ A;  3PBH A;  4YV8 A;  1F2C A;  3KSE A;  3OVX A;  4BPV A;  1TLO A;  2XU4 A;  4BS6 A;  3KFQ A;  4PAD A;  1S4V A;  1CQD A;  2E02 A;  2PBH A;  2PNS A;  3K24 A;  2P86 A;  2WBF X;  1PPD A;  1EWM A;  4I07 A;  2HXZ A;  1CPJ A;  4X6H A;  2AYN A;  1MHW A;  2OP3 A;  3CH3 X;  1CV8 A;  1EWP A;  1YAL A;  2AVW A;  3I06 A;  2F7D A;  4AXM A;  1F29 A;  2PAD A;  2Y6E A;  2IPP B;  1PAD A;  4W5C A;  3BPM A;  1EWO A;  2AUX A;  5PAD A;  2DC8 A;  2R9C A;  2BDL A;  4CDD B;  1VSN A;  3KW9 A;  1YK8 A;  1M6D A;  3GCB A;  2Y5B A;  1PCI A;  4BSQ A;  1PPN A;  1QDQ A;  3CH2 X;  3MTN A;  3S3R A;  3CBJ A;  2YJC A;  1U9W A;  2H7J A;  3H8C A;  4QRV A;  4QBB A;  2R9N A;  4QH6 A;  1EF7 A;  1U9Q X;  1MIR A;  2G8E A;  3CBK A;  2HH5 A;  1PPP A;  4P6E A;  1PBH A;  4MZO A;  5F02 A;  2PRE A;  2B1N A;  1X9Y A;  3E1Z B;  2G7Y A;  3P5W A;  1ATK A;  2GHU A;  3QSD A;  3M99 A;  3IMA A;  4WA6 A;  2E00 A;  1MEG A;  3ZUA A;  2OUL A;  1CJL A;  1PPO A;  2O6X A;  4YYS A;  2ATO A;  3N3G A;  2C0Y A;  1FH0 A;  3ERV A;  5K16 A;  3U8E A;  2OZ2 A;  1AU0 A;  4W5B A;  1POP A;  3QT4 A;  2AYO A;  4CZW A;  2YJB A;  1AU3 A;  1KFX L;  4G54 A;  4FK5 A;  3PW3 A;  2DCA A;  4CDF B;  1U9V A;  2ARY A;  4OEM A;  3BWK A;  4AXL A;  2P0R A;  5J94 A;  3WXE A;  1NL6 A;  2HHN A;  3USV A;  5CHT A;  1AYW A;  2G6D A;  1KFU L;  3BPF A;  1PE6 A;  1ME4 A;  2E01 A;  3RVW A;  3IEJ A;  3I3T A;  4FJC A;  2DZZ A;  4YYU A;  4FIP A;  1A6R A;  4OEL A;  1JQP A;  4PP2 E;  3KWZ A;  3WXF A;  5FPW A;  2P7U A;  3F75 A;  1KXR A;  3PNR A;  5EGW A;  3IUT A;  2YJ2 A;  1VJV A;  3NHE A;  4QRG A;  1GLO A;  3BOW A;  3OF9 A;  3KWB X;  1PXV A;  4BQV A;  2BDZ A;  2CB5 A;  5CVM A;  6PAD A;  5JH3 A;  2AU1 A;  3S3Q A;  4MZS A;  3BC3 A;  4N4Z A;  2AUZ A;  1AYU A;  1AIM A;  4YYV A;  2FQ9 A;  3HHI A;  4ZUX U;  2DCD A;  2FRQ A;  4XR7 A;  4P6G A;  3BCN A;  2DC9 A;  4Q8H A;  3K8U A;  1CTE A;  2DC6 A;  4DMX A;  1THE A;  4CDC B;  1BGO A;  2JQF R;  3LFY A;  3N4C A;  3O1G A;  4PP1 A;  1TL9 A;  1BQI A;  3MHH A;  1GEC E;  2JQG R;  3KX1 A;  1ICF A;  1Y4H A;  3O0U A;  3K9M A;  8PCH A;  2VHF A;  1NB3 A;  1MEM A;  3C9E A;  4RY2 A;  3IHP A;  1CS8 A;  1MDW A;  4X6I