4PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4padA00
1BY8A 2DJFB 9PAPA 2BDLA 4YYWA 3P5WA 3RVXA 3OF9A 2R9CA 2IBIA 2ATOA 4MZOA 3HD3A 2P0RA 1YK7A 2G6DA 1IWDA 4PP2E 3BOWA 1AU4A 4YV8A 2BDZA 4BS6A 3KKUA 1F2BA 1MHWA 4YVAA 1MS6A 3QJ3A 4N8WA 3USVA 3TNXA 4QH6A 2PADA 3CBJA 1EWOA 4XR7A 1PIPA 4QRGA 2XU4A 3K9MA 3KWZA 1GMYA 4N4ZA 2AIMA 3M99A 2AYOA 2HD5A 1PPNA 3BC3A 3H8CA 2WBFX 4W4UA 4CDCB 1CS8A 2GHUA 2XU1A 1YT7A 1CVZA 1NB3A 4AXLA 2R9MA 1KFXL 3AI8A 4CDEB 3KSEA 3DF0A 1NL6A 2DCCA 3E1ZB 3U8EA 2DCBA 2DC6A 2AYNA 1TLOA 4OEMA 2C0YA 3MHHA 3IV2A 1EF7A 1ATKA 4YYQA 1O0EA 3IMAA 3K24A 2CB5A 3RVWA 3F5VA 3PNRA 1M6DA 2NQIA 3NHEA 5CHTA 1PCIA 2F1GA 3H6SA 2FUDA 1CQDA 4BPVA 3CBKA 5EF4A 5F02A 2FTDA 1GCBA 1DF0A 3ERVA 5CVMA 2DZYA 2OP3A 2E02A 4X6JA 4YYUA 3GCBA 3WXEA 5CVOB 5EGWA 2FRAA 2PREA 2DCAA 3OISA 3I06A 5CVNB 1CB5A 2FQ9A 1THEA 4HWYA 1YALA 4CDDB 2G8EA 2DC7A 4Q8GA 1KHPA 1DEUA 3V6CA 2R9NA 3P5VA 3PW3A 1BGOA 1U9VA 3WXFA 2F7DA 4BS5A 2JQFR 3OVXA 2OULA 3O1GA 4XUIA 1CTEA 1YK8A 4CZWA 1KHQA 2JQGR 4MSXA 1AYUA 1KXRA 2YJ2A 8PCHA 4I05A 1PPPA 1YVBA 1JQPA 2FYEA 2AUZA 1QMYA 2DJGB 2E00A 1XKGA 1ME3A 4X6HA 3KFQA 2E03A 1EWMA 3RVVA 2AUXA 3H8BA 3P5XA 1SP4B 2ACTA 4W5CA 1GLOA 1TU6A 6PADA 4ZUXU 2PNSA 3QSDA 4BSQA 3C9EA 3P5UA 3N3GA 1KFUL 3CH3X 2NQGA 2FO5A 1EWLA 1A6RA 2IPPB 1AU3A 3PBHA 1EWPA 1PXVA 5CHVA 1CJLA 4PI3A 4QRVA 4Q8HA 4G54A 1Y4HA 2VHFA 1ICFA 3IUTA 3BCNA 4AXMA 1PPDA 2P86A 1GECE 1MEMA 2P7UA 2B1MA 1Q6KA 2XU5A 2YJ9A 1HUCB 1VJVA 1U9QX 2CIOA 1STFE 1ZCMA 2B1NA 4DMYA 3BPMA 2AVWA 3F75A 3ZUAA 1QDQA 1PADA 4FJCA 5FPWA 2DZZA 2DCDA 1AYWA 2OZ2A 1MDWA 4WA6A 1MEGA 3LXSA 3IOQA 4MZSA 3KX1A 3S3QA 3HHIA 3MHSA 5J94A 2VHSA 3OF8A 3MTNA 1CSBB 1TL9A 2FRQA 3LFYA 3IHPA 4RY2A 3S3RA 2NQAA 1SNKA 2XU3A 4FK5A 3K8UA 2HH5A 4P6GA 4YYVA 5A24A 4BQVA 3OVZA 1F2AA 3MORA 1AYVA 1QXPA 2Y5BA 2GFOA 2FT2A 2ARYA 2YJCA 3KW9A 5JH3A 1POPA 1PPOA 1NB5A 1QOLA 2E01A 4QRXA 3WXGA 1NQCA 1U9XA 2HXZA 1BQIA 1K3BB 4KLBA 2YJBA 4FIPA 3HWNA 1CPJA 3V6EA 1ME4A 4N79A 1BP4A 4K7CA 1AU2A 1S4VA 7PCKA 4OELA 3N3KA 4I07A 3IEJA 5JA7A 4YYRA 1F2CA 3H7DA 1MIRA 5PADA 5K16A 1NPZA 4X6IA 4W5BA 4CDFB 4DMXA 1AU0A 2R9OA 1VSNA 1PE6A 2R9FA 4PP1A 2R6NA 2HHNA 1U9WA 1ZIVA 4P6EA 1PBHA 1FH0A 4YYSA 1AECA 3D6SA 3CH2X 2PBHA 2DC8A 2O6XA 2Y6EA 3I3TA 3QT4A 2H7JA 3BPFA 3N4CA 4PADA 2AU1A 3PDFA 4I04A 3BWKA 2G8JA 3KWBX 3O0UA 1U5IA 3HHAA 2YJ8A 2DC9A 3B79A 1X9YA 1CV8A 1F29A 1NLJA 4QBBA 3H89A 1Y08A 1ITOA 2AS8A 2NQDB 2G7YA 1AIMA
