4PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4padA00
2R9OA 1U9VA 2HD5A 2DCAA 1QDQA 1POPA 4N4ZA 1NQCA 4X6IA 3I06A 3MHHA 2DC9A 4YYRA 4YYWA 4X6JA 2NQGA 1PPOA 1QXPA 1YK8A 3H89A 1BGOA 1GLOA 1ITOA 3KKUA 1MEGA 4N79A 3S3QA 1PPNA 4BS5A 3KFQA 2DJFB 2NQIA 1KFXL 2PADA 4XR7A 2AYNA 3OF9A 4I05A 3H8CA 2E03A 5CHVA 3U8EA 2DC8A 1EWLA 5FPWA 1FH0A 3MTNA 4KLBA 1QMYA 1A6RA 4BS6A 5EGWA 1ATKA 1YK7A 1GCBA 3KWBX 3H8BA 4FJCA 3QSDA 2F7DA 1PADA 2HXZA 5EF4A 1U9QX 3CH2X 2DCCA 1F29A 1CJLA 2ARYA 3E1ZB 1U9XA 4BPVA 2XU1A 1Q6KA 4BQVA 1YALA 4CZWA 5CHTA 3KW9A 3F5VA 1VSNA 2OZ2A 3I3TA 3RVXA 3K8UA 2FT2A 8PCHA 4YYVA 3RVVA 4K7CA 3O0UA 2B1MA 4G54A 1SNKA 2DZZA 5CVNB 3CBKA 1AYUA 1MIRA 3H6SA 4CDEB 4PI3A 2AU1A 2FUDA 1CVZA 2IBIA 1KHQA 1IWDA 1TL9A 3V6EA 1KFUL 1YT7A 7PCKA 3M99A 3WXGA 1F2BA 1AIMA 1AU3A 3C9EA 2R6NA 4QBBA 1VJVA 2YJ9A 3CH3X 1PXVA 3HD3A 3N4CA 4DMYA 1PPDA 2OULA 2AUXA 4ZUXU 1GMYA 1CQDA 5PADA 2YJ2A 3N3GA 1AU0A 4FK5A 2E01A 3IV2A 1CS8A 2XU4A 1QOLA 3P5UA 2JQFR 4AXMA 2P7UA 1AECA 2P0RA 4PADA 4YYSA 3QJ3A 1MS6A 1NPZA 3TNXA 3BPMA 3D6SA 3RVWA 3IHPA 2E02A 4MZSA 3P5VA 1Y08A 4XUIA 2AVWA 2DCDA 2XU5A 1EWPA 3NHEA 2JQGR 3S3RA 2CIOA 3P5WA 3PBHA 2YJCA 3IEJA 1CPJA 1BQIA 4Q8GA 1EWOA 1MDWA 2BDLA 3IMAA 1JQPA 5CVMA 1CTEA 1SP4B 1NB5A 2FRAA 1CV8A 1BP4A 2YJ8A 1TLOA 5JH3A 4OELA 1X9YA 3MHSA 1ICFA 1AYWA 3USVA 3KX1A 2G6DA 2B1NA 3WXEA 2F1GA 4YYQA 3IUTA 3PNRA 5K16A 4YYUA 3K9MA 2HH5A 2R9CA 2AS8A 3H7DA 4AXLA 3OISA 2FRQA 2Y6EA 3KWZA 2AUZA 1AU2A 2C0YA 5A24A 2R9FA 2BDZA 2FYEA 1ME4A 1TU6A 4FIPA 3AI8A 1BY8A 1Y4HA 1F2AA 1ZCMA 2DJGB 2PREA 3O1GA 1NB3A 1YVBA 2OP3A 2R9MA 1PBHA 3LFYA 1K3BB 2DZYA 3BWKA 2AIMA 2XU3A 4CDCB 1KXRA 4QRXA 2WBFX 2DC7A 3B79A 9PAPA 2G8JA 2R9NA 4WA6A 1ZIVA 3BOWA 3PDFA 1KHPA 2ATOA 4W5BA 3PW3A 1DEUA 2P86A 2VHSA 2FO5A 1GECE 6PADA 5JA7A 2HHNA 1F2CA 1PE6A 3V6CA 1PPPA 2FQ9A 4X6HA 3ERVA 2GFOA 4N8WA 4P6GA 1MEMA 4W5CA 4QRVA 1MHWA 2O6XA 2E00A 3KSEA 2IPPB 4QRGA 3N3KA 3GCBA 2Y5BA 5CVOB 1AU4A 1DF0A 1PCIA 4CDFB 2H7JA 4Q8HA 1HUCB 3WXFA 2NQAA 1CSBB 4RY2A 2VHFA 1EWMA 4CDDB 4W4UA 2DC6A 3F75A 4YVAA 3LXSA 2PBHA 4DMXA 3QT4A 1NL6A 