2JQFR

Full length leader protease of foot and mouth disease virus c51a mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
173
structure length
166
Chain Sequence
MELTLYNGEKKTFYSRPNNHDNAWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQKAKVQRKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Investigating the Substrate Specificity and Oligomerisation of the Leader Protease of Foot and Mouth Disease Virus using NMR
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain o1)
molecule tags Viral protein
total genus 30
structure length 166
sequence length 173
chains with identical sequence S
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2jqfR00
1BQIA 2OP3A 3F5VA 2FRAA 1AYWA 1TL9A 4HWYA 2AVWA 1U9XA 2P0RA 1PE6A 4QRXA 1VJVA 1GLOA 1AYVA 1MIRA 1U9QX 5JH3A 2DJGB 3RVVA 5EGWA 1MS6A 2DZYA 1ICFA 1U9WA 1AU4A 2G7YA 4Q8GA 1CQDA 1CS8A 2NQDB 1NLJA 1AIMA 3AI8A 3QJ3A 4FK5A 3DF0A 5PADA 6PADA 1ZIVA 3PNRA 2JQFR 1F2CA 2FUDA 2AUXA 1KHQA 3BOWA 1VSNA 2PREA 4G54A 3IOQA 3KKUA 1BGOA 4XR7A 2O6XA 2R9CA 2R9MA 3IMAA 3HHIA 2YJ9A 3QSDA 2ATOA 3CH2X 5CHVA 2BDLA 1EWLA 3E1ZB 4CDEB 2NQIA 1PPNA 3O0UA 3IUTA 2DZZA 3HWNA 1GECE 2E02A 3HD3A 3KWZA 1PPDA 3C9EA 4YYRA 3S3RA 1PPOA 2DJFB 1STFE 1F2BA 3MHSA 3WXFA 1CPJA 2G8JA 3MHHA 4YYQA 3P5XA 1ATKA 4KLBA 3LXSA 1NL6A 1PIPA 3S3QA 3K8UA 1CSBB 4CDFB 2XU1A 2AYNA 1POPA 3RVWA 3KSEA 1MDWA 1MHWA 2G6DA 4QRVA 1AU0A 4I05A 1YALA 2FQ9A 4W5CA 3P5UA 4BS6A 2FTDA 2B1NA 5FPWA 1PCIA 2R6NA 3PW3A 5J94A 3I06A 3BWKA 2F1GA 1QOLA 4N8WA 5CVNB 1QDQA 2NQGA 4BSQA 4YVAA 4PP2E 4YYWA 3H7DA 3OVZA 3KWBX 2ACTA 2IPPB 2BDZA 5EF4A 4OELA 3GCBA 1AU3A 3N4CA 1NQCA 3O1GA 2P7UA 5CVMA 1CJLA 3K9MA 4FIPA 2ARYA 2F7DA 4Q8HA 3U8EA 4PADA 4YV8A 5JA7A 3BC3A 1THEA 2DCAA 3IEJA 4W5BA 4DMYA 2B1MA 3OF8A 1KXRA 1PBHA 1F2AA 2PBHA 1ITOA 4BPVA 3K24A 2OULA 4X6JA 2E03A 3BCNA 4ZUXU 3IHPA 2AU1A 1U5IA 1EWPA 3CBKA 5CVOB 1FH0A 3PBHA 2R9NA 2YJBA 4OEMA 3N3KA 2HH5A 2FYEA 1QXPA 2H7JA 2OZ2A 4K7CA 1A6RA 3HHAA 2P86A 3P5WA 3BPFA 2AYOA 2VHSA 2DCCA 4W4UA 1Y4HA 3MORA 1DEUA 3H89A 4WA6A 3LFYA 3V6EA 3KW9A 2WBFX 2E00A 4QRGA 1TU6A 2AS8A 2DC8A 2GHUA 1ME3A 1EWOA 2HHNA 1YT7A 2Y6EA 5CHTA 3H6SA 3OISA 1CV8A 1M6DA 4X6HA 1YVBA 1GMYA 2FRQA 3MTNA 4RY2A 4AXLA 3ZUAA 3D6SA 4YYUA 4QH6A 1ME4A 9PAPA 4I07A 2DC7A 2VHFA 4CZWA 4DMXA 2PNSA 2AUZA 3RVXA 2Y5BA 2R9FA 2DC9A 2CIOA 1TLOA 1PADA 3WXEA 1Q6KA 3H8CA 1IWDA 1K3BB 2IBIA 4MSXA 1CB5A 3BPMA 1AYUA 1GCBA 3WXGA 2R9OA 5A24A 1EF7A 3KFQA 4PP1A 4XUIA 1AECA 2FT2A 1NB3A 4AXMA 3V6CA 2DCBA 1YK7A 4MZSA 5F02A 2HXZA 7PCKA 3OF9A 