chains in the Genus database with same CATH superfamily
1BY8A 2DJFB 9PAPA 2BDLA 4YYWA 3P5WA 5JZEA 3RVXA 3OF9A 2R9CA 2IBIA 2ATOA 4MZOA 3HD3A 3E9SA 2P0RA 1YK7A 2G6DA 1IWDA 2DOSA 4PP2E 3BOWA 1AU4A 4YV8A 2BDZA 4BS6A 3KKUA 4REZA 1F2BA 1MHWA 4YVAA 1MS6A 3QJ3A 4N8WA 3USVA 3TNXA 4QH6A 2PADA 3CBJA 3BB7A 1EWOA 4XR7A 1PIPA 2J7QC 4QRGA 2XU4A 3K9MA 3KWZA 1GMYA 4N4ZA 2AIMA 3M99A 2AYOA 2HD5A 1PPNA 3BC3A 3H8CA 2WBFX 4W4UA 4CDCB 1CS8A 4BOUA 2GHUA 2XU1A 1YT7A 1CVZA 1NB3A 4AXLA 2BTWB 2R9MA 1KFXL 3W30A 3AI8A 4CDEB 3KSEA 3DF0A 1NL6A 4M0WA 2DCCA 5EZQA 2BU3A 3E1ZB 3U8EA 2DCBA 2DC6A 2AYNA 1TLOA 4OEMA 4BOSA 2C0YA 3MHHA 3IV2A 1EF7A 1ATKA 4XZXA 4YYQA 2JRIA 1O0EA 3IMAA 3K24A 2CB5A 3RVWA 3F5VA 4MI7A 3PNRA 1M6DA 2NQIA 3NHEA 5CHTA 1PCIA 2F1GA 3H6SA 2FUDA 1CQDA 4BPVA 3CBKA 4D8EA 3PT2A 3PHXA 5EF4A 5F02A 2FTDA 1UKFA 3IFUA 1GCBA 1DF0A 3B21A 3ERVA 5CVMA 2DZYA 2OP3A 2E02A 4X6JA 4BOPA 4YYUA 3GCBA 3WXEA 5CVOB 5EGWA 2FRAA 2PREA 2DCAA 3PSEA 3OISA 3OQCA 3I06A 4OVZA 5CVNB 1CB5A 2FQ9A 1THEA 4HWYA 1YALA 4HXDB 1PVJA 4CDDB 2G8EA 2DC7A 4Q8GA 1KHPA 1DEUA 3V6CA 2R9NA 3P5VA 3ZNHA 4RNAA 3PW3A 1BGOA 1U9VA 3WXFA 2F7DA 4BS5A 2JQFR 3OVXA 2OULA 3O1GA 4XUIA 1CTEA 1YK8A 4CZWA 1KHQA 2JQGR 4RF0A 4MSXA 1YZBA 1AYUA 1KXRA 2YJ2A 8PCHA 4I05A 4A5UA 1PPPA 4IUMA 1YVBA 1JQPA 2FYEA 2AUZA 1QMYA 2DJGB 2E00A 1XKGA 2BTWA 1ME3A 2HWKA 4X6HA 3KFQA 2E03A 1EWMA 3RVVA 2AUXA 3H8BA 3P5XA 1SP4B 2ACTA 4W5CA 1GLOA 1TU6A 6PADA 4ZUXU 2PNSA 3QSDA 4BSQA 3C9EA 3P5UA 3N3GA 1KFUL 3CH3X 2NQGA 2FO5A 1EWLA 4GUAA 1A6RA 4D8BA 4ZTBA 2IPPB 1AU3A 3PBHA 1EWPA 1PXVA 5CHVA 1CJLA 4PI3A 4QRVA 3BY4A 4Q8HA 4G54A 1Y4HA 2VHFA 1ICFA 3IUTA 3BCNA 4AXMA 1PPDA 2P86A 1GECE 1MEMA 4R3DA 2P7UA 2B1MA 1Q6KA 3O65A 3W31A 2XU5A 2YJ9A 3PRMA 1HUCB 1VJVA 1U9QX 2CIOA 5EZSA 1STFE 1ZCMA 2B1NA 3TRKA 3BPMA 4DMYA 3BBAA 2AVWA 3F75A 3ZUAA 1QDQA 1PADA 4FJCA 4PT5A 5FPWA 3TMPA 4WURA 2DZZA 4RKXA 2DCDA 4RF1A 1AYWA 2OZ2A 1MDWA 4WA6A 1MEGA 3MP2A 3LXSA 3IOQA 4MZSA 3KX1A 3S3QA 3HHIA 3MHSA 4P16A 2VHSA 5J94A 3OF8A 3MTNA 1CSBB 1TL9A 2FRQA 4OW0A 3LFYA 3IHPA 4RY2A 3S3RA 2NQAA 2J7QA 1SNKA 2XU3A 4FK5A 3K8UA 2HH5A 4P6GA 4BOZA 4YYVA 5A24A 4BQVA 3OVZA 1F2AA 3MORA 1DKIA 1AYVA 1QXPA 2JTCA 2Y5BA 2GFOA 2FT2A 2ARYA 2YJCA 3KW9A 5JH3A 1POPA 5KO3A 1PPOA 1NB5A 1QOLA 2E01A 4QRXA 3WXGA 1NQCA 1U9XA 2HXZA 1BQIA 1K3BB 4OVZB 4KLBA 2YJBA 4FIPA 3HWNA 1CPJA 3V6EA 1ME4A 4N79A 1BP4A 4K7CA 1AU2A 1S4VA 7PCKA 3PHWA 4OELA 3N3KA 5E6JA 2UZJA 4I07A 4IP3A 3RNVA 3IEJA 5JA7A 4YYRA 1F2CA 3H7DA 