1CB5A 3OVXA 4YV8A 4HWYA 1U5IA 2ACTA 3HWNA 4PP1A 3CBJA 2G7YA 1AYVA 3BC3A 2CB5A 1S4VA 3OVZA 1XKGA 1THEA 2AYOA 4P6EA 2YJBA 5J94A 3P5XA 3K24A 2NQDB 2FTDA 3BPFA 3HHIA 1M6DA 1NLJA 1U9WA 5F02A 4MZOA 3HHAA 4MSXA 3IOQA 3ZUAA 1ME3A 2G8EA 4OEMA 2PNSA 4BSQA 4PP2E 1STFE 1O0EA 3DF0A 4I04A 1EF7A 1PIPA 4I07A 4QH6A 3MORA 2DCBA 2GHUA 3OF8A 3BCNA
chains in the Genus database with same CATH superfamily
2R9OA 1U9VA 2HD5A 2DCAA 1QDQA 1POPA 4N4ZA 1NQCA 4X6IA 3I06A 3MHHA 2DC9A 4YYRA 4YYWA 4X6JA 2NQGA 4OVZA 1PPOA 1QXPA 1YK8A 3RNVA 3H89A 1BGOA 1GLOA 1ITOA 3KKUA 1MEGA 4N79A 3S3QA 1PPNA 2BU3A 4BS5A 3KFQA 2DJFB 2NQIA 1KFXL 2PADA 4XR7A 2AYNA 3OF9A 2J7QA 4I05A 3H8CA 2E03A 5CHVA 3U8EA 2DC8A 1EWLA 3O65A 5FPWA 4KLBA 1FH0A 3MTNA 3TRKA 1QMYA 1A6RA 4BS6A 5EGWA 4D8IA 1ATKA 1YK7A 3C0RA 1GCBA 3KWBX 3H8BA 3ZNHA 4FJCA 3QSDA 2F7DA 1PADA 2HXZA 5EF4A 1U9QX 3CH2X 3IFUA 2DCCA 1F29A 1CJLA 2ARYA 3E1ZB 1U9XA 4BPVA 2XU1A 1Q6KA 4BQVA 1YALA 4HXDB 4CZWA 5CHTA 3W30A 3KW9A 2AGAA 3F5VA 1VSNA 2OZ2A 5EZSA 3I3TA 3RVXA 3K8UA 2FT2A 8PCHA 4YYVA 3RVVA 4K7CA 3O0UA 2B1MA 1PVJA 4G54A 1SNKA 4OVZB 2DZZA 5CVNB 3CBKA 1AYUA 1MIRA 2DOSA 3H6SA 4RF1A 4RNAA 3W31A 4CDEB 4PI3A 2AU1A 2FUDA 1CVZA 2IBIA 1KHQA 1IWDA 1TL9A 3V6EA 1KFUL 1YT7A 4PT5A 7PCKA 3M99A 3WXGA 1F2BA 3BB7A 1AIMA 1AU3A 4WURA 3C9EA 1UKFA 2R6NA 3PHXA 5KO3A 4QBBA 1VJVA 2YJ9A 3CH3X 1PXVA 3HD3A 3N4CA 2BTWA 4DMYA 5JZEA 4MI7A 4A5UA 4GUAA 1PPDA 2OULA 2AUXA 2HWKA 4ZUXU 1GMYA 1CQDA 5PADA 2YJ2A 3PRMA 3N3GA 1AU0A 4FK5A 2E01A 3IV2A 1CS8A 2XU4A 1QOLA 3P5UA 2JQFR 4AXMA 2P7UA 1AECA 2P0RA 4PADA 4YYSA 4R3DA 3QJ3A 1MS6A 4MM3B 1NPZA 3TNXA 3BPMA 3D6SA 3MTVA 3RVWA 3IHPA 2E02A 4MZSA 3P5VA 4XZXA 1Y08A 4XUIA 2AVWA 2DCDA 2XU5A 1EWPA 4IUMA 3NHEA 2JQGR 3S3RA 2CIOA 3P5WA 4BOSA 3PBHA 2YJCA 3IEJA 1CPJA 1BQIA 4Q8GA 1EWOA 1MDWA 2BDLA 3IMAA 1JQPA 5CVMA 1DKIA 1CTEA 1SP4B 4BOQA 4D8EA 1NB5A 2FRAA 1CV8A 4REZA 1BP4A 2YJ8A 1TLOA 3PSEA 5JH3A 4OELA 1X9YA 3MHSA 1ICFA 1AYWA 3USVA 3KX1A 2G6DA 4ZTBA 2B1NA 3WXEA 2F1GA 4YYQA 3IUTA 3PNRA 5K16A 4YYUA 3K9MA 2HH5A 2R9CA 2AS8A 3H7DA 2JTCA 4AXLA 3OISA 2FRQA 2Y6EA 3KWZA 