A;  1Y08 A;  1KHP A;  2NQG A;  2FUD A;  3AI8 A;  1F2B A;  2R9O A;  1ZCM A;  3H7D A;  3V6C A;  3F5V A;  4YYW A;  4BS5 A;  1SNK A;  4CDE B;  5CVN B;  1AEC A;  1MS6 A;  1PIP A;  3HHA A;  4Q8G A;  5CVO B;  1EWL A;  5A24 A;  1BP4 A;  3RVX A;  4YYR A;  5EF4 A;  1GMY A;  1NB5 A;  1IWD A;  1AU2 A;  3OF8 A;  3HD3 A;  2FT2 A;  2XU3 A;  2DCB A;  3HWN A;  2AIM A;  3OIS A;  1ZIV A;  3MHS A;  2VHS A;  4N8W A;  5JA7 A;  2R9M A;  1YVB A;  1ME3 A;  1ITO A;  3LXS A;  1U9X A;  1QOL A;  2YJ8 A;  1BY8 A;  3P5U A;  1QXP A;  2NQA A;  3D6S A; 
#chains in the Genus database with same CATH topology
 4W4U A;  2ACT A;  2FO5 A;  2Z84 A;  4I05 A;  1SP4 B;  1NQC A;  3W31 A;  3N3K A;  1KHQ A;  2NQI A;  3ZNH A;  2R6N A;  2F1G A;  4D8I A;  2GFO A;  2DC7 A;  3H89 A;  1O0E A;  4P16 A;  1YT7 A;  1HUC B;  4RKX A;  4KLB A;  3OVZ A;  3B79 A;  3P5X A;  3H8B A;  3PDF A;  1F2A A;  2FE8 A;  3KKU A;  1Q6K A;  2DJG B;  4HWY A;  4PI3 A;  5CHV A;  7PCK A;  2DCC A;  3TMP A;  1AU4 A;  1GCB A;  1DEU A;  2YJ9 A;  3P5V A;  4YYQ A;  4I04 A;  2BTW A;  4HXD B;  3WXG A;  1K3B B;  1DF0 A;  4X6J A;  1CSB B;  1AYV A;  1TU6 A;  3E9S A;  2FRA A;  2G8J A;  1YK7 A;  2IBI A;  3QJ3 A;  1CVZ A;  2XU5 A;  4MSX A;  3IOQ A;  3RVV A;  1NPZ A;  2AS8 A;  3MOR A;  4BOZ A;  3H6S A;  1QMY A;  2XU1 A;  4GUA A;  2B1M A;  1XKG A;  1U5I A;  4XUI A;  3V6E A;  3DF0 A;  2HD5 A;  2DZY A;  1STF E;  4BOP A;  4QRX A;  2CIO A;  4PT5 A;  4DMY A;  1CB5 A;  4YVA A;  4N79 A;  2BTW B;  4K7C A;  3TNX A;  2FTD A;  9PAP A;  4A5U A;  2DJF B;  3IV2 A;  3MJ5 A;  4OW0 A;  2FYE A;  2R9F A;  2E03 A;  2NQD B;  1NLJ A;  3PBH A;  4YV8 A;  1F2C A;  3KSE A;  3OVX A;  4BPV A;  4RF0 A;  1TLO A;  2XU4 A;  4BS6 A;  3KFQ A;  4PAD A;  1S4V A;  3PSE A;  1CQD A;  2E02 A;  2PBH A;  2PNS A;  3K24 A;  2P86 A;  4M0W A;  2WBF X;  1PPD A;  1EWM A;  4I07 A;  2HXZ A;  4D8E A;  1CPJ A;  4X6H A;  2AYN A;  1MHW A;  2OP3 A;  1DKI A;  4OVZ A;  3CH3 X;  1CV8 A;  1EWP A;  1YAL A;  2AVW A;  3I06 A;  2F7D A;  4AXM A;  1F29 A;  2PAD A;  2Y6E A;  4R3D A;  2IPP B;  2DOS A;  4ZTB A;  1PAD A;  4W5C A;  3BPM A;  1EWO A;  4REZ A;  2AUX A;  5PAD A;  2DC8 A;  2R9C A;  2BDL A;  