3KX1A 1O0EA 1PXVA 1NB5A 2XU4A 1CTEA 1XKGA 1PPPA 1ZCMA 3F75A 2CB5A 4P6GA 4YYSA 3I3TA 4X6IA 2YJ2A 5K16A 4FJCA 3N3GA 1X9YA 2DCDA 3USVA 1KHPA 1AU2A 2XU3A 2YJCA 1JQPA 4N79A 2NQAA 2JQGR 4I04A 1Y08A 1SP4B 1BP4A 1U9VA 1QMYA 2HD5A 3QT4A 3CBJA 2GFOA 4CDCB 1NPZA 3ERVA 4BS5A 2XU5A 1F29A 4QBBA 4PI3A 2G8EA 4CDDB 2FO5A 2DC6A 1KFXL 3M99A 3H8BA 1CVZA 8PCHA 4MZOA 2E01A 3TNXA 3OVXA 4YYVA 3IV2A 2PADA 2YJ8A 1HUCB 1YK8A 3NHEA 3PDFA 1S4VA 4N4ZA 1MEGA 3CH3X 1SNKA 3B79A 1BY8A 2AIMA 1KFUL 4BQVA 1MEMA 4P6EA 1EWMA 2C0YA 1DF0A 3P5VA
chains in the Genus database with same CATH superfamily
1BQIA 2OP3A 3F5VA 2FRAA 1AYWA 1TL9A 4HWYA 2AVWA 1U9XA 2P0RA 1PE6A 4QRXA 1VJVA 1GLOA 1AYVA 1MIRA 1U9QX 5JH3A 2DJGB 3RVVA 3E9SA 5EGWA 1MS6A 2DZYA 1ICFA 1U9WA 1AU4A 3PSEA 2G7YA 4Q8GA 1CQDA 1CS8A 2NQDB 3TRKA 1NLJA 1AIMA 3AI8A 3QJ3A 4FK5A 3DF0A 5PADA 6PADA 1ZIVA 3PNRA 2JQFR 1F2CA 5EZSA 1YZBA 2FUDA 2AUXA 1KHQA 3MJ5A 3BOWA 1VSNA 2PREA 4G54A 2DOSA 3BB7A 3IOQA 3KKUA 1BGOA 4XR7A 2JTCA 2O6XA 2R9CA 2R9MA 3IMAA 3HHIA 2YJ9A 3QSDA 2ATOA 3CH2X 5CHVA 2BDLA 1EWLA 3E1ZB 4CDEB 3PT2A 2NQIA 2BU3A 1PPNA 3O0UA 3IUTA 4MM3B 2DZZA 3HWNA 1GECE 2E02A 3HD3A 3KWZA 1PPDA 3C9EA 4BOSA 4YYRA 3S3RA 3O65A 4OVZA 4RF0A 4RNAA 1PPOA 2DJFB 1STFE 3MTVA 1F2BA 3MHSA 3WXFA 1CPJA 2G8JA 3MHHA 4YYQA 3W30A 3P5XA 1ATKA 4BOUA 4KLBA 3LXSA 1NL6A 4ZTBA 1PIPA 3S3QA 3K8UA 1CSBB 4CDFB 2UZJA 2XU1A 2AYNA 1POPA 3RVWA 3KSEA 4R3DA 1MDWA 1MHWA 2G6DA 4QRVA 1AU0A 4I05A 1YALA 2FQ9A 4W5CA 3P5UA 3PRPA 4BS6A 2FTDA 2B1NA 4OVZB 5FPWA 1PCIA 3TMPA 2R6NA 3PW3A 5J94A 3I06A 3BWKA 2F1GA 1QOLA 2J7QA 4N8WA 5CVNB 2J7QC 1QDQA 2NQGA 4BSQA 4YVAA 4PP2E 4YYWA 2FE8A 4PT5A 3H7DA 3OVZA 3KWBX 2ACTA 4M0WA 2IPPB 2BDZA 5EF4A 4OELA 4HXDB 3GCBA 1AU3A 3N4CA 1NQCA 3O1GA 2P7UA 5CVMA 1CJLA 3K9MA 4FIPA 2ARYA 4OW0A 2F7DA 4Q8HA 3U8EA 4PADA 4YV8A 5JA7A 3BC3A 1THEA 2DCAA 3IEJA 4W5BA 4DMYA 2B1MA 2Z84A 3OF8A 1KXRA 1PBHA 4IUMA 1F2AA 2PBHA 1UKFA 1ITOA 3RNVA 4BPVA 3K24A 4RF1A 2OULA 4GUAA 4X6JA 2E03A 3BCNA 4ZUXU 3IHPA 2AU1A 1U5IA 1EWPA 3CBKA 5CVOB 1FH0A 3PBHA 2R9NA 2YJBA 1PVJA 4OEMA 3N3KA 3OQCA 4IP3A 4A5UA 2HH5A 4WURA 2FYEA 1QXPA 2H7JA 4D8BA 2OZ2A 4K7CA 1A6RA 4D8IA 3HHAA 2P86A 3P5WA 4REZA 3BPFA 2AYOA 2VHSA 2DCCA 4W4UA 1Y4HA 2HWKA 3MORA 1DEUA 3H89A 4BOQA 3IFUA 4WA6A 3LFYA 3V6EA 3KW9A 2WBFX 2E00A 4QRGA 1TU6A 2AS8A 2DC8A 2GHUA 1ME3A 1EWOA 2HHNA 1YT7A 2Y6EA 5CHTA 3H6SA 3OISA 1CV8A 1M6DA 4X6HA 3B21A 1YVBA 1GMYA 2FRQA 3MTNA 4RY2A 4AXLA 3ZUAA 3D6SA 5EZQA 4YYUA 4QH6A 1ME4A 9PAPA 3BBAA 2DC7A 4I07A 2VHFA 4XZXA 4CZWA 4DMXA 2PNSA 