2JQFR

Full length leader protease of foot and mouth disease virus c51a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Genome polyprotein
publication title Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain o1)
total genus 30
structure length 166
sequence length 173
chains with identical sequence S
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2jqfR00
4OEMA 3KWZA 5F02A 3IOQA 4BS5A 3D6SA 1NL6A 4Q8HA 1CTEA 1CVZA 2WBFX 1THEA 3N3KA 3OVZA 1U9VA 2R9NA 4X6JA 3BWKA 4YYUA 1S4VA 4YYRA 3I3TA 1QXPA 4BPVA 2VHSA 1EF7A 8PCHA 1AU3A 2DCBA 2GFOA 3QJ3A 3PBHA 2PNSA 6PADA 4FJCA 2R9OA 3OF8A 1VJVA 1YK7A 4K7CA 4I04A 1BQIA 1NPZA 2CIOA 2FRQA 2AUZA 1KXRA 4W4UA 2C0YA 4W5BA 4N79A 1YVBA 4FIPA 1YK8A 1ZIVA 1ICFA 3O0UA 1GCBA 1YT7A 1MEMA 3AI8A 2FUDA 2E03A 1CB5A 1ATKA 1U9XA 2R9CA 4XR7A 1SNKA 4QRVA 1HUCB 1EWLA 3NHEA 1ITOA 3ERVA 3QSDA 1BY8A 2OZ2A 2E01A 1PIPA 1Y08A 3B79A 4N4ZA 3MTNA 4WA6A 4P6GA 1PE6A 3LXSA 4HWYA 3KX1A 1FH0A 3WXEA 3F75A 4ZUXU 5FPWA 1PBHA 1F29A 3F5VA 3OISA 4XUIA 2HH5A 2YJ2A 3U8EA 1X9YA 3H8CA 3N4CA 2P7UA 2ARYA 3QT4A 4YYSA 5JH3A 1GLOA 2NQGA 3HHAA 2GHUA 2DC8A 4PADA 3IV2A 1ME4A 2XU5A 1KFUL 1U5IA 1VSNA 2HXZA 3BC3A 3MHSA 2YJ9A 3CBJA 4RY2A 3E1ZB 2AVWA 2XU3A 4MZOA 1TL9A 5CVMA 2DCCA 1Y4HA 3RVVA 2FO5A 4P6EA 1GECE 4QRXA 4CDDB 3USVA 1EWMA 2DCDA 2JQGR 3IMAA 3PDFA 2ACTA 1SP4B 1AU4A 3PNRA 1F2AA 1GMYA 3K8UA 2DJGB 9PAPA 2O6XA 2DC9A 4QRGA 3MHHA 1QDQA 2B1NA 1F2CA 2BDZA 3M99A 1CPJA 3HWNA 4CDEB 1CS8A 5CVNB 2IBIA 1EWOA 3CH2X 1TLOA 1NQCA 2PADA 4X6HA 2XU1A 1NLJA 2FQ9A 1DF0A 4CZWA 1PCIA 2R9FA 2IPPB 3GCBA 4DMXA 1STFE 5A24A 2NQDB 1MEGA 1JQPA 1DEUA 4KLBA 5CVOB 1CSBB 3IUTA 1AU2A 1AYVA 3KW9A 3V6EA 1MIRA 4QH6A 4YVAA 2R6NA 4AXLA 4AXMA 1ZCMA 2G8EA 3K9MA 2PREA 2AYNA 3BPMA 3S3RA 1NB3A 3KFQA 3TNXA 1O0EA 2P0RA 3O1GA 3V6CA 2JQFR 3P5WA 2PBHA 3BOWA 4YYWA 2AS8A 2XU4A 1NB5A 2DJFB 2YJBA 1AYUA 2DZZA 2HD5A 3OVXA 3P5XA 2FYEA 4CDCB 1CQDA 2F7DA 1CV8A 1TU6A 3N3GA 1Q6KA 1XKGA 1AYWA 1BP4A 3IHPA 1F2BA 7PCKA 1BGOA 1QOLA 3H6SA 5EGWA 2G6DA 4I07A 4MSXA 2B1MA 2NQAA 3P5UA 5K16A 2E02A 2OULA 3WXGA 2OP3A 1MDWA 2FTDA 3IEJA 5CHTA 4W5CA 1MHWA 5EF4A 1EWPA 2G8JA 2AIMA 2Y6EA 2YJ8A 3OF9A 2DC6A 4MZSA 3H7DA 3K24A 2NQIA 4Q8GA 3HHIA 2DZYA 2CB5A 2H7JA 1AIMA 4DMYA 1ME3A 3CH3X 4PI3A 1IWDA 4YYVA 2E00A 3LFYA 4BS6A 2Y5BA 1PPDA 1CJLA 3H89A 2F1GA 1MS6A 4BSQA 4X6IA 2YJCA 4PP2E 1AECA 2DCAA 3WXFA 1QMYA 1POPA 4PP1A 3RVXA 3DF0A 3I06A 1U9QX 3PW3A 4CDFB 2BDLA 3BCNA 3KSEA 2P86A 1PPNA 3MORA 4OELA 1PADA 1KHPA 1YALA 3KKUA 1PPOA 4QBBA 4YYQA 4I05A 2G7YA 3P5VA 1U9WA 5CHVA 2R9MA 1M6DA 3KWBX 1A6RA 5J94A 2AUXA 4BQVA 2DC7A 1KHQA 2AU1A 3C9EA 3BPFA 2FT2A 4FK5A 4G54A 2ATOA 3S3QA 1AU0A 3H8BA 3RVWA 3CBKA 2FRAA 1K3BB 2HHNA 1KFXL 1PPPA 3HD3A 2VHFA 5PADA 4N8WA 4YV8A 5JA7A 3ZUAA 2AYOA 1PXVA