2AUZA 1AU2A 2C0YA 5A24A 2R9FA 2BDZA 2FYEA 3OQCA 1ME4A 3PT2A 1TU6A 4FIPA 3AI8A 3E9SA 1BY8A 1Y4HA 1F2AA 1ZCMA 2DJGB 4RF0A 2PREA 3MP2A 2UZJA 3O1GA 1NB3A 1YVBA 2JRIA 2OP3A 4BOZA 2R9MA 1YZBA 1PBHA 2Z84A 3LFYA 1K3BB 2DZYA 3BWKA 2AIMA 3PHWA 2XU3A 4CDCB 1KXRA 3PRPA 4QRXA 2WBFX 2DC7A 3B79A 9PAPA 2G8JA 2R9NA 4WA6A 1ZIVA 3BOWA 3PDFA 1KHPA 2ATOA 4W5BA 3PW3A 1DEUA 2P86A 2VHSA 2FO5A 4RKXA 1GECE 6PADA 5JA7A 2HHNA 2J7QC 1F2CA 1PE6A 3V6CA 1PPPA 2FQ9A 2FE8A 4X6HA 3ERVA 2GFOA 4N8WA 4P6GA 1MEMA 4W5CA 4QRVA 3BBAA 1MHWA 2O6XA 2E00A 3KSEA 2IPPB 4QRGA 3N3KA 4M0WA 2BTWB 4P16A 3GCBA 2Y5BA 5CVOB 1AU4A 1DF0A 3B21A 1PCIA 5EZQA 4CDFB 2H7JA 3BY4A 4Q8HA 4D8BA 1HUCB 3WXFA 2NQAA 1CSBB 4RY2A 2VHFA 1EWMA 4CDDB 4W4UA 5E6JA 3MJ5A 2DC6A 3F75A 4YVAA 3TMPA 3LXSA 2PBHA 4DMXA 3QT4A 4IP3A 1NL6A 1CB5A 3OVXA 4YV8A 4HWYA 1U5IA 2ACTA 3HWNA 4PP1A 3CBJA 2G7YA 1AYVA 3BC3A 2CB5A 1S4VA 3OVZA 1XKGA 1THEA 2AYOA 4P6EA 2YJBA 5J94A 3P5XA 3K24A 2NQDB 2FTDA 3BPFA 3HHIA 3PHUA 1M6DA 1NLJA 1U9WA 5F02A 4MZOA 4OW0A 3HHAA 4MSXA 3IOQA 4BOPA 3ZUAA 1ME3A 2G8EA 4OEMA 2PNSA 4BOUA 4BSQA 4PP2E 1STFE 1O0EA 3DF0A 4I04A 1EF7A 1PIPA 4I07A 4QH6A 3MORA 2DCBA 2GHUA 3OF8A 3BCNA
chains in the Genus database with same CATH topology
2R9OA 1U9VA 2HD5A 2DCAA 1QDQA 1POPA 4N4ZA 1NQCA 4X6IA 3I06A 3MHHA 2DC9A 4YYRA 4YYWA 4X6JA 2NQGA 1W6FA 1PPOA 1QXPA 1YK8A 3H89A 1BGOA 1GLOA 1ITOA 3KKUA 1MEGA 4N79A 3S3QA 1W4TA 1PPNA 4BS5A 3KFQA 2BSZA 4C5PA 2DJFB 2NQIA 1KFXL 2PADA 4XR7A 2AYNA 3OF9A 4I05A 3H8CA 1GX3A 2E03A 5CHVA 3U8EA 2DC8A 1EWLA 5FPWA 1FH0A 3MTNA 4KLBA 1QMYA 1A6RA 4BS6A 5EGWA 1ATKA 1YK7A 1GCBA 3KWBX 3H8BA 4FJCA 3QSDA 2F7DA 1PADA 2HXZA 5EF4A 1U9QX 3CH2X 2DCCA 1F29A 1CJLA 2ARYA 3E1ZB 1U9XA 4BPVA 2XU1A 1Q6KA 4BQVA 4BGFA 1YALA 4CZWA 5CHTA 3KW9A 3F5VA 1VSNA 2OZ2A 3I3TA 3RVXA 3K8UA 2FT2A 8PCHA 4YYVA 3RVVA 4K7CA 3O0UA 2B1MA 4G54A 1SNKA 2DZZA 5CVNB 3CBKA 1AYUA 1MIRA 3H6SA 4CDEB 4PI3A 2AU1A 2FUDA 1CVZA 2IBIA 1KHQA 1IWDA 1TL9A 3V6EA 1KFUL 1YT7A 7PCKA 1E2TA 3M99A 3WXGA 1F2BA 1AIMA 1AU3A 3C9EA 2R6NA 4QBBA 1VJVA 2YJ9A 3CH3X 1PXVA 1W5RA 3HD3A 3N4CA 4DMYA 