3BY4A 2AUZA 3RVXA 2Y5BA 2R9FA 2DC9A 2CIOA 2JRIA 1TLOA 3MP2A 1PADA 3C0RA 3WXEA 1Q6KA 3H8CA 1IWDA 1K3BB 2IBIA 4MSXA 1CB5A 3BPMA 5E6JA 3W31A 1AYUA 1GCBA 2BTWA 3WXGA 2R9OA 5A24A 1EF7A 3KFQA 4PP1A 5JZEA 4XUIA 1AECA 2FT2A 1NB3A 4AXMA 3V6CA 2DCBA 1YK7A 4MZSA 1DKIA 5F02A 2HXZA 7PCKA 3OF9A 3KX1A 1O0EA 1PXVA 1NB5A 2XU4A 1CTEA 1XKGA 1PPPA 1ZCMA 3ZNHA 4MI7A 3F75A 2CB5A 4P6GA 4YYSA 3I3TA 2BTWB 4X6IA 2YJ2A 5K16A 4FJCA 5KO3A 3N3GA 1X9YA 4P16A 2DCDA 3USVA 3PHUA 1KHPA 1AU2A 2XU3A 2YJCA 1JQPA 4N79A 2NQAA 2JQGR 4BOZA 4I04A 1Y08A 1SP4B 1BP4A 1U9VA 4BOPA 1QMYA 2HD5A 3PHXA 3QT4A 3CBJA 2GFOA 4CDCB 1NPZA 3ERVA 4BS5A 4D8EA 2XU5A 1F29A 4QBBA 3PHWA 4PI3A 2G8EA 4CDDB 2FO5A 2DC6A 1KFXL 3M99A 3H8BA 1CVZA 8PCHA 4MZOA 2E01A 3TNXA 3OVXA 4YYVA 3IV2A 2PADA 4RKXA 2YJ8A 1HUCB 1YK8A 3NHEA 3PDFA 1S4VA 4N4ZA 1MEGA 3PRMA 2AGAA 3CH3X 1SNKA 3B79A 1BY8A 2AIMA 1KFUL 4BQVA 1MEMA 4P6EA 1EWMA 2C0YA 1DF0A 3P5VA
chains in the Genus database with same CATH topology
1BQIA 2OP3A 3F5VA 2FRAA 1AYWA 1TL9A 4HWYA 2AVWA 1U9XA 2P0RA 1PE6A 4QRXA 1VJVA 1GLOA 1AYVA 1MIRA 1U9QX 5JH3A 2DJGB 3RVVA 5EGWA 1MS6A 2DZYA 1ICFA 1U9WA 1AU4A 2G7YA 4Q8GA 1CQDA 1CS8A 2NQDB 1GX3A 1NLJA 1AIMA 3AI8A 3QJ3A 4FK5A 3DF0A 5PADA 6PADA 1ZIVA 3PNRA 2JQFR 1F2CA 2FUDA 2AUXA 1KHQA 3BOWA 1VSNA 2PREA 4G54A 3IOQA 3KKUA 1BGOA 4XR7A 2O6XA 2R9CA 2R9MA 3IMAA 3HHIA 2YJ9A 3QSDA 2ATOA 3CH2X 5CHVA 2BDLA 1EWLA 3E1ZB 4CDEB 2NQIA 1PPNA 3O0UA 3IUTA 2DZZA 3HWNA 1GECE 2E02A 3HD3A 3KWZA 1PPDA 3C9EA 4YYRA 3S3RA 1PPOA 2DJFB 1STFE 1F2BA 3MHSA 4C5PA 3WXFA 1CPJA 2G8JA 3MHHA 4YYQA 3P5XA 1ATKA 4KLBA 3LXSA 1NL6A 1PIPA 3S3QA 3K8UA 1CSBB 4CDFB 2XU1A 2AYNA 1POPA 3RVWA 3KSEA 2VFCA 1MDWA 1MHWA 2G6DA 4QRVA 1AU0A 4I05A 1YALA 2FQ9A 4W5CA 3P5UA 1W4TA 4BS6A 2FTDA 2B1NA 5FPWA 1PCIA 2R6NA 3PW3A 5J94A 3I06A 3BWKA 2F1GA 1QOLA 4N8WA 5CVNB 1QDQA 2NQGA 4BSQA 4YVAA 4PP2E 4YYWA 3H7DA 3OVZA 3KWBX 2ACTA 2IPPB 2BDZA 5EF4A 4OELA 3GCBA 1AU3A 3N4CA 1NQCA 3O1GA 2P7UA 5CVMA 1CJLA 3K9MA 4FIPA 2ARYA 2F7DA 4Q8HA 3U8EA 4PADA 4YV8A 5JA7A 3BC3A 1THEA 2DCAA 3IEJA 4W5BA 4DMYA 2B1MA 3OF8A 1KXRA 1PBHA 1F2AA 2PBHA 1ITOA 4BPVA 3K24A 2OULA 4X6JA 2E03A 3BCNA 4ZUXU 3IHPA 2AU1A 3LTWA 1U5IA 1EWPA 3CBKA 5CVOB 1FH0A 3PBHA 2R9NA 2YJBA 4OEMA 3N3KA 2HH5A 2FYEA 1QXPA 2H7JA 2OZ2A 4K7CA 1A6RA 3HHAA 2P86A 3P5WA 3BPFA 2AYOA 2VHSA 2DCCA 4W4UA 1Y4HA 3MORA 1DEUA 3H89A 4WA6A 3LFYA 3V6EA 3KW9A 2WBFX 2E00A 4QRGA 1TU6A 2AS8A 2DC8A 2GHUA 1ME3A 1EWOA 2HHNA 1YT7A 2Y6EA 5CHTA 2BSZA 3H6SA 3OISA 1CV8A 1M6DA 4X6HA 1YVBA 1GMYA 2FRQA 3MTNA 4RY2A 4AXLA 3ZUAA 