1MIRA 5PADA 5K16A 3MJ5A 1NPZA 4BOQA 4X6IA 4W5BA 4CDFB 4DMXA 1AU0A 2R9OA 1VSNA 1PE6A 2R9FA 4PP1A 2R6NA 2HHNA 1U9WA 1ZIVA 4P6EA 1PBHA 1FH0A 4YYSA 1AECA 3D6SA 3CH2X 2PBHA 2AGAA 2DC8A 2O6XA 2Y6EA 3I3TA 3QT4A 2H7JA 3BPFA 3N4CA 4PADA 2AU1A 3MTVA 3PDFA 4I04A 3BWKA 3PHUA 2G8JA 3KWBX 3O0UA 1U5IA 3HHAA 2YJ8A 2DC9A 4D8IA 3C0RA 3PRPA 3B79A 1X9YA 1CV8A 1F29A 1NLJA 2Z84A 4QBBA 4MM3B 3H89A 1Y08A 1ITOA 2AS8A 2FE8A 2NQDB 2G7YA 1AIMA
chains in the Genus database with same CATH topology
1BY8A 2DJFB 9PAPA 2BDLA 4YYWA 3P5WA 3RVXA 3OF9A 2R9CA 2IBIA 2ATOA 4MZOA 3HD3A 2P0RA 1YK7A 2G6DA 1IWDA 4PP2E 3BOWA 1AU4A 4YV8A 2BDZA 4BS6A 4B55A 3KKUA 1F2BA 1MHWA 4YVAA 1MS6A 3QJ3A 4N8WA 3USVA 3TNXA 4QH6A 2PADA 3CBJA 1EWOA 4XR7A 1PIPA 4QRGA 2XU4A 3K9MA 1W6FA 3KWZA 1GMYA 4N4ZA 2AIMA 3M99A 2AYOA 2HD5A 1PPNA 3BC3A 3H8CA 2WBFX 4W4UA 1W4TA 4CDCB 1CS8A 2GHUA 2XU1A 1YT7A 1CVZA 1NB3A 4AXLA 2R9MA 1KFXL 3AI8A 4CDEB 3KSEA 3DF0A 1NL6A 2DCCA 3E1ZB 3U8EA 2DCBA 2BSZA 2DC6A 2AYNA 1TLOA 4OEMA 2C0YA 3MHHA 3IV2A 1EF7A 1ATKA 4YYQA 1O0EA 3IMAA 3K24A 2CB5A 3RVWA 3F5VA 3PNRA 1M6DA 2NQIA 3NHEA 5CHTA 1PCIA 2F1GA 3H6SA 2FUDA 1CQDA 4BPVA 3CBKA 4NV7A 5EF4A 5F02A 2FTDA 1GCBA 1DF0A 3ERVA 5CVMA 2DZYA 2OP3A 2E02A 4X6JA 4YYUA 3GCBA 3WXEA 5CVOB 5EGWA 2FRAA 2PREA 2DCAA 4GUZA 3OISA 4BGFA 3I06A 5CVNB 1CB5A 2FQ9A 1THEA 4HWYA 1YALA 4CDDB 2G8EA 2VFCA 2DC7A 4Q8GA 1KHPA 1DEUA 3V6CA 2R9NA 3P5VA 3PW3A 1BGOA 1U9VA 3WXFA 2F7DA 4BS5A 2JQFR 3OVXA 2OULA 3O1GA 4XUIA 1CTEA 1YK8A 4CZWA 1KHQA 2JQGR 4MSXA 1AYUA 1KXRA 2YJ2A 8PCHA 4I05A 1PPPA 1YVBA 1JQPA 2FYEA 2AUZA 1QMYA 2DJGB 2E00A 1XKGA 1ME3A 4X6HA 3KFQA 2E03A 1EWMA 3RVVA 2AUXA 3H8BA 3P5XA 1SP4B 2ACTA 4W5CA 1GLOA 1TU6A 6PADA 4ZUXU 2PNSA 3QSDA 4NV8A 4BSQA 3C9EA 3P5UA 3N3GA 1GX3A 1KFUL 3CH3X 2NQGA 2FO5A 1W5RA 1EWLA 1A6RA 2IPPB 1AU3A 3PBHA 1EWPA 1PXVA 5CHVA 1CJLA 4PI3A 4QRVA 4Q8HA 4G54A 1Y4HA 2VFBA 2VHFA 1ICFA 3IUTA 3BCNA 4AXMA 1PPDA 2P86A 1GECE 1MEMA 2P7UA 2B1MA 1Q6KA 3LTWA 2XU5A 2YJ9A 1HUCB 1VJVA 1U9QX 2CIOA 1STFE 1ZCMA 2B1NA 4DMYA 3BPMA 2AVWA 3F75A 3ZUAA 1QDQA 1PADA 4FJCA 5FPWA 2DZZA 2DCDA 1AYWA 2OZ2A 1MDWA 4WA6A 1MEGA 3LXSA 3IOQA 4MZSA 3KX1A 3S3QA 3HHIA 3MHSA 5J94A 2VHSA 3OF8A 3MTNA 1CSBB 1TL9A 2FRQA 3LFYA 3IHPA 4RY2A 3S3RA 2NQAA 1SNKA 2XU3A 4FK5A 3K8UA 2HH5A 4P6GA 4YYVA 5A24A 4BQVA 3OVZA 1F2AA 3MORA 1AYVA 1QXPA 2Y5BA 2GFOA 2FT2A 2ARYA 2YJCA 3KW9A 5JH3A 1POPA 1PPOA 1NB5A 1QOLA 2E01A 4QRXA 3WXGA 1NQCA 1U9XA 2HXZA 1BQIA 1K3BB 4KLBA 2YJBA 