chains in the Genus database with same CATH superfamily
4OEMA 3KWZA 5F02A 4OVZB 3TRKA 3IOQA 4BS5A 5EZQA 3D6SA 1NL6A 4Q8HA 1CTEA 1CVZA 2WBFX 1THEA 3N3KA 3OVZA 3PRPA 1U9VA 3PHXA 2R9NA 2DOSA 4X6JA 3BWKA 4YYUA 2BU3A 1S4VA 4YYRA 4RF0A 3I3TA 1QXPA 4BPVA 2VHSA 3TMPA 1EF7A 8PCHA 1AU3A 4RKXA 4BOQA 2DCBA 2GFOA 4BOZA 3QJ3A 3PBHA 2PNSA 2JTCA 6PADA 4FJCA 3BB7A 2R9OA 1YZBA 3OF8A 1VJVA 4HXDB 1YK7A 4K7CA 4I04A 1BQIA 1NPZA 2CIOA 2FRQA 4M0WA 2AUZA 1KXRA 2FE8A 4W4UA 2C0YA 4W5BA 4N79A 1YVBA 4FIPA 1YK8A 4D8BA 1ZIVA 3ZNHA 1PVJA 1ICFA 3O0UA 2HWKA 1GCBA 1YT7A 1MEMA 3AI8A 2FUDA 2E03A 4OVZA 1CB5A 1ATKA 1U9XA 2R9CA 4XR7A 1SNKA 4QRVA 1HUCB 1EWLA 3NHEA 1ITOA 3ERVA 3QSDA 4GUAA 1BY8A 2OZ2A 2E01A 3OQCA 1PIPA 1Y08A 3B79A 4N4ZA 3MTNA 4WA6A 3O65A 4P6GA 1PE6A 3LXSA 4HWYA 4D8IA 3KX1A 1FH0A 3WXEA 3F75A 3MP2A 4PT5A 5FPWA 4ZUXU 3PRMA 1PBHA 1F29A 3F5VA 3OISA 5E6JA 4BOPA 5EZSA 4XUIA 2HH5A 2YJ2A 3U8EA 1X9YA 4D8EA 3H8CA 3N4CA 2P7UA 2ARYA 3QT4A 4YYSA 5JH3A 1GLOA 2NQGA 3PHWA 3HHAA 2GHUA 2DC8A 4PADA 3IV2A 1ME4A 2XU5A 1KFUL 1U5IA 1VSNA 3MHSA 2HXZA 3BC3A 2YJ9A 3CBJA 4RY2A 3E1ZB 2AVWA 4R3DA 2XU3A 4MZOA 1TL9A 5CVMA 3RNVA 2DCCA 1Y4HA 3RVVA 2FO5A 4P6EA 1GECE 4QRXA 4CDDB 3USVA 1EWMA 2DCDA 2JQGR 3IMAA 3PDFA 2ACTA 1SP4B 1AU4A 3PHUA 3PNRA 1F2AA 1GMYA 3K8UA 2DJGB 9PAPA 2O6XA 2DC9A 2UZJA 4QRGA 3MHHA 1QDQA 2B1NA 1F2CA 2BDZA 3M99A 1CPJA 3HWNA 4CDEB 1CS8A 5CVNB 2IBIA 1EWOA 3CH2X 2BTWA 2J7QA 1UKFA 1TLOA 1NQCA 2PADA 4X6HA 2XU1A 1NLJA 2FQ9A 1DF0A 4CZWA 1PCIA 2R9FA 2IPPB 4IUMA 3GCBA 4DMXA 1STFE 5A24A 2NQDB 1MEGA 1JQPA 1DEUA 4KLBA 4OW0A 5CVOB 1CSBB 4WURA 3IUTA 1AU2A 1AYVA 3KW9A 3V6EA 1MIRA 4QH6A 3IFUA 4YVAA 2R6NA 4AXLA 4AXMA 1ZCMA 2G8EA 3K9MA 2PREA 2AYNA 3E9SA 3BPMA 3S3RA 1NB3A 3KFQA 3TNXA 1O0EA 2P0RA 3O1GA 3C0RA 3V6CA 2JQFR 2BTWB 3P5WA 2PBHA 4P16A 3BOWA 4YYWA 2AS8A 2XU4A 1NB5A 2DJFB 2YJBA 1AYUA 2DZZA 2HD5A 3OVXA 3P5XA 2FYEA 4CDCB 1CQDA 2F7DA 1CV8A 1TU6A 2Z84A 3N3GA 1Q6KA 1XKGA 2AGAA 1AYWA 1BP4A 4MI7A 3IHPA 1F2BA 3W31A 7PCKA 1BGOA 4BOSA 1QOLA 3H6SA 5EGWA 4RNAA 2G6DA 4I07A 4MSXA 2B1MA 2NQAA 3P5UA 5K16A 2E02A 2OULA 3WXGA 2OP3A 4A5UA 1MDWA 2FTDA 3IEJA 5CHTA 4W5CA 1MHWA 5EF4A 1EWPA 2G8JA 2AIMA 2Y6EA 2YJ8A 3OF9A 2DC6A 4MZSA 3H7DA 3K24A 2NQIA 4Q8GA 3HHIA 2DZYA 