3D6SA 4YYUA 4QH6A 1ME4A 9PAPA 4I07A 2DC7A 2VHFA 4CZWA 4DMXA 2PNSA 2AUZA 3RVXA 2Y5BA 2R9FA 2DC9A 2CIOA 1TLOA 1PADA 3WXEA 1Q6KA 3H8CA 1IWDA 1K3BB 2IBIA 4NV8A 2VFBA 1W6FA 4MSXA 1CB5A 3BPMA 1AYUA 1GCBA 3WXGA 2R9OA 5A24A 1EF7A 3KFQA 4PP1A 4B55A 4XUIA 1AECA 2FT2A 1NB3A 4AXMA 3V6CA 2DCBA 1YK7A 4MZSA 5F02A 2HXZA 7PCKA 3OF9A 3KX1A 1O0EA 1PXVA 1NB5A 2XU4A 1CTEA 1XKGA 1PPPA 1ZCMA 3F75A 2CB5A 4P6GA 4YYSA 1E2TA 3I3TA 4X6IA 4BGFA 2YJ2A 5K16A 4FJCA 3N3GA 1X9YA 2DCDA 3USVA 1KHPA 1AU2A 2XU3A 2YJCA 1JQPA 4N79A 2NQAA 2JQGR 4I04A 1Y08A 1SP4B 1W5RA 1BP4A 1U9VA 1QMYA 2HD5A 3QT4A 3CBJA 2GFOA 4CDCB 1NPZA 3ERVA 4BS5A 2XU5A 1F29A 4QBBA 4PI3A 2G8EA 4CDDB 2FO5A 2DC6A 1KFXL 3M99A 3H8BA 3D9WA 1CVZA 8PCHA 4MZOA 2E01A 3TNXA 3OVXA 4YYVA 3IV2A 2PADA 2YJ8A 1HUCB 1YK8A 3NHEA 3PDFA 1S4VA 4N4ZA 1MEGA 3CH3X 1SNKA 3B79A 1BY8A 2AIMA 1KFUL 4GUZA 4BQVA 1MEMA 4P6EA 1EWMA 4NV7A 2C0YA 1DF0A 3P5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQI A;  2OP3 A;  3F5V A;  2FRA A;  1AYW A;  1TL9 A;  4HWY A;  2AVW A;  1U9X A;  2P0R A;  1PE6 A;  4QRX A;  1VJV A;  1GLO A;  1AYV A;  1MIR A;  1U9Q X;  5JH3 A;  2DJG B;  3RVV A;  5EGW A;  1MS6 A;  2DZY A;  1ICF A;  1U9W A;  1AU4 A;  2G7Y A;  4Q8G A;  1CQD A;  1CS8 A;  2NQD B;  1NLJ A;  1AIM A;  3AI8 A;  3QJ3 A;  4FK5 A;  3DF0 A;  5PAD A;  6PAD A;  1ZIV A;  3PNR A;  2JQF R;  1F2C A;  2FUD A;  2AUX A;  1KHQ A;  3BOW A;  1VSN A;  2PRE A;  4G54 A;  3IOQ A;  3KKU A;  1BGO A;  4XR7 A;  2O6X A;  2R9C A;  2R9M A;  3IMA A;  3HHI A;  2YJ9 A;  3QSD A;  2ATO A;  3CH2 X;  5CHV A;  2BDL A;  1EWL A;  3E1Z B;  4CDE B;  2NQI A;  1PPN A;  3O0U A;  3IUT A;  2DZZ A;  3HWN A;  1GEC E;  2E02 A;  3HD3 A;  3KWZ A;  1PPD A;  3C9E A;  4YYR A;  3S3R A;  1PPO A;  2DJF B;  1STF E;  1F2B A;  3MHS A;  3WXF A;  1CPJ A;  2G8J A;  3MHH A;  4YYQ A;  3P5X A;  1ATK A;  4KLB A;  3LXS A;  1NL6 A;  1PIP A;  3S3Q A;  3K8U A;  1CSB B;  4CDF B;  2XU1 A;  2AYN A;  1POP A;  3RVW A;  3KSE A;  1MDW A;  1MHW A;  2G6D A;  4QRV A;  1AU0 A;  4I05 A;  1YAL A;  2FQ9 A;  4W5C A;  3P5U A;  4BS6 A;  2FTD A;  2B1N A;  5FPW A;  1PCI A;  2R6N A;  3PW3 A;  5J94 A;  3I06 A;  3BWK A;  2F1G A;  1QOL A;  4N8W A;  5CVN B;  1QDQ A;  2NQG A;  4BSQ A;  4YVA A;  4PP2 E;  4YYW A;  3H7D A;  3OVZ A;  3KWB X;  2ACT A;  2IPP B;  2BDZ A;  5EF4 A;  4OEL A;  3GCB A;  1AU3 A;  3N4C A;  1NQC A;  3O1G A;  2P7U A;  5CVM A;  1CJL A;  3K9M A;  4FIP A;  2ARY A;  2F7D A;  4Q8H A;  3U8E A;  4PAD A;  4YV8 A;  5JA7 A;  3BC3 A;  1THE A;  2DCA A;  3IEJ A;  4W5B