1PPDA 2OULA 2AUXA 4ZUXU 1GMYA 1CQDA 5PADA 2YJ2A 3N3GA 1AU0A 4FK5A 2E01A 3IV2A 3LTWA 1CS8A 2XU4A 1QOLA 3P5UA 2JQFR 4AXMA 2P7UA 1AECA 2P0RA 4PADA 4YYSA 3QJ3A 1MS6A 1NPZA 3TNXA 3BPMA 3D6SA 3RVWA 3IHPA 2E02A 4MZSA 3P5VA 1Y08A 4XUIA 2AVWA 2DCDA 2XU5A 1EWPA 3NHEA 2JQGR 3S3RA 2CIOA 3P5WA 4NV8A 3PBHA 2YJCA 3IEJA 1CPJA 1BQIA 4Q8GA 1EWOA 1MDWA 2BDLA 3IMAA 1JQPA 5CVMA 1CTEA 1SP4B 1NB5A 2FRAA 1CV8A 1BP4A 2YJ8A 1TLOA 5JH3A 4GUZA 4OELA 1X9YA 3MHSA 1ICFA 1AYWA 3USVA 3KX1A 2G6DA 2B1NA 3WXEA 2F1GA 4YYQA 3IUTA 3PNRA 5K16A 4YYUA 3K9MA 2HH5A 2R9CA 2AS8A 3H7DA 4AXLA 3OISA 2FRQA 2Y6EA 3KWZA 2AUZA 1AU2A 2C0YA 5A24A 2R9FA 2BDZA 2FYEA 1ME4A 1TU6A 4FIPA 3AI8A 1BY8A 1Y4HA 1F2AA 1ZCMA 2DJGB 2PREA 2VFBA 3O1GA 1NB3A 1YVBA 2OP3A 2R9MA 1PBHA 3LFYA 1K3BB 2DZYA 3BWKA 2AIMA 2XU3A 4CDCB 1KXRA 4QRXA 2WBFX 2DC7A 3B79A 4B55A 9PAPA 2G8JA 2R9NA 4WA6A 1ZIVA 3BOWA 3PDFA 1KHPA 2ATOA 4W5BA 3PW3A 1DEUA 2P86A 2VHSA 2FO5A 1GECE 6PADA 5JA7A 2HHNA 1F2CA 1PE6A 3V6CA 2VFCA 1PPPA 2FQ9A 4X6HA 3ERVA 2GFOA 4N8WA 4P6GA 1MEMA 4W5CA 4QRVA 1MHWA 2O6XA 2E00A 3D9WA 3KSEA 2IPPB 4QRGA 3N3KA 3GCBA 2Y5BA 5CVOB 1AU4A 1DF0A 1PCIA 4CDFB 2H7JA 4Q8HA 1HUCB 3WXFA 2NQAA 1CSBB 4RY2A 2VHFA 1EWMA 4CDDB 4W4UA 2DC6A 3F75A 4YVAA 3LXSA 2PBHA 4DMXA 3QT4A 1NL6A 1CB5A 3OVXA 4YV8A 4HWYA 1U5IA 2ACTA 3HWNA 4PP1A 3CBJA 2G7YA 1AYVA 3BC3A 2CB5A 1S4VA 3OVZA 1XKGA 4NV7A 1THEA 2AYOA 4P6EA 2YJBA 5J94A 3P5XA 3K24A 2NQDB 2FTDA 3BPFA 3HHIA 1M6DA 1NLJA 1U9WA 5F02A 4MZOA 3HHAA 4MSXA 3IOQA 3ZUAA 1ME3A 2G8EA 4OEMA 2PNSA 4BSQA 4PP2E 1STFE 1O0EA 3DF0A 4I04A 1EF7A 1PIPA 4I07A 4QH6A 3MORA 2DCBA 2GHUA 3OF8A 3BCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9O A;  1U9V A;  2HD5 A;  2DCA A;  1QDQ A;  1POP A;  4N4Z A;  1NQC A;  4X6I A;  3I06 A;  3MHH A;  2DC9 A;  4YYR A;  4YYW A;  4X6J A;  2NQG A;  1PPO A;  1QXP A;  1YK8 A;  3H89 A;  1BGO A;  1GLO A;  1ITO A;  3KKU A;  1MEG A;  4N79 A;  3S3Q A;  1PPN A;  4BS5 A;  3KFQ A;  2DJF B;  2NQI A;  1KFX L;  2PAD A;  4XR7 A;  2AYN A;  3OF9 A;  4I05 A;  3H8C A;  2E03 A;  5CHV A;  3U8E A;  2DC8 A;  1EWL A;  5FPW