2CB5A 2H7JA 1AIMA 4DMYA 1ME3A 3W30A 4IP3A 3CH3X 4PI3A 5JZEA 1IWDA 4YYVA 2J7QC 2E00A 3LFYA 4BS6A 2Y5BA 1PPDA 1CJLA 3H89A 2F1GA 1MS6A 5KO3A 4BSQA 4X6IA 1DKIA 4REZA 2YJCA 4PP2E 1AECA 2DCAA 3WXFA 1QMYA 1POPA 4PP1A 3RVXA 3DF0A 3I06A 1U9QX 3PW3A 4CDFB 2BDLA 3BCNA 3KSEA 2P86A 1PPNA 3MORA 4OELA 3BBAA 1PADA 1KHPA 3MTVA 1YALA 3KKUA 1PPOA 3PSEA 4MM3B 4QBBA 4YYQA 4I05A 4BOUA 2G7YA 3P5VA 1U9WA 5CHVA 2R9MA 1M6DA 3KWBX 1A6RA 5J94A 2AUXA 4BQVA 3BY4A 4XZXA 2DC7A 1KHQA 2AU1A 4RF1A 3C9EA 2JRIA 3BPFA 2FT2A 4FK5A 4G54A 2ATOA 3PT2A 3S3QA 1AU0A 3B21A 3H8BA 3MJ5A 3RVWA 3CBKA 2FRAA 1K3BB 4ZTBA 2HHNA 1KFXL 1PPPA 3HD3A 2VHFA 5PADA 4N8WA 4YV8A 5JA7A 3ZUAA 2AYOA 1PXVA
chains in the Genus database with same CATH topology
4OEMA 3KWZA 5F02A 3IOQA 4BS5A 3D9WA 3D6SA 1NL6A 4Q8HA 1CTEA 1CVZA 2WBFX 1THEA 3N3KA 3OVZA 1U9VA 2R9NA 4X6JA 3BWKA 4YYUA 1S4VA 4YYRA 3I3TA 1QXPA 4BPVA 2VHSA 1EF7A 8PCHA 1AU3A 2DCBA 2GFOA 3QJ3A 3PBHA 2PNSA 6PADA 4FJCA 2R9OA 3OF8A 1VJVA 1YK7A 4K7CA 4I04A 1BQIA 1NPZA 2CIOA 1W4TA 2FRQA 2AUZA 1KXRA 4W4UA 2C0YA 4W5BA 4N79A 1YVBA 4C5PA 4FIPA 1YK8A 1ZIVA 1ICFA 3O0UA 1W6FA 1GCBA 1YT7A 1MEMA 3AI8A 2FUDA 2E03A 1CB5A 1ATKA 1U9XA 2R9CA 4XR7A 1SNKA 4QRVA 1HUCB 1EWLA 3NHEA 1ITOA 3ERVA 3QSDA 1BY8A 2OZ2A 2E01A 4NV8A 1PIPA 1Y08A 3B79A 4N4ZA 3MTNA 4WA6A 4P6GA 1PE6A 3LXSA 4HWYA 3KX1A 1FH0A 3WXEA 3F75A 4ZUXU 5FPWA 1PBHA 1F29A 3F5VA 3OISA 4XUIA 2HH5A 2YJ2A 3U8EA 1X9YA 3H8CA 3N4CA 2P7UA 3LTWA 2ARYA 3QT4A 4YYSA 5JH3A 1GLOA 2NQGA 3HHAA 2GHUA 2DC8A 4PADA 3IV2A 1ME4A 2XU5A 1KFUL 1U5IA 1VSNA 2HXZA 3BC3A 3MHSA 2YJ9A 3CBJA 4RY2A 3E1ZB 2AVWA 2XU3A 4MZOA 1TL9A 5CVMA 2DCCA 1Y4HA 3RVVA 2FO5A 4P6EA 1GECE 4QRXA 4CDDB 3USVA 1EWMA 2DCDA 2JQGR 3IMAA 3PDFA 2ACTA 1SP4B 1AU4A 3PNRA 1F2AA 1GMYA 3K8UA 2DJGB 9PAPA 2O6XA 2VFCA 2DC9A 4QRGA 3MHHA 1QDQA 2B1NA 1F2CA 2BDZA 3M99A 1CPJA 3HWNA 4CDEB 1CS8A 5CVNB 2IBIA 1EWOA 3CH2X 1TLOA 1NQCA 2PADA 4X6HA 2XU1A 1NLJA 2FQ9A 1DF0A 4CZWA 1PCIA 2R9FA 2IPPB 1E2TA 3GCBA 4DMXA 1STFE 5A24A 2NQDB 1MEGA 4BGFA 1JQPA 1DEUA 4KLBA 5CVOB 1CSBB 3IUTA 1AU2A 1AYVA 3KW9A 3V6EA 1MIRA 4QH6A 4YVAA 2R6NA 4AXLA 4AXMA 1ZCMA 2G8EA 3K9MA 2PREA 2AYNA 4GUZA 3BPMA 3S3RA 1NB3A 3KFQA 3TNXA 1O0EA 2P0RA 3O1GA 3V6CA 2JQFR 3P5WA 2PBHA 3BOWA 4YYWA 2AS8A 2XU4A 1NB5A 2DJFB 4NV7A 2YJBA 1AYUA 2HD5A 2DZZA 3OVXA 1GX3A 3P5XA 2FYEA 4CDCB 1CQDA 2F7DA 1CV8A 1TU6A 2VFBA 3N3GA 1Q6KA 1XKGA 1AYWA 1BP4A 3IHPA 1F2BA 7PCKA 1BGOA 1QOLA 3H6SA 2BSZA 5EGWA 2G6DA 4I07A 4MSXA 2B1MA 2NQAA 3P5UA 5K16A 2E02A 2OULA 