A;  4DMY A;  2B1M A;  3OF8 A;  1KXR A;  1PBH A;  1F2A A;  2PBH A;  1ITO A;  4BPV A;  3K24 A;  2OUL A;  4X6J A;  2E03 A;  3BCN A;  4ZUX U;  3IHP A;  2AU1 A;  1U5I A;  1EWP A;  3CBK A;  5CVO B;  1FH0 A;  3PBH A;  2R9N A;  2YJB A;  4OEM A;  3N3K A;  2HH5 A;  2FYE A;  1QXP A;  2H7J A;  2OZ2 A;  4K7C A;  1A6R A;  3HHA A;  2P86 A;  3P5W A;  3BPF A;  2AYO A;  2VHS A;  2DCC A;  4W4U A;  1Y4H A;  3MOR A;  1DEU A;  3H89 A;  4WA6 A;  3LFY A;  3V6E A;  3KW9 A;  2WBF X;  2E00 A;  4QRG A;  1TU6 A;  2AS8 A;  2DC8 A;  2GHU A;  1ME3 A;  1EWO A;  2HHN A;  1YT7 A;  2Y6E A;  5CHT A;  3H6S A;  3OIS A;  1CV8 A;  1M6D A;  4X6H A;  1YVB A;  1GMY A;  2FRQ A;  3MTN A;  4RY2 A;  4AXL A;  3ZUA A;  3D6S A;  4YYU A;  4QH6 A;  1ME4 A;  9PAP A;  4I07 A;  2DC7 A;  2VHF A;  4CZW A;  4DMX A;  2PNS A;  2AUZ A;  3RVX A;  2Y5B A;  2R9F A;  2DC9 A;  2CIO A;  1TLO A;  1PAD A;  3WXE A;  1Q6K A;  3H8C A;  1IWD A;  1K3B B;  2IBI A;  4MSX A;  1CB5 A;  3BPM A;  1AYU A;  1GCB A;  3WXG A;  2R9O A;  5A24 A;  1EF7 A;  3KFQ A;  4PP1 A;  4XUI A;  1AEC A;  2FT2 A;  1NB3 A;  4AXM A;  3V6C A;  2DCB A;  1YK7 A;  4MZS A;  5F02 A;  2HXZ A;  7PCK A;  3OF9 A;  3KX1 A;  1O0E A;  1PXV A;  1NB5 A;  2XU4 A;  1CTE A;  1XKG A;  1PPP A;  1ZCM A;  3F75 A;  2CB5 A;  4P6G A;  4YYS A;  3I3T A;  4X6I A;  2YJ2 A;  5K16 A;  4FJC A;  3N3G A;  1X9Y A;  2DCD A;  3USV A;  1KHP A;  1AU2 A;  2XU3 A;  2YJC A;  1JQP A;  4N79 A;  2NQA A;  2JQG R;  4I04 A;  1Y08 A;  1SP4 B;  1BP4 A;  1U9V A;  1QMY A;  2HD5 A;  3QT4 A;  3CBJ A;  2GFO A;  4CDC B;  1NPZ A;  3ERV A;  4BS5 A;  2XU5 A;  1F29 A;  4QBB A;  4PI3 A;  2G8E A;  4CDD B;  2FO5 A;  2DC6 A;  1KFX L;  3M99 A;  3H8B A;  1CVZ A;  8PCH A;  4MZO A;  2E01 A;  3TNX A;  3OVX A;  4YYV A;  3IV2 A;  2PAD A;  2YJ8 A;  1HUC B;  1YK8 A;  3NHE A;  3PDF A;  1S4V A;  4N4Z A;  1MEG A;  3CH3 X;  1SNK A;  3B79 A;  1BY8 A;  2AIM A;  1KFU L;  4BQV A;  1MEM A;  4P6E A;  1EWM A;  2C0Y A;  1DF0 A;  3P5V A; 
#chains in the Genus database with same CATH topology
 1BQI A;  2OP3 A;  3F5V A;  2FRA A;  1AYW A;  1TL9 A;  4HWY A;  2AVW A;  1U9X A;  2P0R A;  1PE6 A;  4QRX A;  1VJV A;  1GLO A;  1AYV A;  1MIR A;  1U9Q X;  5JH3 A;  2DJG B;  3RVV A;  3E9S A;  5EGW A;  1MS6 A;  2DZY A;  1ICF A;  1U9W A;  1AU4 A;  3PSE A;  2G7Y A;  4Q8G A;  1CQD A;  1CS8 A;  2NQD B;  3TRK A;  1NLJ A;  1AIM A;  3AI8 A;  3QJ3 A;  4FK5 A;  3DF0 A;  5PAD A;  6PAD A;  1ZIV A;  3PNR A;  2JQF R;  1F2C A;  5EZS A;  1YZB A;  2FUD A;  2AUX A;  1KHQ A;  3MJ5 A;  3BOW