A;  1FH0 A;  3MTN A;  4KLB A;  1QMY A;  1A6R A;  4BS6 A;  5EGW A;  1ATK A;  1YK7 A;  1GCB A;  3KWB X;  3H8B A;  4FJC A;  3QSD A;  2F7D A;  1PAD A;  2HXZ A;  5EF4 A;  1U9Q X;  3CH2 X;  2DCC A;  1F29 A;  1CJL A;  2ARY A;  3E1Z B;  1U9X A;  4BPV A;  2XU1 A;  1Q6K A;  4BQV A;  1YAL A;  4CZW A;  5CHT A;  3KW9 A;  3F5V A;  1VSN A;  2OZ2 A;  3I3T A;  3RVX A;  3K8U A;  2FT2 A;  8PCH A;  4YYV A;  3RVV A;  4K7C A;  3O0U A;  2B1M A;  4G54 A;  1SNK A;  2DZZ A;  5CVN B;  3CBK A;  1AYU A;  1MIR A;  3H6S A;  4CDE B;  4PI3 A;  2AU1 A;  2FUD A;  1CVZ A;  2IBI A;  1KHQ A;  1IWD A;  1TL9 A;  3V6E A;  1KFU L;  1YT7 A;  7PCK A;  3M99 A;  3WXG A;  1F2B A;  1AIM A;  1AU3 A;  3C9E A;  2R6N A;  4QBB A;  1VJV A;  2YJ9 A;  3CH3 X;  1PXV A;  3HD3 A;  3N4C A;  4DMY A;  1PPD A;  2OUL A;  2AUX A;  4ZUX U;  1GMY A;  1CQD A;  5PAD A;  2YJ2 A;  3N3G A;  1AU0 A;  4FK5 A;  2E01 A;  3IV2 A;  1CS8 A;  2XU4 A;  1QOL A;  3P5U A;  2JQF R;  4AXM A;  2P7U A;  1AEC A;  2P0R A;  4PAD A;  4YYS A;  3QJ3 A;  1MS6 A;  1NPZ A;  3TNX A;  3BPM A;  3D6S A;  3RVW A;  3IHP A;  2E02 A;  4MZS A;  3P5V A;  1Y08 A;  4XUI A;  2AVW A;  2DCD A;  2XU5 A;  1EWP A;  3NHE A;  2JQG R;  3S3R A;  2CIO A;  3P5W A;  3PBH A;  2YJC A;  3IEJ A;  1CPJ A;  1BQI A;  4Q8G A;  1EWO A;  1MDW A;  2BDL A;  3IMA A;  1JQP A;  5CVM A;  1CTE A;  1SP4 B;  1NB5 A;  2FRA A;  1CV8 A;  1BP4 A;  2YJ8 A;  1TLO A;  5JH3 A;  4OEL A;  1X9Y A;  3MHS A;  1ICF A;  1AYW A;  3USV A;  3KX1 A;  2G6D A;  2B1N A;  3WXE A;  2F1G A;  4YYQ A;  3IUT A;  3PNR A;  5K16 A;  4YYU A;  3K9M A;  2HH5 A;  2R9C A;  2AS8 A;  3H7D A;  4AXL A;  3OIS A;  2FRQ A;  2Y6E A;  3KWZ A;  2AUZ A;  1AU2 A;  2C0Y A;  5A24 A;  2R9F A;  2BDZ A;  2FYE A;  1ME4 A;  1TU6 A;  4FIP A;  3AI8 A;  1BY8 A;  1Y4H A;  1F2A A;  1ZCM A;  2DJG B;  2PRE A;  3O1G A;  1NB3 A;  1YVB A;  2OP3 A;  2R9M A;  1PBH A;  3LFY A;  1K3B B;  2DZY A;  3BWK A;  2AIM A;  2XU3 A;  4CDC B;  1KXR A;  4QRX A;  2WBF X;  2DC7 A;  3B79 A;  9PAP A;  2G8J A;  2R9N A;  4WA6 A;  1ZIV A;  3BOW A;  3PDF A;  1KHP A;  2ATO A;  4W5B