3WXGA 2OP3A 1MDWA 2FTDA 3IEJA 5CHTA 4W5CA 1MHWA 5EF4A 1EWPA 2G8JA 2AIMA 2Y6EA 2YJ8A 3OF9A 2DC6A 4MZSA 3H7DA 3K24A 2NQIA 4Q8GA 3HHIA 2DZYA 2CB5A 2H7JA 1AIMA 4DMYA 1ME3A 3CH3X 4PI3A 1IWDA 4YYVA 2E00A 3LFYA 4BS6A 2Y5BA 1PPDA 1CJLA 3H89A 2F1GA 1MS6A 4BSQA 4X6IA 2YJCA 4PP2E 1AECA 2DCAA 3WXFA 1QMYA 1POPA 4PP1A 3RVXA 3DF0A 3I06A 1U9QX 3PW3A 4CDFB 2BDLA 3BCNA 3KSEA 2P86A 1PPNA 3MORA 4B55A 4OELA 1PADA 1KHPA 1YALA 3KKUA 1PPOA 4QBBA 4YYQA 4I05A 2G7YA 3P5VA 1U9WA 5CHVA 2R9MA 1M6DA 3KWBX 1A6RA 5J94A 2AUXA 4BQVA 2DC7A 1KHQA 2AU1A 3C9EA 3BPFA 2FT2A 4FK5A 4G54A 2ATOA 3S3QA 1AU0A 3H8BA 1W5RA 3RVWA 3CBKA 2FRAA 1K3BB 2HHNA 1KFXL 1PPPA 3HD3A 2VHFA 5PADA 4N8WA 4YV8A 5JA7A 3ZUAA 2AYOA 1PXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEM A;  3KWZ A;  5F02 A;  3IOQ A;  4BS5 A;  3D6S A;  1NL6 A;  4Q8H A;  1CTE A;  1CVZ A;  2WBF X;  1THE A;  3N3K A;  3OVZ A;  1U9V A;  2R9N A;  4X6J A;  3BWK A;  4YYU A;  1S4V A;  4YYR A;  3I3T A;  1QXP A;  4BPV A;  2VHS A;  1EF7 A;  8PCH A;  1AU3 A;  2DCB A;  2GFO A;  3QJ3 A;  3PBH A;  2PNS A;  6PAD A;  4FJC A;  2R9O A;  3OF8 A;  1VJV A;  1YK7 A;  4K7C A;  4I04 A;  1BQI A;  1NPZ A;  2CIO A;  2FRQ A;  2AUZ A;  1KXR A;  4W4U A;  2C0Y A;  4W5B A;  4N79 A;  1YVB A;  4FIP A;  1YK8 A;  1ZIV A;  1ICF A;  3O0U A;  1GCB A;  1YT7 A;  1MEM A;  3AI8 A;  2FUD A;  2E03 A;  1CB5 A;  1ATK A;  1U9X A;  2R9C A;  4XR7 A;  1SNK A;  4QRV A;  1HUC B;  1EWL A;  3NHE A;  1ITO A;  3ERV A;  3QSD A;  1BY8 A;  2OZ2 A;  2E01 A;  1PIP A;  1Y08 A;  3B79 A;  4N4Z A;  3MTN A;  4WA6 A;  4P6G A;  1PE6 A;  3LXS A;  4HWY A;  3KX1 A;  1FH0 A;  3WXE A;  3F75 A;  4ZUX U;  5FPW A;  1PBH A;  1F29 A;  3F5V A;  3OIS A;  4XUI A;  2HH5 A;  2YJ2 A;  3U8E A;  1X9Y A;  3H8C A;  3N4C A;  2P7U A;  2ARY A;  3QT4 A;  4YYS A;  5JH3 A;  1GLO A;  2NQG A;  3HHA A;  2GHU A;  2DC8 A;  4PAD A;  3IV2 A;  1ME4 A;  2XU5 A;  1KFU L;  1U5I A;  1VSN A;  2HXZ A;  3BC3 A;  3MHS A;  2YJ9 A;  3CBJ A;  4RY2 A;  3E1Z B;  2AVW A;  2XU3 A;  4MZO A;  1TL9 A;  5CVM A;  2DCC A;  1Y4H A;  3RVV A;  2FO5 A;  4P6E A;  1GEC E;  4QRX A;  4CDD B;  3USV A;  1EWM A;  2DCD A;  2JQG R;  3IMA A;  3PDF A;  2ACT A;  1SP4 B;  1AU4 A;  3PNR A;  1F2A A;  1GMY A;  3K8U A;  2DJG B;  9PAP A;  2O6X A;  2DC9 A;  4QRG A;  3MHH A;  1QDQ A;  2B1N A;  1F2C A;  2BDZ A;  3M99 A;  1CPJ A;  3HWN A;  4CDE B;  1CS8 A;  5CVN B;  2IBI A;  1EWO A;  3CH2 X;  1TLO A;  1NQC A;  2PAD A;  4X6H A;  2XU1 A;  1NLJ A;  2FQ9 A;  1DF0 A;  