A;  1VSN A;  2PRE A;  4G54 A;  2DOS A;  3BB7 A;  3IOQ A;  3KKU A;  1BGO A;  4XR7 A;  2JTC A;  2O6X A;  2R9C A;  2R9M A;  3IMA A;  3HHI A;  2YJ9 A;  3QSD A;  2ATO A;  3CH2 X;  5CHV A;  2BDL A;  1EWL A;  3E1Z B;  4CDE B;  3PT2 A;  2NQI A;  2BU3 A;  1PPN A;  3O0U A;  3IUT A;  4MM3 B;  2DZZ A;  3HWN A;  1GEC E;  2E02 A;  3HD3 A;  3KWZ A;  1PPD A;  3C9E A;  4BOS A;  4YYR A;  3S3R A;  3O65 A;  4OVZ A;  4RF0 A;  4RNA A;  1PPO A;  2DJF B;  1STF E;  3MTV A;  1F2B A;  3MHS A;  3WXF A;  1CPJ A;  2G8J A;  3MHH A;  4YYQ A;  3W30 A;  3P5X A;  1ATK A;  4BOU A;  4KLB A;  3LXS A;  1NL6 A;  4ZTB A;  1PIP A;  3S3Q A;  3K8U A;  1CSB B;  4CDF B;  2UZJ A;  2XU1 A;  2AYN A;  1POP A;  3RVW A;  3KSE A;  4R3D A;  1MDW A;  1MHW A;  2G6D A;  4QRV A;  1AU0 A;  4I05 A;  1YAL A;  2FQ9 A;  4W5C A;  3P5U A;  3PRP A;  4BS6 A;  2FTD A;  2B1N A;  4OVZ B;  5FPW A;  1PCI A;  3TMP A;  2R6N A;  3PW3 A;  5J94 A;  3I06 A;  3BWK A;  2F1G A;  1QOL A;  2J7Q A;  4N8W A;  5CVN B;  2J7Q C;  1QDQ A;  2NQG A;  4BSQ A;  4YVA A;  4PP2 E;  4YYW A;  2FE8 A;  4PT5 A;  3H7D A;  3OVZ A;  3KWB X;  2ACT A;  4M0W A;  2IPP B;  2BDZ A;  5EF4 A;  4OEL A;  4HXD B;  3GCB A;  1AU3 A;  3N4C A;  1NQC A;  3O1G A;  2P7U A;  5CVM A;  1CJL A;  3K9M A;  4FIP A;  2ARY A;  4OW0 A;  2F7D A;  4Q8H A;  3U8E A;  4PAD A;  4YV8 A;  5JA7 A;  3BC3 A;  1THE A;  2DCA A;  3IEJ A;  4W5B A;  4DMY A;  2B1M A;  2Z84 A;  3OF8 A;  1KXR A;  1PBH A;  4IUM A;  1F2A A;  2PBH A;  1UKF A;  1ITO A;  3RNV A;  4BPV A;  3K24 A;  4RF1 A;  2OUL A;  4GUA A;  4X6J A;  2E03 A;  3BCN A;  4ZUX U;  3IHP A;  2AU1 A;  1U5I A;  1EWP A;  3CBK A;  5CVO B;  1FH0 A;  3PBH A;  2R9N A;  2YJB A;  1PVJ A;  4OEM A;  3N3K A;  3OQC A;  4IP3 A;  4A5U A;  2HH5 A;  4WUR A;  2FYE A;  1QXP A;  2H7J A;  4D8B A;  2OZ2 A;  4K7C A;  1A6R A;  4D8I A;  3HHA A;  2P86 A;  3P5W A;  4REZ A;  3BPF A;  2AYO A;  2VHS A;  2DCC A;  4W4U A;  1Y4H A;  2HWK A;  3MOR A;  1DEU A;  3H89 A;  4BOQ A;  3IFU A;  4WA6 A;  3LFY A;  3V6E A;  3KW9 A;  2WBF X;  2E00 A;  4QRG A;  1TU6 A;  2AS8 A;  2DC8 A;  2GHU A;  1ME3 A;  1EWO A;  2HHN A;  1YT7 A;  2Y6E A;  5CHT A;  3H6S A;  3OIS A;  1CV8 A;  1M6D A;  4X6H A;  3B21 A;  1YVB A;  1GMY A;  2FRQ A;  3MTN A;  4RY2 A;  4AXL A;  3ZUA A;  3D6S A;  5EZQ A;  4YYU A;  4QH6 A;  1ME4 A;  9PAP A;  3BBA A;  2DC7 A;  4I07 A;  2VHF A;  4XZX A;  4CZW A;  4DMX A;  2PNS A;  3BY4 A;  2AUZ A;  3RVX A;  2Y5B A;  2R9F A;  2DC9 A;  2CIO A;  2JRI A;  1TLO A;  3MP2 A;  1PAD A;  3C0R A;  3WXE A;  1Q6K