A;  3PW3 A;  1DEU A;  2P86 A;  2VHS A;  2FO5 A;  1GEC E;  6PAD A;  5JA7 A;  2HHN A;  1F2C A;  1PE6 A;  3V6C A;  1PPP A;  2FQ9 A;  4X6H A;  3ERV A;  2GFO A;  4N8W A;  4P6G A;  1MEM A;  4W5C A;  4QRV A;  1MHW A;  2O6X A;  2E00 A;  3KSE A;  2IPP B;  4QRG A;  3N3K A;  3GCB A;  2Y5B A;  5CVO B;  1AU4 A;  1DF0 A;  1PCI A;  4CDF B;  2H7J A;  4Q8H A;  1HUC B;  3WXF A;  2NQA A;  1CSB B;  4RY2 A;  2VHF A;  1EWM A;  4CDD B;  4W4U A;  2DC6 A;  3F75 A;  4YVA A;  3LXS A;  2PBH A;  4DMX A;  3QT4 A;  1NL6 A;  1CB5 A;  3OVX A;  4YV8 A;  4HWY A;  1U5I A;  2ACT A;  3HWN A;  4PP1 A;  3CBJ A;  2G7Y A;  1AYV A;  3BC3 A;  2CB5 A;  1S4V A;  3OVZ A;  1XKG A;  1THE A;  2AYO A;  4P6E A;  2YJB A;  5J94 A;  3P5X A;  3K24 A;  2NQD B;  2FTD A;  3BPF A;  3HHI A;  1M6D A;  1NLJ A;  1U9W A;  5F02 A;  4MZO A;  3HHA A;  4MSX A;  3IOQ A;  3ZUA A;  1ME3 A;  2G8E A;  4OEM A;  2PNS A;  4BSQ A;  4PP2 E;  1STF E;  1O0E A;  3DF0 A;  4I04 A;  1EF7 A;  1PIP A;  4I07 A;  4QH6 A;  3MOR A;  2DCB A;  2GHU A;  3OF8 A;  3BCN A; 
#chains in the Genus database with same CATH topology
 2R9O A;  1U9V A;  2HD5 A;  2DCA A;  1QDQ A;  1POP A;  4N4Z A;  1NQC A;  4X6I A;  3I06 A;  3MHH A;  2DC9 A;  4YYR A;  4YYW A;  4X6J A;  2NQG A;  4OVZ A;  1PPO A;  1QXP A;  1YK8 A;  3RNV A;  3H89 A;  1BGO A;  1GLO A;  1ITO A;  3KKU A;  1MEG A;  4N79 A;  3S3Q A;  1PPN A;  2BU3 A;  4BS5 A;  3KFQ A;  2DJF B;  2NQI A;  1KFX L;  2PAD A;  4XR7 A;  2AYN A;  3OF9 A;  2J7Q A;  4I05 A;  3H8C A;  2E03 A;  5CHV A;  3U8E A;  2DC8 A;  1EWL A;  3O65 A;  5FPW A;  4KLB A;  1FH0 A;  3MTN A;  3TRK A;  1QMY A;  1A6R A;  4BS6 A;  5EGW A;  4D8I A;  1ATK A;  1YK7 A;  3C0R A;  1GCB A;  3KWB X;  3H8B A;  3ZNH A;  4FJC A;  3QSD A;  2F7D A;  1PAD A;  2HXZ A;  5EF4 A;  1U9Q X;  3CH2 X;  3IFU A;  2DCC A;  1F29 A;  1CJL A;  2ARY A;  3E1Z B;  1U9X A;  4BPV A;  2XU1 A;  1Q6K A;  4BQV A;  1YAL A;  4HXD B;  4CZW A;  5CHT A;  3W30 A;  3KW9 A;  2AGA A;  3F5V A;  1VSN A;  2OZ2 A;  5EZS A;  3I3T A;  3RVX A;  3K8U A;  2FT2 A;  8PCH A;  4YYV A;  3RVV A;  4K7C A;  