4CZW A;  1PCI A;  2R9F A;  2IPP B;  3GCB A;  4DMX A;  1STF E;  5A24 A;  2NQD B;  1MEG A;  1JQP A;  1DEU A;  4KLB A;  5CVO B;  1CSB B;  3IUT A;  1AU2 A;  1AYV A;  3KW9 A;  3V6E A;  1MIR A;  4QH6 A;  4YVA A;  2R6N A;  4AXL A;  4AXM A;  1ZCM A;  2G8E A;  3K9M A;  2PRE A;  2AYN A;  3BPM A;  3S3R A;  1NB3 A;  3KFQ A;  3TNX A;  1O0E A;  2P0R A;  3O1G A;  3V6C A;  2JQF R;  3P5W A;  2PBH A;  3BOW A;  4YYW A;  2AS8 A;  2XU4 A;  1NB5 A;  2DJF B;  2YJB A;  1AYU A;  2DZZ A;  2HD5 A;  3OVX A;  3P5X A;  2FYE A;  4CDC B;  1CQD A;  2F7D A;  1CV8 A;  1TU6 A;  3N3G A;  1Q6K A;  1XKG A;  1AYW A;  1BP4 A;  3IHP A;  1F2B A;  7PCK A;  1BGO A;  1QOL A;  3H6S A;  5EGW A;  2G6D A;  4I07 A;  4MSX A;  2B1M A;  2NQA A;  3P5U A;  5K16 A;  2E02 A;  2OUL A;  3WXG A;  2OP3 A;  1MDW A;  2FTD A;  3IEJ A;  5CHT A;  4W5C A;  1MHW A;  5EF4 A;  1EWP A;  2G8J A;  2AIM A;  2Y6E A;  2YJ8 A;  3OF9 A;  2DC6 A;  4MZS A;  3H7D A;  3K24 A;  2NQI A;  4Q8G A;  3HHI A;  2DZY A;  2CB5 A;  2H7J A;  1AIM A;  4DMY A;  1ME3 A;  3CH3 X;  4PI3 A;  1IWD A;  4YYV A;  2E00 A;  3LFY A;  4BS6 A;  2Y5B A;  1PPD A;  1CJL A;  3H89 A;  2F1G A;  1MS6 A;  4BSQ A;  4X6I A;  2YJC A;  4PP2 E;  1AEC A;  2DCA A;  3WXF A;  1QMY A;  1POP A;  4PP1 A;  3RVX A;  3DF0 A;  3I06 A;  1U9Q X;  3PW3 A;  4CDF B;  2BDL A;  3BCN A;  3KSE A;  2P86 A;  1PPN A;  3MOR A;  4OEL A;  1PAD A;  1KHP A;  1YAL A;  3KKU A;  1PPO A;  4QBB A;  4YYQ A;  4I05 A;  2G7Y A;  3P5V A;  1U9W A;  5CHV A;  2R9M A;  1M6D A;  3KWB X;  1A6R A;  5J94 A;  2AUX A;  4BQV A;  2DC7 A;  1KHQ A;  2AU1 A;  3C9E A;  3BPF A;  2FT2 A;  4FK5 A;  4G54 A;  2ATO A;  3S3Q A;  1AU0 A;  3H8B A;  3RVW A;  3CBK A;  2FRA A;  1K3B B;  2HHN A;  1KFX L;  1PPP A;  3HD3 A;  2VHF A;  5PAD A;  4N8W A;  4YV8 A;  5JA7 A;  3ZUA A;  2AYO A;  1PXV A; 
#chains in the Genus database with same CATH topology
 4OEM A;  3KWZ A;  5F02 A;  4OVZ B;  3TRK A;  3IOQ A;  4BS5 A;  5EZQ A;  3D6S A;  1NL6 A;  4Q8H A;  1CTE A;  1CVZ A;  2WBF X;  1THE A;  3N3K A;  3OVZ A;  3PRP A;  1U9V A;  3PHX A;  2R9N A;  2DOS A;  4X6J A;  3BWK A;  4YYU A;  2BU3 A;  1S4V A;  4YYR A;  4RF0 A;  3I3T A;  1QXP A;  4BPV A;  2VHS A;  3TMP A;  1EF7 A;  8PCH A;  1AU3 A;  4RKX A;  4BOQ A;  2DCB A;  2GFO A;  4BOZ A;  3QJ3 A;  3PBH A;  2PNS A;  2JTC A;  6PAD A;  4FJC A;  3BB7 A;  2R9O A;  1YZB A;  3OF8 A;  1VJV A;  4HXD B;  1YK7 A;  4K7C A;  4I04 A;  1BQI A;  1NPZ A;  2CIO A;  2FRQ A;  4M0W A;  2AUZ A;  1KXR A;  2FE8 A;  