4CDD B;  1VSN A;  3KW9 A;  1YK8 A;  1M6D A;  3GCB A;  2Y5B A;  1PCI A;  4BSQ A;  1PPN A;  1QDQ A;  3CH2 X;  3PRP A;  3MTN A;  3S3R A;  3CBJ A;  2YJC A;  1U9W A;  2H7J A;  3H8C A;  4QRV A;  4QBB A;  2R9N A;  4QH6 A;  1EF7 A;  1U9Q X;  1MIR A;  2G8E A;  3CBK A;  2HH5 A;  3OQC A;  1PPP A;  4P6E A;  5EZQ A;  1PBH A;  4MZO A;  5F02 A;  2PRE A;  2B1N A;  4MI7 A;  1X9Y A;  3E1Z B;  4BOQ A;  1YZB A;  2G7Y A;  3P5W A;  1ATK A;  2GHU A;  3QSD A;  3M99 A;  3IMA A;  4WA6 A;  2E00 A;  5JZE A;  1MEG A;  3ZUA A;  2OUL A;  1CJL A;  1PPO A;  2O6X A;  4MM3 B;  4YYS A;  2ATO A;  3N3G A;  2C0Y A;  1FH0 A;  3ERV A;  3IFU A;  5K16 A;  3U8E A;  2OZ2 A;  1AU0 A;  4W5B A;  1POP A;  3QT4 A;  2AYO A;  4OVZ B;  4CZW A;  2YJB A;  1AU3 A;  1KFX L;  4G54 A;  4FK5 A;  3PW3 A;  2DCA A;  4CDF B;  2J7Q C;  1U9V A;  2ARY A;  4OEM A;  2J7Q A;  3BWK A;  4AXL A;  2P0R A;  5J94 A;  3WXE A;  1NL6 A;  2HHN A;  3USV A;  5CHT A;  4BOS A;  1AYW A;  2G6D A;  4XZX A;  1KFU L;  3BPF A;  1PE6 A;  2AGA A;  1ME4 A;  2E01 A;  3MTV A;  3RVW A;  3IEJ A;  5KO3 A;  3I3T A;  4FJC A;  4RNA A;  2DZZ A;  4YYU A;  4FIP A;  1A6R A;  4OEL A;  1JQP A;  4PP2 E;  3KWZ A;  3BY4 A;  3WXF A;  5FPW A;  2P7U A;  3F75 A;  4BOU A;  1KXR A;  3PNR A;  5EGW A;  2JRI A;  3IUT A;  2YJ2 A;  3PRM A;  1VJV A;  3NHE A;  4QRG A;  1GLO A;  3BOW A;  3OF9 A;  3KWB X;  1PXV A;  4BQV A;  2BDZ A;  2CB5 A;  5CVM A;  6PAD A;  5EZS A;  5JH3 A;  3BB7 A;  2AU1 A;  3PHX A;  3S3Q A;  4MZS A;  3BC3 A;  3B21 A;  4N4Z A;  2AUZ A;  1AYU A;  1AIM A;  4YYV A;  2FQ9 A;  5E6J A;  3HHI A;  4ZUX U;  2DCD A;  2FRQ A;  4XR7 A;  4WUR A;  4P6G A;  3BCN A;  2DC9 A;  4Q8H A;  3K8U A;  1CTE A;  2DC6 A;  4DMX A;  1THE A;  2BU3 A;  4CDC B;  1BGO A;  2JQF R;  3LFY A;  3N4C A;  1UKF A;  3O1G A;  4PP1 A;  1TL9 A;  1BQI A;  3MHH A;  1GEC E;  2JQG R;  3KX1 A;  3BBA A;  1ICF A;  1Y4H A;  3O0U A;  3K9M A;  4RF1 A;  8PCH A;  2VHF A;  1NB3 A;  1MEM A;  3C0R A;  3C9E A;  4RY2 A;  3TRK A;  3IHP A;  1CS8 A;  1MDW A;  4X6I A;  3PT2 A;  1Y08 A;  1KHP A;  2NQG A;  2FUD A;  3AI8 A;  1F2B A;  2R9O A;  1ZCM A;  3H7D A;  3V6C A;  3W30 A;  3F5V A;  4YYW A;  2UZJ A;  4BS5 A;  1SNK A;  4CDE B;  5CVN B;  1AEC A;  4IUM A;  3MP2 A;  2JTC A;  1MS6 A;  4IP3 A;  1PIP A;  3HHA A;  4D8B A;  4Q8G A;  5CVO B;  1EWL A;  5A24 A;  1BP4 A;  3RVX A;  4YYR A;  2HWK A;  5EF4 A;  1GMY A;  1NB5 A;  1IWD A;  1AU2 A;  3OF8 A;  3HD3 A;  2FT2 A;  2XU3 A;  1PVJ A;  2DCB A;  3HWN A;  2AIM A;  3OIS A;  1ZIV A;  3PHU A;  3O65 A;  3PHW A;  3MHS A;  2VHS A;  4N8W A;  5JA7 A;  2R9M A;  1YVB A;  3RNV A;  1ME3 A;  1ITO A;  3LXS A;  1U9X A;  1QOL A;  2YJ8 A;  1BY8 A;  3P5U A;  1QXP A;  2NQA A;  3D6S A; 
#chains in the Genus database with same CATH homology
 4W4U A;  2ACT A;  2FO5 A;  4I05 A;  1SP4 B;  1NQC A;  3N3K A;  1KHQ A;  2NQI A;  1E2T A;  2R6N A;  1GX3 A;  2F1G A;  2GFO A;  2DC7 A;  3H89 A;  1O0E A;  1YT7 A;  1HUC B;  4KLB A;  3OVZ A;  3B79 A;  3P5X A;  3H8B A;  3PDF A;  1F2A A;  3KKU A;  1Q6K A;  2DJG B;  4HWY A;  4PI3 A;  5CHV A;  7PCK A;  2DCC A;  1AU4 A;  1GCB A;  1DEU A;  2YJ9 A;  3P5V A;  4YYQ A;  4I04 A;  3WXG A;  1K3B B;  1DF0 A;  4X6J A;  1CSB B;  1AYV A;  1TU6 A;  2FRA A;  2G8J A;  1YK7 A;  2IBI A;  3QJ3 A;  1CVZ A;  2XU5 A;  4MSX A;  3IOQ A;  3RVV A;  1NPZ A;  2AS8 A;  3MOR A;  3H6S A;  1QMY A;  2XU1 A;  2B1M A;  1XKG A;  1U5I A;  4XUI A;  3V6E A;  3DF0 A;  2HD5 A;  2DZY A;  1STF E;  4QRX A;  2CIO A;  4B55 A;  4DMY A;  1CB5 A;  4YVA A;  4N79 A;  4K7C A;  3TNX A;  2FTD A;  9PAP A;  4NV8 A;  2DJF B;  3IV2 A;  2FYE A;  2R9F A;  2E03 A;  2NQD B;  1NLJ A;  3PBH A;  4YV8 A;  1F2C A;  3KSE A;  3OVX A;  4BGF A;  4BPV A;  1TLO A;  2XU4 A;  4BS6 A;  3KFQ A;  4PAD A;  1S4V A;  1CQD A;  2E02 A;  2PBH A;  1W5R A;  2PNS A;  3K24 A;  2P86 A;  4C5P A;  2WBF X;  1PPD A;  1EWM A;  4I07 A;  2HXZ A;  1CPJ A;  4X6H A;  2AYN A;  1MHW A;  2OP3 A;  3CH3 X;  1CV8 A;  1EWP A;  1YAL A;  2AVW A;  3I06 A;  2F7D A;  4AXM A;  1F29 A;  2PAD A;  2Y6E A;  1W6F A;  2IPP B;  1PAD A;  4W5C A;  3BPM A;  1EWO A;  2AUX A;  5PAD A;  2DC8 A;  2R9C A;  2BDL A;  4CDD B;  3KW9 A;  1VSN A;  1YK8 A;  1M6D A;  3GCB A;  2Y5B A;  1PCI A;  4BSQ A;  1PPN A;  1QDQ A;  3CH2 X;  3MTN A;  3S3R A;  3CBJ A;  2YJC A;  1U9W A;  2H7J A;  3H8C A;  4QRV A;  4QBB A;  2R9N A;  4QH6 