4FIPA 3HWNA 1CPJA 3V6EA 1ME4A 4N79A 1BP4A 4K7CA 1AU2A 1S4VA 4C5PA 7PCKA 4OELA 3N3KA 4I07A 3IEJA 5JA7A 4YYRA 1F2CA 3H7DA 1MIRA 5PADA 5K16A 1NPZA 4X6IA 4W5BA 4CDFB 4DMXA 1AU0A 2R9OA 1VSNA 1PE6A 2R9FA 4PP1A 2R6NA 2HHNA 1U9WA 1ZIVA 4P6EA 1PBHA 1FH0A 4YYSA 1AECA 3D6SA 3CH2X 2PBHA 2DC8A 2O6XA 2Y6EA 3I3TA 3QT4A 2H7JA 3BPFA 3N4CA 4PADA 2AU1A 3PDFA 4I04A 3BWKA 2G8JA 3KWBX 3O0UA 1U5IA 3HHAA 2YJ8A 2DC9A 3B79A 1X9YA 1CV8A 1F29A 1NLJA 3D9WA 4QBBA 3H89A 1Y08A 1ITOA 1E2TA 2AS8A 2NQDB 2G7YA 1AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BY8 A;  2DJF B;  9PAP A;  2BDL A;  4YYW A;  3P5W A;  3RVX A;  3OF9 A;  2R9C A;  2IBI A;  2ATO A;  4MZO A;  3HD3 A;  2P0R A;  1YK7 A;  2G6D A;  1IWD A;  4PP2 E;  3BOW A;  1AU4 A;  4YV8 A;  2BDZ A;  4BS6 A;  3KKU A;  1F2B A;  1MHW A;  4YVA A;  1MS6 A;  3QJ3 A;  4N8W A;  3USV A;  3TNX A;  4QH6 A;  2PAD A;  3CBJ A;  1EWO A;  4XR7 A;  1PIP A;  4QRG A;  2XU4 A;  3K9M A;  3KWZ A;  1GMY A;  4N4Z A;  2AIM A;  3M99 A;  2AYO A;  2HD5 A;  1PPN A;  3BC3 A;  3H8C A;  2WBF X;  4W4U A;  4CDC B;  1CS8 A;  2GHU A;  2XU1 A;  1YT7 A;  1CVZ A;  1NB3 A;  4AXL A;  2R9M A;  1KFX L;  3AI8 A;  4CDE B;  3KSE A;  3DF0 A;  1NL6 A;  2DCC A;  3E1Z B;  3U8E A;  2DCB A;  2DC6 A;  2AYN A;  1TLO A;  4OEM A;  2C0Y A;  3MHH A;  3IV2 A;  1EF7 A;  1ATK A;  4YYQ A;  1O0E A;  3IMA A;  3K24 A;  2CB5 A;  3RVW A;  3F5V A;  3PNR A;  1M6D A;  2NQI A;  3NHE A;  5CHT A;  1PCI A;  2F1G A;  3H6S A;  2FUD A;  1CQD A;  4BPV A;  3CBK A;  5EF4 A;  5F02 A;  2FTD A;  1GCB A;  1DF0 A;  3ERV A;  5CVM A;  2DZY A;  2OP3 A;  2E02 A;  4X6J A;  4YYU A;  3GCB A;  3WXE A;  5CVO B;  5EGW A;  2FRA A;  2PRE A;  2DCA A;  3OIS A;  3I06 A;  5CVN B;  1CB5 A;  2FQ9 A;  1THE A;  4HWY A;  1YAL A;  4CDD B;  2G8E A;  2DC7 A;  4Q8G A;  1KHP A;  1DEU A;  3V6C A;  2R9N A;  3P5V A;  3PW3 A;  1BGO A;  1U9V A;  3WXF A;  2F7D A;  4BS5 A;  2JQF R;  3OVX A;  2OUL A;  3O1G A;  4XUI A;  1CTE A;  1YK8 A;  4CZW A;  1KHQ A;  2JQG R;  4MSX A;  1AYU A;  1KXR A;  2YJ2 A;  8PCH A;  4I05 A;  1PPP A;  1YVB A;  1JQP A;  2FYE A;  2AUZ A;  1QMY A;  2DJG B;  2E00 A;  1XKG A;  1ME3 A;  4X6H A;  3KFQ A;  2E03 A;  1EWM A;  3RVV A;  2AUX A;  3H8B A;  3P5X A;  1SP4 B;  2ACT A;  4W5C A;  1GLO A;  1TU6 A;  6PAD A;  4ZUX U;  2PNS A;  3QSD A;  4BSQ A;  3C9E A;  3P5U A;  3N3G A;  1KFU L;  3CH3 X;  2NQG A;  2FO5 A;  1EWL A;  1A6R A;  2IPP B;  1AU3 A;  3PBH A;  1EWP A;  1PXV A;  