4W4U A;  2C0Y A;  4W5B A;  4N79 A;  1YVB A;  4FIP A;  1YK8 A;  4D8B A;  1ZIV A;  3ZNH A;  1PVJ A;  1ICF A;  3O0U A;  2HWK A;  1GCB A;  1YT7 A;  1MEM A;  3AI8 A;  2FUD A;  2E03 A;  4OVZ A;  1CB5 A;  1ATK A;  1U9X A;  2R9C A;  4XR7 A;  1SNK A;  4QRV A;  1HUC B;  1EWL A;  3NHE A;  1ITO A;  3ERV A;  3QSD A;  4GUA A;  1BY8 A;  2OZ2 A;  2E01 A;  3OQC A;  1PIP A;  1Y08 A;  3B79 A;  4N4Z A;  3MTN A;  4WA6 A;  3O65 A;  4P6G A;  1PE6 A;  3LXS A;  4HWY A;  4D8I A;  3KX1 A;  1FH0 A;  3WXE A;  3F75 A;  3MP2 A;  4PT5 A;  5FPW A;  4ZUX U;  3PRM A;  1PBH A;  1F29 A;  3F5V A;  3OIS A;  5E6J A;  4BOP A;  5EZS A;  4XUI A;  2HH5 A;  2YJ2 A;  3U8E A;  1X9Y A;  4D8E A;  3H8C A;  3N4C A;  2P7U A;  2ARY A;  3QT4 A;  4YYS A;  5JH3 A;  1GLO A;  2NQG A;  3PHW A;  3HHA A;  2GHU A;  2DC8 A;  4PAD A;  3IV2 A;  1ME4 A;  2XU5 A;  1KFU L;  1U5I A;  1VSN A;  3MHS A;  2HXZ A;  3BC3 A;  2YJ9 A;  3CBJ A;  4RY2 A;  3E1Z B;  2AVW A;  4R3D A;  2XU3 A;  4MZO A;  1TL9 A;  5CVM A;  3RNV A;  2DCC A;  1Y4H A;  3RVV A;  2FO5 A;  4P6E A;  1GEC E;  4QRX A;  4CDD B;  3USV A;  1EWM A;  2DCD A;  2JQG R;  3IMA A;  3PDF A;  2ACT A;  1SP4 B;  1AU4 A;  3PHU A;  3PNR A;  1F2A A;  1GMY A;  3K8U A;  2DJG B;  9PAP A;  2O6X A;  2DC9 A;  2UZJ A;  4QRG A;  3MHH A;  1QDQ A;  2B1N A;  1F2C A;  2BDZ A;  3M99 A;  1CPJ A;  3HWN A;  4CDE B;  1CS8 A;  5CVN B;  2IBI A;  1EWO A;  3CH2 X;  2BTW A;  2J7Q A;  1UKF A;  1TLO A;  1NQC A;  2PAD A;  4X6H A;  2XU1 A;  1NLJ A;  2FQ9 A;  1DF0 A;  4CZW A;  1PCI A;  2R9F A;  2IPP B;  4IUM A;  3GCB A;  4DMX A;  1STF E;  5A24 A;  2NQD B;  1MEG A;  1JQP A;  1DEU A;  4KLB A;  4OW0 A;  5CVO B;  1CSB B;  4WUR A;  3IUT A;  1AU2 A;  1AYV A;  3KW9 A;  3V6E A;  1MIR A;  4QH6 A;  3IFU A;  4YVA A;  2R6N A;  4AXL A;  4AXM A;  1ZCM A;  2G8E A;  3K9M A;  2PRE A;  2AYN A;  3E9S A;  3BPM A;  3S3R A;  1NB3 A;  3KFQ A;  3TNX A;  1O0E A;  2P0R A;  3O1G A;  3C0R A;  3V6C A;  2JQF R;  2BTW B;  3P5W A;  2PBH A;  4P16 A;  3BOW A;  4YYW A;  2AS8 A;  2XU4 A;  1NB5 A;  2DJF B;  2YJB A;  1AYU A;  2DZZ A;  2HD5 A;  3OVX A;  3P5X A;  2FYE A;  4CDC B;  1CQD A;  2F7D A;  1CV8 A;  1TU6 A;  2Z84 A;  3N3G A;  1Q6K A;  1XKG A;  2AGA A;  1AYW A;  1BP4 A;  4MI7 A;  3IHP A;  1F2B A;  3W31 A;  7PCK A;  1BGO A;  4BOS A;  1QOL A;  3H6S A;  5EGW A;  4RNA A;  2G6D A;  4I07 A;  4MSX A;  2B1M A;  2NQA A;  3P5U A;  5K16 A;  2E02 A;  2OUL A;  3WXG A;  2OP3 A;  4A5U A;  1MDW A;  2FTD A;  3IEJ A;  5CHT A;  4W5C A;  