A;  1EF7 A;  1U9Q X;  1MIR A;  2G8E A;  3CBK A;  2HH5 A;  1PPP A;  4P6E A;  1PBH A;  4MZO A;  5F02 A;  2PRE A;  2B1N A;  1X9Y A;  3E1Z B;  2G7Y A;  3P5W A;  1ATK A;  2GHU A;  3QSD A;  3M99 A;  3IMA A;  1W4T A;  4WA6 A;  2E00 A;  1MEG A;  3ZUA A;  2OUL A;  1CJL A;  1PPO A;  2O6X A;  4YYS A;  2ATO A;  3N3G A;  2C0Y A;  1FH0 A;  3ERV A;  5K16 A;  3U8E A;  2OZ2 A;  1AU0 A;  4W5B A;  1POP A;  3QT4 A;  2AYO A;  4CZW A;  2YJB A;  1AU3 A;  1KFX L;  4G54 A;  4FK5 A;  3PW3 A;  2DCA A;  4CDF B;  1U9V A;  2ARY A;  4OEM A;  3BWK A;  4AXL A;  2P0R A;  5J94 A;  3WXE A;  1NL6 A;  2HHN A;  3USV A;  5CHT A;  1AYW A;  2G6D A;  1KFU L;  3BPF A;  1PE6 A;  1ME4 A;  2E01 A;  3RVW A;  3IEJ A;  3I3T A;  4FJC A;  2DZZ A;  4YYU A;  4FIP A;  1A6R A;  4OEL A;  1JQP A;  4PP2 E;  3KWZ A;  3WXF A;  5FPW A;  2P7U A;  3F75 A;  2BSZ A;  1KXR A;  3PNR A;  5EGW A;  3IUT A;  2YJ2 A;  1VJV A;  3NHE A;  4QRG A;  1GLO A;  3BOW A;  3OF9 A;  3KWB X;  1PXV A;  4BQV A;  2BDZ A;  2CB5 A;  5CVM A;  6PAD A;  5JH3 A;  4GUZ A;  2AU1 A;  3S3Q A;  4MZS A;  3BC3 A;  4N4Z A;  2AUZ A;  1AYU A;  1AIM A;  4YYV A;  2FQ9 A;  4NV7 A;  3HHI A;  4ZUX U;  2DCD A;  2FRQ A;  4XR7 A;  4P6G A;  3BCN A;  2DC9 A;  4Q8H A;  3K8U A;  1CTE A;  2DC6 A;  4DMX A;  1THE A;  4CDC B;  1BGO A;  2JQF R;  3LFY A;  3N4C A;  3O1G A;  4PP1 A;  1TL9 A;  1BQI A;  3MHH A;  1GEC E;  2JQG R;  3KX1 A;  1ICF A;  1Y4H A;  3O0U A;  3K9M A;  8PCH A;  2VHF A;  1NB3 A;  1MEM A;  3C9E A;  4RY2 A;  3LTW A;  3IHP A;  1CS8 A;  1MDW A;  4X6I A;  1Y08 A;  1KHP A;  2NQG A;  2FUD A;  3AI8 A;  1F2B A;  2R9O A;  1ZCM A;  3H7D A;  3V6C A;  2VFC A;  3F5V A;  4YYW A;  4BS5 A;  1SNK A;  4CDE B;  5CVN B;  1AEC A;  1MS6 A;  2VFB A;  1PIP A;  3HHA A;  4Q8G A;  5CVO B;  1EWL A;  5A24 A;  1BP4 A;  3RVX A;  4YYR A;  5EF4 A;  1GMY A;  1NB5 A;  1IWD A;  1AU2 A;  3OF8 A;  3HD3 A;  2FT2 A;  2XU3 A;  2DCB A;  3HWN A;  2AIM A;  3OIS A;  1ZIV A;  3MHS A;  2VHS A;  4N8W A;  5JA7 A;  2R9M A;  1YVB A;  1ME3 A;  1ITO A;  3LXS A;  1U9X A;  1QOL A;  2YJ8 A;  1BY8 A;  3P5U A;  3D9W A;  1QXP A;  2NQA A;  3D6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...