3O0U A;  2B1M A;  1PVJ A;  4G54 A;  1SNK A;  4OVZ B;  2DZZ A;  5CVN B;  3CBK A;  1AYU A;  1MIR A;  2DOS A;  3H6S A;  4RF1 A;  4RNA A;  3W31 A;  4CDE B;  4PI3 A;  2AU1 A;  2FUD A;  1CVZ A;  2IBI A;  1KHQ A;  1IWD A;  1TL9 A;  3V6E A;  1KFU L;  1YT7 A;  4PT5 A;  7PCK A;  3M99 A;  3WXG A;  1F2B A;  3BB7 A;  1AIM A;  1AU3 A;  4WUR A;  3C9E A;  1UKF A;  2R6N A;  3PHX A;  5KO3 A;  4QBB A;  1VJV A;  2YJ9 A;  3CH3 X;  1PXV A;  3HD3 A;  3N4C A;  2BTW A;  4DMY A;  5JZE A;  4MI7 A;  4A5U A;  4GUA A;  1PPD A;  2OUL A;  2AUX A;  2HWK A;  4ZUX U;  1GMY A;  1CQD A;  5PAD A;  2YJ2 A;  3PRM A;  3N3G A;  1AU0 A;  4FK5 A;  2E01 A;  3IV2 A;  1CS8 A;  2XU4 A;  1QOL A;  3P5U A;  2JQF R;  4AXM A;  2P7U A;  1AEC A;  2P0R A;  4PAD A;  4YYS A;  4R3D A;  3QJ3 A;  1MS6 A;  4MM3 B;  1NPZ A;  3TNX A;  3BPM A;  3D6S A;  3MTV A;  3RVW A;  3IHP A;  2E02 A;  4MZS A;  3P5V A;  4XZX A;  1Y08 A;  4XUI A;  2AVW A;  2DCD A;  2XU5 A;  1EWP A;  4IUM A;  3NHE A;  2JQG R;  3S3R A;  2CIO A;  3P5W A;  4BOS A;  3PBH A;  2YJC A;  3IEJ A;  1CPJ A;  1BQI A;  4Q8G A;  1EWO A;  1MDW A;  2BDL A;  3IMA A;  1JQP A;  5CVM A;  1DKI A;  1CTE A;  1SP4 B;  4BOQ A;  4D8E A;  1NB5 A;  2FRA A;  1CV8 A;  4REZ A;  1BP4 A;  2YJ8 A;  1TLO A;  3PSE A;  5JH3 A;  4OEL A;  1X9Y A;  3MHS A;  1ICF A;  1AYW A;  3USV A;  3KX1 A;  2G6D A;  4ZTB A;  2B1N A;  3WXE A;  2F1G A;  4YYQ A;  3IUT A;  3PNR A;  5K16 A;  4YYU A;  3K9M A;  2HH5 A;  2R9C A;  2AS8 A;  3H7D A;  2JTC A;  4AXL A;  3OIS A;  2FRQ A;  2Y6E A;  3KWZ A;  2AUZ A;  1AU2 A;  2C0Y A;  5A24 A;  2R9F A;  2BDZ A;  2FYE A;  3OQC A;  1ME4 A;  3PT2 A;  1TU6 A;  4FIP A;  3AI8 A;  3E9S A;  1BY8 A;  1Y4H A;  1F2A A;  1ZCM A;  2DJG B;  4RF0 A;  2PRE A;  3MP2 A;  2UZJ A;  3O1G A;  1NB3 A;  1YVB A;  2JRI A;  2OP3 A;  4BOZ A;  2R9M A;  1YZB A;  1PBH A;  2Z84 A;  3LFY A;  1K3B B;  2DZY A;  3BWK A;  2AIM A;  3PHW A;  2XU3 A;  4CDC B;  1KXR A;  3PRP A;  4QRX A;  2WBF X;  2DC7 A;  3B79 A;  9PAP A;  2G8J A;  2R9N A;  4WA6 A;  1ZIV A;  3BOW A;  3PDF A;  1KHP A;  2ATO A;  4W5B A;  3PW3 A;  