1MHW A;  5EF4 A;  1EWP A;  2G8J A;  2AIM A;  2Y6E A;  2YJ8 A;  3OF9 A;  2DC6 A;  4MZS A;  3H7D A;  3K24 A;  2NQI A;  4Q8G A;  3HHI A;  2DZY A;  2CB5 A;  2H7J A;  1AIM A;  4DMY A;  1ME3 A;  3W30 A;  4IP3 A;  3CH3 X;  4PI3 A;  5JZE A;  1IWD A;  4YYV A;  2J7Q C;  2E00 A;  3LFY A;  4BS6 A;  2Y5B A;  1PPD A;  1CJL A;  3H89 A;  2F1G A;  1MS6 A;  5KO3 A;  4BSQ A;  4X6I A;  1DKI A;  4REZ A;  2YJC A;  4PP2 E;  1AEC A;  2DCA A;  3WXF A;  1QMY A;  1POP A;  4PP1 A;  3RVX A;  3DF0 A;  3I06 A;  1U9Q X;  3PW3 A;  4CDF B;  2BDL A;  3BCN A;  3KSE A;  2P86 A;  1PPN A;  3MOR A;  4OEL A;  3BBA A;  1PAD A;  1KHP A;  3MTV A;  1YAL A;  3KKU A;  1PPO A;  3PSE A;  4MM3 B;  4QBB A;  4YYQ A;  4I05 A;  4BOU A;  2G7Y A;  3P5V A;  1U9W A;  5CHV A;  2R9M A;  1M6D A;  3KWB X;  1A6R A;  5J94 A;  2AUX A;  4BQV A;  3BY4 A;  4XZX A;  2DC7 A;  1KHQ A;  2AU1 A;  4RF1 A;  3C9E A;  2JRI A;  3BPF A;  2FT2 A;  4FK5 A;  4G54 A;  2ATO A;  3PT2 A;  3S3Q A;  1AU0 A;  3B21 A;  3H8B A;  3MJ5 A;  3RVW A;  3CBK A;  2FRA A;  1K3B B;  4ZTB A;  2HHN A;  1KFX L;  1PPP A;  3HD3 A;  2VHF A;  5PAD A;  4N8W A;  4YV8 A;  5JA7 A;  3ZUA A;  2AYO A;  1PXV A; 
#chains in the Genus database with same CATH homology
 4OEM A;  3KWZ A;  5F02 A;  3IOQ A;  4BS5 A;  3D9W A;  3D6S A;  1NL6 A;  4Q8H A;  1CTE A;  1CVZ A;  2WBF X;  1THE A;  3N3K A;  3OVZ A;  1U9V A;  2R9N A;  4X6J A;  3BWK A;  4YYU A;  1S4V A;  4YYR A;  3I3T A;  1QXP A;  4BPV A;  2VHS A;  1EF7 A;  8PCH A;  1AU3 A;  2DCB A;  2GFO A;  3QJ3 A;  3PBH A;  2PNS A;  6PAD A;  4FJC A;  2R9O A;  3OF8 A;  1VJV A;  1YK7 A;  4K7C A;  4I04 A;  1BQI A;  1NPZ A;  2CIO A;  1W4T A;  2FRQ A;  2AUZ A;  1KXR A;  4W4U A;  2C0Y A;  4W5B A;  4N79 A;  1YVB A;  4C5P A;  4FIP A;  1YK8 A;  1ZIV A;  1ICF A;  3O0U A;  1W6F A;  1GCB A;  1YT7 A;  1MEM A;  3AI8 A;  2FUD A;  2E03 A;  1CB5 A;  1ATK A;  1U9X A;  2R9C A;  4XR7 A;  1SNK A;  4QRV A;  1HUC B;  1EWL A;  3NHE A;  1ITO A;  3ERV A;  3QSD A;  1BY8 A;  2OZ2 A;  2E01 A;  4NV8 A;  1PIP A;  1Y08 A;  3B79 A;  4N4Z A;  3MTN A;  4WA6 A;  4P6G A;  1PE6 A;  3LXS A;  4HWY A;  3KX1 A;  1FH0 A;  3WXE A;  3F75 A;  4ZUX U;  5FPW A;  1PBH A;  1F29 A;  3F5V A;  3OIS A;  4XUI A;  2HH5 A;  2YJ2 A;  3U8E A;  1X9Y A;  3H8C A;  3N4C A;  2P7U A;  3LTW A;  2ARY A;  3QT4 A;  4YYS A;  5JH3 A;  1GLO A;  2NQG A;  3HHA A;  2GHU A;  2DC8 A;  4PAD A;  3IV2 A;  1ME4 A;  2XU5 A;  1KFU L;  1U5I A;  1VSN A;  2HXZ A;  3BC3 A;  3MHS A;  2YJ9 A;  3CBJ A;  4RY2 A;  3E1Z B;  2AVW A;  2XU3 A;  4MZO A;  1TL9 A;  5CVM A;  2DCC A;  1Y4H A;  3RVV A;  2FO5 A;  4P6E A;  1GEC E;  4QRX A;  4CDD B;  3USV A;  1EWM A;  2DCD A;  2JQG R;  3IMA A;  3PDF A;  2ACT A;  1SP4 B;  1AU4 A;  3PNR A;  1F2A A;  1GMY A;  3K8U A;  2DJG B;  9PAP A;  2O6X A;  2VFC A;  2DC9 A;  4QRG A;  3MHH A;  1QDQ A;  2B1N A;  1F2C A;  2BDZ A;  3M99 A;  1CPJ A;  3HWN A;  4CDE B;  1CS8 A;  5CVN B;  2IBI A;  1EWO A;  3CH2 X;  1TLO A;  1NQC A;  2PAD A;  4X6H A;  2XU1 A;  1NLJ A;  2FQ9 A;  1DF0 A;  4CZW A;  1PCI A;  2R9F A;  2IPP B;  1E2T A;  3GCB A;  4DMX A;  1STF E;  5A24 A;  2NQD B;  1MEG A;  4BGF A;  1JQP A;  1DEU A;  4KLB A;  5CVO B;  1CSB B;  3IUT A;  1AU2 A;  1AYV A;  3KW9 A;  3V6E A;  1MIR A;  4QH6 A;  4YVA A;  2R6N A;  4AXL A;  4AXM A;  1ZCM A;  2G8E A;  3K9M A;  2PRE A;  2AYN A;  4GUZ A;  3BPM A;  3S3R A;  1NB3 A;  3KFQ A;  3TNX A;  1O0E A;  2P0R A;  3O1G A;  3V6C A;  2JQF R;  3P5W A;  2PBH A;  3BOW A;  4YYW A;  2AS8 A;  2XU4 A;  1NB5 A;  2DJF B;  4NV7 A;  2YJB A;  1AYU A;  2HD5 A;  2DZZ A;  3OVX A;  1GX3 A;  3P5X A;  2FYE A;  4CDC B;  1CQD A;  2F7D A;  1CV8 A;  1TU6 A;  2VFB A;  3N3G A;  1Q6K A;  1XKG A;  1AYW A;  1BP4 A;  3IHP A;  1F2B A;  7PCK A;  1BGO A;  1QOL A;  3H6S A;  2BSZ A;  5EGW A;  2G6D A;  4I07 A;  4MSX A;  2B1M A;  2NQA A;  3P5U A;  5K16 A;  2E02 A;  2OUL A;  3WXG A;  2OP3 A;  1MDW A;  2FTD A;  3IEJ A;  5CHT A;  4W5C A;  1MHW A;  5EF4 A;  1EWP A;  2G8J A;  2AIM A;  2Y6E A;  2YJ8 A;  3OF9 A;  2DC6 A;  4MZS A;  3H7D A;  3K24 A;  2NQI A;  4Q8G A;  3HHI A;  2DZY A;  2CB5 A;  2H7J A;  1AIM A;  4DMY A;  1ME3 A;  3CH3 X;  4PI3 A;  1IWD A;  4YYV A;  2E00 A;  3LFY A;  4BS6 A;  2Y5B A;  1PPD A;  1CJL A;  3H89 A;  2F1G A;  1MS6 A;  4BSQ A;  4X6I A;  2YJC A;  4PP2 E;  1AEC A;  2DCA A;  3WXF A;  1QMY A;  1POP A;  4PP1 A;  3RVX A;  3DF0 A;  3I06 A;  1U9Q X;  3PW3 A;  4CDF B;  2BDL A;  3BCN A;  3KSE A;  2P86 A;  1PPN A;  3MOR A;  4B55 A;  4OEL A;  1PAD A;  1KHP A;  1YAL A;  3KKU A;  1PPO A;  4QBB A;  4YYQ A;  4I05 A;  2G7Y A;  3P5V A;  1U9W A;  5CHV A;  2R9M A;  1M6D A;  3KWB X;  1A6R A;  5J94 A;  2AUX A;  4BQV A;  2DC7 A;  1KHQ A;  2AU1 A;  3C9E A;  3BPF A;  2FT2 A;  4FK5 A;  4G54 A;  2ATO A;  3S3Q A;  1AU0 A;  3H8B A;  1W5R A;  3RVW A;  3CBK A;  2FRA A;  1K3B B;  2HHN A;  1KFX L;  1PPP A;  3HD3 A;  2VHF A;  5PAD A;  4N8W A;  4YV8 A;  5JA7 A;  3ZUA A;  2AYO A;  1PXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...