A;  3H8C A;  1IWD A;  1K3B B;  2IBI A;  4MSX A;  1CB5 A;  3BPM A;  5E6J A;  3W31 A;  1AYU A;  1GCB A;  2BTW A;  3WXG A;  2R9O A;  5A24 A;  1EF7 A;  3KFQ A;  4PP1 A;  5JZE A;  4XUI A;  1AEC A;  2FT2 A;  1NB3 A;  4AXM A;  3V6C A;  2DCB A;  1YK7 A;  4MZS A;  1DKI A;  5F02 A;  2HXZ A;  7PCK A;  3OF9 A;  3KX1 A;  1O0E A;  1PXV A;  1NB5 A;  2XU4 A;  1CTE A;  1XKG A;  1PPP A;  1ZCM A;  3ZNH A;  4MI7 A;  3F75 A;  2CB5 A;  4P6G A;  4YYS A;  3I3T A;  2BTW B;  4X6I A;  2YJ2 A;  5K16 A;  4FJC A;  5KO3 A;  3N3G A;  1X9Y A;  4P16 A;  2DCD A;  3USV A;  3PHU A;  1KHP A;  1AU2 A;  2XU3 A;  2YJC A;  1JQP A;  4N79 A;  2NQA A;  2JQG R;  4BOZ A;  4I04 A;  1Y08 A;  1SP4 B;  1BP4 A;  1U9V A;  4BOP A;  1QMY A;  2HD5 A;  3PHX A;  3QT4 A;  3CBJ A;  2GFO A;  4CDC B;  1NPZ A;  3ERV A;  4BS5 A;  4D8E A;  2XU5 A;  1F29 A;  4QBB A;  3PHW A;  4PI3 A;  2G8E A;  4CDD B;  2FO5 A;  2DC6 A;  1KFX L;  3M99 A;  3H8B A;  1CVZ A;  8PCH A;  4MZO A;  2E01 A;  3TNX A;  3OVX A;  4YYV A;  3IV2 A;  2PAD A;  4RKX A;  2YJ8 A;  1HUC B;  1YK8 A;  3NHE A;  3PDF A;  1S4V A;  4N4Z A;  1MEG A;  3PRM A;  2AGA A;  3CH3 X;  1SNK A;  3B79 A;  1BY8 A;  2AIM A;  1KFU L;  4BQV A;  1MEM A;  4P6E A;  1EWM A;  2C0Y A;  1DF0 A;  3P5V A; 
#chains in the Genus database with same CATH homology
 1BQI A;  2OP3 A;  3F5V A;  2FRA A;  1AYW A;  1TL9 A;  4HWY A;  2AVW A;  1U9X A;  2P0R A;  1PE6 A;  4QRX A;  1VJV A;  1GLO A;  1AYV A;  1MIR A;  1U9Q X;  5JH3 A;  2DJG B;  3RVV A;  5EGW A;  1MS6 A;  2DZY A;  1ICF A;  1U9W A;  1AU4 A;  2G7Y A;  4Q8G A;  1CQD A;  1CS8 A;  2NQD B;  1GX3 A;  1NLJ A;  1AIM A;  3AI8 A;  3QJ3 A;  4FK5 A;  3DF0 A;  5PAD A;  6PAD A;  1ZIV A;  3PNR A;  2JQF R;  1F2C A;  2FUD A;  2AUX A;  1KHQ A;  3BOW A;  1VSN A;  2PRE A;  4G54 A;  3IOQ A;  3KKU A;  1BGO A;  4XR7 A;  2O6X A;  2R9C A;  2R9M A;  3IMA A;  3HHI A;  2YJ9 A;  3QSD A;  2ATO A;  3CH2 X;  5CHV A;  2BDL A;  1EWL A;  3E1Z B;  4CDE B;  2NQI A;  1PPN A;  3O0U A;  3IUT A;  2DZZ A;  3HWN A;  1GEC E;  2E02 A;  3HD3 A;  3KWZ A;  1PPD A;  3C9E A;  4YYR A;  3S3R A;  1PPO A;  2DJF B;  1STF E;  1F2B A;  3MHS A;  4C5P A;  3WXF A;  1CPJ A;  2G8J A;  3MHH A;  4YYQ A;  3P5X A;  1ATK A;  4KLB A;  3LXS A;  1NL6 A;  1PIP A;  3S3Q A;  3K8U A;  1CSB B;  4CDF B;  2XU1 A;  2AYN A;  1POP A;  3RVW A;  3KSE A;  2VFC A;  1MDW A;  1MHW A;  2G6D A;  4QRV A;  1AU0 A;  4I05 A;  1YAL A;  2FQ9 A;  4W5C A;  3P5U A;  1W4T A;  4BS6 A;  2FTD A;  2B1N A;  5FPW A;  1PCI A;  2R6N A;  3PW3 A;  5J94 A;  3I06 