5CHV A;  1CJL A;  4PI3 A;  4QRV A;  4Q8H A;  4G54 A;  1Y4H A;  2VHF A;  1ICF A;  3IUT A;  3BCN A;  4AXM A;  1PPD A;  2P86 A;  1GEC E;  1MEM A;  2P7U A;  2B1M A;  1Q6K A;  2XU5 A;  2YJ9 A;  1HUC B;  1VJV A;  1U9Q X;  2CIO A;  1STF E;  1ZCM A;  2B1N A;  4DMY A;  3BPM A;  2AVW A;  3F75 A;  3ZUA A;  1QDQ A;  1PAD A;  4FJC A;  5FPW A;  2DZZ A;  2DCD A;  1AYW A;  2OZ2 A;  1MDW A;  4WA6 A;  1MEG A;  3LXS A;  3IOQ A;  4MZS A;  3KX1 A;  3S3Q A;  3HHI A;  3MHS A;  5J94 A;  2VHS A;  3OF8 A;  3MTN A;  1CSB B;  1TL9 A;  2FRQ A;  3LFY A;  3IHP A;  4RY2 A;  3S3R A;  2NQA A;  1SNK A;  2XU3 A;  4FK5 A;  3K8U A;  2HH5 A;  4P6G A;  4YYV A;  5A24 A;  4BQV A;  3OVZ A;  1F2A A;  3MOR A;  1AYV A;  1QXP A;  2Y5B A;  2GFO A;  2FT2 A;  2ARY A;  2YJC A;  3KW9 A;  5JH3 A;  1POP A;  1PPO A;  1NB5 A;  1QOL A;  2E01 A;  4QRX A;  3WXG A;  1NQC A;  1U9X A;  2HXZ A;  1BQI A;  1K3B B;  4KLB A;  2YJB A;  4FIP A;  3HWN A;  1CPJ A;  3V6E A;  1ME4 A;  4N79 A;  1BP4 A;  4K7C A;  1AU2 A;  1S4V A;  7PCK A;  4OEL A;  3N3K A;  4I07 A;  3IEJ A;  5JA7 A;  4YYR A;  1F2C A;  3H7D A;  1MIR A;  5PAD A;  5K16 A;  1NPZ A;  4X6I A;  4W5B A;  4CDF B;  4DMX A;  1AU0 A;  2R9O A;  1VSN A;  1PE6 A;  2R9F A;  4PP1 A;  2R6N A;  2HHN A;  1U9W A;  1ZIV A;  4P6E A;  1PBH A;  1FH0 A;  4YYS A;  1AEC A;  3D6S A;  3CH2 X;  2PBH A;  2DC8 A;  2O6X A;  2Y6E A;  3I3T A;  3QT4 A;  2H7J A;  3BPF A;  3N4C A;  4PAD A;  2AU1 A;  3PDF A;  4I04 A;  3BWK A;  2G8J A;  3KWB X;  3O0U A;  1U5I A;  3HHA A;  2YJ8 A;  2DC9 A;  3B79 A;  1X9Y A;  1CV8 A;  1F29 A;  1NLJ A;  4QBB A;  3H89 A;  1Y08 A;  1ITO A;  2AS8 A;  2NQD B;  2G7Y A;  1AIM A; 
#chains in the Genus database with same CATH topology
 1BY8 A;  2DJF B;  9PAP A;  2BDL A;  4YYW A;  3P5W A;  5JZE A;  3RVX A;  3OF9 A;  2R9C A;  2IBI A;  2ATO A;  4MZO A;  3HD3 A;  3E9S A;  2P0R A;  1YK7 A;  2G6D A;  1IWD A;  2DOS A;  4PP2 E;  3BOW A;  1AU4 A;  4YV8 A;  2BDZ A;  4BS6 A;  3KKU A;  4REZ A;  1F2B A;  1MHW A;  4YVA A;  1MS6 A;  3QJ3 A;  4N8W A;  3USV A;  3TNX A;  4QH6 A;  2PAD A;  3CBJ A;  3BB7 A;  1EWO A;  4XR7 A;  1PIP A;  2J7Q C;  4QRG A;  2XU4 A;  3K9M A;  3KWZ A;  1GMY A;  4N4Z A;  2AIM A;  3M99 A;  2AYO A;  2HD5 A;  1PPN A;  3BC3 A;  3H8C A;  2WBF X;  4W4U A;  4CDC B;  1CS8 A;  4BOU A;  2GHU A;  2XU1 A;  1YT7 A;  1CVZ A;  1NB3 A;  4AXL A;  2BTW B;  2R9M A;  1KFX L;  3W30 A;  3AI8 A;  4CDE B;  3KSE A;  3DF0 A;  1NL6 A;  4M0W A;  2DCC A;  5EZQ A;  2BU3 A;  3E1Z B;  3U8E A;  2DCB A;  2DC6 A;  2AYN A;  1TLO A;  4OEM A;  4BOS A;  2C0Y A;  3MHH A;  3IV2 A;  1EF7 A;  1ATK A;  4XZX A;  4YYQ A;  2JRI A;  1O0E A;  3IMA A;  3K24 A;  2CB5 A;  3RVW A;  3F5V A;  4MI7 A;  3PNR A;  1M6D A;  2NQI A;  3NHE A;  5CHT A;  1PCI A;  2F1G A;  3H6S A;  2FUD A;  1CQD A;  4BPV A;  3CBK A;  4D8E A;  3PT2 A;  3PHX A;  5EF4 A;  5F02 A;  2FTD A;  1UKF A;  3IFU A;  1GCB A;  1DF0 A;  3B21 A;  3ERV A;  5CVM A;  2DZY A;  2OP3 A;  2E02 A;  4X6J A;  4BOP A;  4YYU A;  3GCB A;  3WXE A;  5CVO B;  5EGW A;  2FRA A;  2PRE A;  2DCA A;  3PSE A;  3OIS A;  3OQC A;  3I06 A;  4OVZ A;  5CVN B;  1CB5 A;  2FQ9 A;  1THE A;  4HWY A;  1YAL A;  4HXD B;  1PVJ A;  4CDD B;  2G8E A;  2DC7 A;  4Q8G A;  1KHP A;  1DEU A;  3V6C A;  2R9N A;  3P5V A;  3ZNH A;  4RNA A;  3PW3 A;  1BGO A;  1U9V A;  3WXF A;  2F7D A;  4BS5 A;  2JQF R;  3OVX A;  2OUL A;  3O1G A;  4XUI A;  1CTE A;  1YK8 A;  4CZW A;  1KHQ A;  2JQG R;  4RF0 A;  4MSX A;  1YZB A;  1AYU A;  1KXR A;  2YJ2 A;  8PCH A;  4I05 A;  4A5U A;  1PPP A;  4IUM A;  1YVB A;  1JQP A;  2FYE A;  2AUZ A;  1QMY A;  2DJG B;  2E00 A;  1XKG A;  2BTW A;  1ME3 A;  2HWK A;  4X6H A;  3KFQ A;  2E03 A;  1EWM A;  3RVV A;  2AUX A;  3H8B A;  3P5X A;  1SP4 B;  2ACT A;  4W5C A;  1GLO A;  1TU6 A;  6PAD A;  4ZUX U;  2PNS A;  3QSD A;  4BSQ A;  3C9E A;  3P5U A;  3N3G A;  1KFU L;  3CH3 X;  2NQG A;  2FO5 A;  1EWL A;  4GUA A;  1A6R A;  4D8B A;  4ZTB A;  2IPP B;  1AU3 A;  3PBH A;  1EWP A;  1PXV A;  5CHV A;  1CJL A;  4PI3 A;  4QRV A;  3BY4 A;  4Q8H A;  4G54 A;  1Y4H A;  2VHF A;  1ICF A;  3IUT A;  3BCN A;  4AXM A;  1PPD A;  2P86 A;  1GEC E;  1MEM A;  4R3D A;  2P7U A;  2B1M A;  1Q6K A;  3O65 A;  3W31 A;  2XU5 A;  2YJ9 A;  3PRM A;  1HUC B;  1VJV A;  1U9Q X;  2CIO A;  5EZS A;  1STF E;  1ZCM A;  2B1N A;  3TRK A;  3BPM A;  4DMY A;  3BBA A;  2AVW A;  3F75 A;  3ZUA A;  1QDQ A;  1PAD A;  4FJC A;  4PT5 A;  5FPW A;  3TMP A;  4WUR A;  2DZZ A;  4RKX A;  2DCD A;  4RF1 A;  1AYW A;  2OZ2 A;  1MDW A;  4WA6 A;  1MEG A;  3MP2 A;  3LXS A;  3IOQ A;  4MZS A;  3KX1 A;  3S3Q A;  3HHI A;  3MHS A;  4P16 A;  2VHS A;  5J94 A;  3OF8 A;  3MTN A;  1CSB B;  1TL9 A;  2FRQ A;  4OW0 A;  3LFY A;  3IHP A;  4RY2 A;  3S3R A;  2NQA A;  2J7Q A;  1SNK A;  2XU3 A;  4FK5 A;  3K8U A;  2HH5 A;  4P6G A;  4BOZ A;  4YYV A;  5A24 A;  4BQV A;  3OVZ A;  1F2A A;  3MOR A;  1DKI A;  1AYV A;  1QXP A;  2JTC A;  2Y5B A;  