A;  3BWK A;  2F1G A;  1QOL A;  4N8W A;  5CVN B;  1QDQ A;  2NQG A;  4BSQ A;  4YVA A;  4PP2 E;  4YYW A;  3H7D A;  3OVZ A;  3KWB X;  2ACT A;  2IPP B;  2BDZ A;  5EF4 A;  4OEL A;  3GCB A;  1AU3 A;  3N4C A;  1NQC A;  3O1G A;  2P7U A;  5CVM A;  1CJL A;  3K9M A;  4FIP A;  2ARY A;  2F7D A;  4Q8H A;  3U8E A;  4PAD A;  4YV8 A;  5JA7 A;  3BC3 A;  1THE A;  2DCA A;  3IEJ A;  4W5B A;  4DMY A;  2B1M A;  3OF8 A;  1KXR A;  1PBH A;  1F2A A;  2PBH A;  1ITO A;  4BPV A;  3K24 A;  2OUL A;  4X6J A;  2E03 A;  3BCN A;  4ZUX U;  3IHP A;  2AU1 A;  3LTW A;  1U5I A;  1EWP A;  3CBK A;  5CVO B;  1FH0 A;  3PBH A;  2R9N A;  2YJB A;  4OEM A;  3N3K A;  2HH5 A;  2FYE A;  1QXP A;  2H7J A;  2OZ2 A;  4K7C A;  1A6R A;  3HHA A;  2P86 A;  3P5W A;  3BPF A;  2AYO A;  2VHS A;  2DCC A;  4W4U A;  1Y4H A;  3MOR A;  1DEU A;  3H89 A;  4WA6 A;  3LFY A;  3V6E A;  3KW9 A;  2WBF X;  2E00 A;  4QRG A;  1TU6 A;  2AS8 A;  2DC8 A;  2GHU A;  1ME3 A;  1EWO A;  2HHN A;  1YT7 A;  2Y6E A;  5CHT A;  2BSZ A;  3H6S A;  3OIS A;  1CV8 A;  1M6D A;  4X6H A;  1YVB A;  1GMY A;  2FRQ A;  3MTN A;  4RY2 A;  4AXL A;  3ZUA A;  3D6S A;  4YYU A;  4QH6 A;  1ME4 A;  9PAP A;  4I07 A;  2DC7 A;  2VHF A;  4CZW A;  4DMX A;  2PNS A;  2AUZ A;  3RVX A;  2Y5B A;  2R9F A;  2DC9 A;  2CIO A;  1TLO A;  1PAD A;  3WXE A;  1Q6K A;  3H8C A;  1IWD A;  1K3B B;  2IBI A;  4NV8 A;  2VFB A;  1W6F A;  4MSX A;  1CB5 A;  3BPM A;  1AYU A;  1GCB A;  3WXG A;  2R9O A;  5A24 A;  1EF7 A;  3KFQ A;  4PP1 A;  4B55 A;  4XUI A;  1AEC A;  2FT2 A;  1NB3 A;  4AXM A;  3V6C A;  2DCB A;  1YK7 A;  4MZS A;  5F02 A;  2HXZ A;  7PCK A;  3OF9 A;  3KX1 A;  1O0E A;  1PXV A;  1NB5 A;  2XU4 A;  1CTE A;  1XKG A;  1PPP A;  1ZCM A;  3F75 A;  2CB5 A;  4P6G A;  4YYS A;  1E2T A;  3I3T A;  4X6I A;  4BGF A;  2YJ2 A;  5K16 A;  4FJC A;  3N3G A;  1X9Y A;  2DCD A;  3USV A;  1KHP A;  1AU2 A;  2XU3 A;  2YJC A;  1JQP A;  4N79 A;  2NQA A;  2JQG R;  4I04 A;  1Y08 A;  1SP4 B;  1W5R A;  1BP4 A;  1U9V A;  1QMY A;  2HD5 A;  3QT4 A;  3CBJ A;  2GFO A;  4CDC B;  1NPZ A;  3ERV A;  4BS5 A;  2XU5 A;  1F29 A;  4QBB A;  4PI3 A;  2G8E A;  4CDD B;  2FO5 A;  2DC6 A;  1KFX L;  3M99 A;  3H8B A;  3D9W A;  1CVZ A;  8PCH A;  4MZO A;  2E01 A;  3TNX A;  3OVX A;  4YYV A;  3IV2 A;  2PAD A;  2YJ8 A;  1HUC B;  1YK8 A;  3NHE A;  3PDF A;  1S4V A;  4N4Z A;  1MEG A;  3CH3 X;  1SNK A;  3B79 A;  1BY8 A;  2AIM A;  1KFU L;  4GUZ A;  4BQV A;  1MEM A;  4P6E A;  1EWM A;  4NV7 A;  2C0Y A;  1DF0 A;  3P5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...