2GFO A;  2FT2 A;  2ARY A;  2YJC A;  3KW9 A;  5JH3 A;  1POP A;  5KO3 A;  1PPO A;  1NB5 A;  1QOL A;  2E01 A;  4QRX A;  3WXG A;  1NQC A;  1U9X A;  2HXZ A;  1BQI A;  1K3B B;  4OVZ B;  4KLB A;  2YJB A;  4FIP A;  3HWN A;  1CPJ A;  3V6E A;  1ME4 A;  4N79 A;  1BP4 A;  4K7C A;  1AU2 A;  1S4V A;  7PCK A;  3PHW A;  4OEL A;  3N3K A;  5E6J A;  2UZJ A;  4I07 A;  4IP3 A;  3RNV A;  3IEJ A;  5JA7 A;  4YYR A;  1F2C A;  3H7D A;  1MIR A;  5PAD A;  5K16 A;  3MJ5 A;  1NPZ A;  4BOQ A;  4X6I A;  4W5B A;  4CDF B;  4DMX A;  1AU0 A;  2R9O A;  1VSN A;  1PE6 A;  2R9F A;  4PP1 A;  2R6N A;  2HHN A;  1U9W A;  1ZIV A;  4P6E A;  1PBH A;  1FH0 A;  4YYS A;  1AEC A;  3D6S A;  3CH2 X;  2PBH A;  2AGA A;  2DC8 A;  2O6X A;  2Y6E A;  3I3T A;  3QT4 A;  2H7J A;  3BPF A;  3N4C A;  4PAD A;  2AU1 A;  3MTV A;  3PDF A;  4I04 A;  3BWK A;  3PHU A;  2G8J A;  3KWB X;  3O0U A;  1U5I A;  3HHA A;  2YJ8 A;  2DC9 A;  4D8I A;  3C0R A;  3PRP A;  3B79 A;  1X9Y A;  1CV8 A;  1F29 A;  1NLJ A;  2Z84 A;  4QBB A;  4MM3 B;  3H89 A;  1Y08 A;  1ITO A;  2AS8 A;  2FE8 A;  2NQD B;  2G7Y A;  1AIM A; 
#chains in the Genus database with same CATH homology
 1BY8 A;  2DJF B;  9PAP A;  2BDL A;  4YYW A;  3P5W A;  3RVX A;  3OF9 A;  2R9C A;  2IBI A;  2ATO A;  4MZO A;  3HD3 A;  2P0R A;  1YK7 A;  2G6D A;  1IWD A;  4PP2 E;  3BOW A;  1AU4 A;  4YV8 A;  2BDZ A;  4BS6 A;  4B55 A;  3KKU A;  1F2B A;  1MHW A;  4YVA A;  1MS6 A;  3QJ3 A;  4N8W A;  3USV A;  3TNX A;  4QH6 A;  2PAD A;  3CBJ A;  1EWO A;  4XR7 A;  1PIP A;  4QRG A;  2XU4 A;  3K9M A;  1W6F A;  3KWZ A;  1GMY A;  4N4Z A;  2AIM A;  3M99 A;  2AYO A;  2HD5 A;  1PPN A;  3BC3 A;  3H8C A;  2WBF X;  4W4U A;  1W4T A;  4CDC B;  1CS8 A;  2GHU A;  2XU1 A;  1YT7 A;  1CVZ A;  1NB3 A;  4AXL A;  2R9M A;  1KFX L;  3AI8 A;  4CDE B;  3KSE A;  3DF0 A;  1NL6 A;  2DCC A;  3E1Z B;  3U8E A;  2DCB A;  2BSZ A;  2DC6 A;  2AYN A;  1TLO A;  4OEM A;  2C0Y A;  3MHH A;  3IV2 A;  1EF7 A;  1ATK A;  4YYQ A;  1O0E A;  3IMA A;  3K24 A;  2CB5 A;  3RVW A;  3F5V A;  3PNR A;  1M6D A;  2NQI A;  3NHE A;  5CHT A;  1PCI A;  2F1G A;  3H6S A;  2FUD A;  1CQD A;  4BPV A;  3CBK A;  4NV7 A;  5EF4 A;  5F02 A;  2FTD A;  1GCB A;  1DF0 A;  3ERV A;  5CVM A;  2DZY A;  2OP3 A;  2E02 A;  4X6J A;  4YYU A;  3GCB A;  3WXE A;  5CVO B;  5EGW A;  2FRA A;  2PRE A;  2DCA A;  4GUZ A;  3OIS A;  4BGF A;  3I06 A;  5CVN B;  1CB5 A;  2FQ9 A;  1THE A;  4HWY A;  1YAL A;  4CDD B;  2G8E A;  2VFC A;  2DC7 A;  4Q8G A;  1KHP A;  1DEU A;  3V6C A;  2R9N A;  3P5V A;  3PW3 A;  1BGO A;  1U9V A;  3WXF A;  2F7D A;  4BS5 A;  2JQF R;  3OVX A;  2OUL A;  3O1G A;  4XUI A;  1CTE A;  1YK8 A;  4CZW A;  1KHQ A;  2JQG R;  4MSX A;  1AYU A;  1KXR A;  2YJ2 A;  8PCH A;  4I05 A;  1PPP A;  1YVB A;  1JQP A;  2FYE A;  2AUZ A;  1QMY A;  2DJG B;  2E00 A;  1XKG A;  1ME3 A;  4X6H A;  3KFQ A;  2E03 A;  1EWM A;  3RVV A;  2AUX A;  3H8B A;  3P5X A;  1SP4 B;  2ACT A;  4W5C A;  1GLO A;  1TU6 A;  6PAD A;  4ZUX U;  2PNS A;  3QSD A;  4NV8 A;  4BSQ A;  3C9E A;  3P5U A;  3N3G A;  1GX3 A;  1KFU L;  3CH3 X;  2NQG A;  2FO5 A;  1W5R A;  1EWL A;  1A6R A;  2IPP B;  1AU3 A;  3PBH A;  1EWP A;  1PXV A;  5CHV A;  1CJL A;  4PI3 A;  4QRV A;  4Q8H A;  4G54 A;  1Y4H A;  2VFB A;  2VHF A;  1ICF A;  3IUT A;  3BCN A;  4AXM A;  1PPD A;  2P86 A;  1GEC E;  1MEM A;  2P7U A;  2B1M A;  1Q6K A;  3LTW A;  2XU5 A;  2YJ9 A;  1HUC B;  1VJV A;  1U9Q X;  2CIO A;  1STF E;  1ZCM A;  2B1N A;  4DMY A;  3BPM A;  2AVW A;  3F75 A;  3ZUA A;  1QDQ A;  1PAD A;  4FJC A;  5FPW A;  2DZZ A;  2DCD A;  1AYW A;  2OZ2 A;  1MDW A;  4WA6 A;  1MEG A;  3LXS A;  3IOQ A;  4MZS A;  3KX1 A;  3S3Q A;  3HHI A;  3MHS A;  5J94 A;  2VHS A;  3OF8 A;  3MTN A;  1CSB B;  1TL9 A;  2FRQ A;  3LFY A;  3IHP A;  4RY2 A;  3S3R A;  2NQA A;  1SNK A;  2XU3 A;  4FK5 A;  3K8U A;  2HH5 A;  4P6G A;  4YYV A;  5A24 A;  4BQV A;  3OVZ A;  1F2A A;  3MOR A;  1AYV A;  1QXP A;  2Y5B A;  2GFO A;  2FT2 A;  2ARY A;  2YJC A;  3KW9 A;  5JH3 A;  1POP A;  1PPO A;  1NB5 A;  1QOL A;  2E01 A;  4QRX A;  3WXG A;  1NQC A;  1U9X A;  2HXZ A;  1BQI A;  1K3B B;  4KLB A;  2YJB A;  4FIP A;  3HWN A;  1CPJ A;  3V6E A;  1ME4 A;  4N79 A;  1BP4 A;  4K7C A;  1AU2 A;  1S4V A;  4C5P A;  7PCK A;  4OEL A;  3N3K A;  4I07 A;  3IEJ A;  5JA7 A;  4YYR A;  1F2C A;  3H7D A;  1MIR A;  5PAD A;  5K16 A;  1NPZ A;  4X6I A;  4W5B A;  4CDF B;  4DMX A;  1AU0 A;  2R9O A;  1VSN A;  1PE6 A;  2R9F A;  4PP1 A;  2R6N A;  2HHN A;  1U9W A;  1ZIV A;  4P6E A;  1PBH A;  1FH0 A;  4YYS A;  1AEC A;  3D6S A;  3CH2 X;  2PBH A;  2DC8 A;  2O6X A;  2Y6E A;  3I3T A;  3QT4 A;  2H7J A;  3BPF A;  3N4C A;  4PAD A;  2AU1 A;  3PDF A;  4I04 A;  3BWK A;  2G8J A;  3KWB X;  3O0U A;  1U5I A;  3HHA A;  2YJ8 A;  2DC9 A;  3B79 A;  1X9Y A;  1CV8 A;  1F29 A;  1NLJ A;  3D9W A;  4QBB A;  3H89 A;  1Y08 A;  1ITO A;  1E2T A;  2AS8 A;  2NQD B;  2G7Y A;  1AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...