1DEU A;  2P86 A;  2VHS A;  2FO5 A;  4RKX A;  1GEC E;  6PAD A;  5JA7 A;  2HHN A;  2J7Q C;  1F2C A;  1PE6 A;  3V6C A;  1PPP A;  2FQ9 A;  2FE8 A;  4X6H A;  3ERV A;  2GFO A;  4N8W A;  4P6G A;  1MEM A;  4W5C A;  4QRV A;  3BBA A;  1MHW A;  2O6X A;  2E00 A;  3KSE A;  2IPP B;  4QRG A;  3N3K A;  4M0W A;  2BTW B;  4P16 A;  3GCB A;  2Y5B A;  5CVO B;  1AU4 A;  1DF0 A;  3B21 A;  1PCI A;  5EZQ A;  4CDF B;  2H7J A;  3BY4 A;  4Q8H A;  4D8B A;  1HUC B;  3WXF A;  2NQA A;  1CSB B;  4RY2 A;  2VHF A;  1EWM A;  4CDD B;  4W4U A;  5E6J A;  3MJ5 A;  2DC6 A;  3F75 A;  4YVA A;  3TMP A;  3LXS A;  2PBH A;  4DMX A;  3QT4 A;  4IP3 A;  1NL6 A;  1CB5 A;  3OVX A;  4YV8 A;  4HWY A;  1U5I A;  2ACT A;  3HWN A;  4PP1 A;  3CBJ A;  2G7Y A;  1AYV A;  3BC3 A;  2CB5 A;  1S4V A;  3OVZ A;  1XKG A;  1THE A;  2AYO A;  4P6E A;  2YJB A;  5J94 A;  3P5X A;  3K24 A;  2NQD B;  2FTD A;  3BPF A;  3HHI A;  3PHU A;  1M6D A;  1NLJ A;  1U9W A;  5F02 A;  4MZO A;  4OW0 A;  3HHA A;  4MSX A;  3IOQ A;  4BOP A;  3ZUA A;  1ME3 A;  2G8E A;  4OEM A;  2PNS A;  4BOU A;  4BSQ A;  4PP2 E;  1STF E;  1O0E A;  3DF0 A;  4I04 A;  1EF7 A;  1PIP A;  4I07 A;  4QH6 A;  3MOR A;  2DCB A;  2GHU A;  3OF8 A;  3BCN A; 
#chains in the Genus database with same CATH homology
 2R9O A;  1U9V A;  2HD5 A;  2DCA A;  1QDQ A;  1POP A;  4N4Z A;  1NQC A;  4X6I A;  3I06 A;  3MHH A;  2DC9 A;  4YYR A;  4YYW A;  4X6J A;  2NQG A;  1W6F A;  1PPO A;  1QXP A;  1YK8 A;  3H89 A;  1BGO A;  1GLO A;  1ITO A;  3KKU A;  1MEG A;  4N79 A;  3S3Q A;  1W4T A;  1PPN A;  4BS5 A;  3KFQ A;  2BSZ A;  4C5P A;  2DJF B;  2NQI A;  1KFX L;  2PAD A;  4XR7 A;  2AYN A;  3OF9 A;  4I05 A;  3H8C A;  1GX3 A;  2E03 A;  5CHV A;  3U8E A;  2DC8 A;  1EWL A;  5FPW A;  1FH0 A;  3MTN A;  4KLB A;  1QMY A;  1A6R A;  4BS6 A;  5EGW A;  1ATK A;  1YK7 A;  1GCB A;  3KWB X;  3H8B A;  4FJC A;  3QSD A;  2F7D A;  1PAD A;  2HXZ A;  5EF4 A;  1U9Q X;  3CH2 X;  2DCC A;  1F29 A;  1CJL A;  2ARY A;  3E1Z B;  1U9X A;  4BPV A;  2XU1 A;  1Q6K A;  4BQV A;  4BGF A;  1YAL A;  4CZW A;  5CHT A;  3KW9 A;  3F5V A;  1VSN A;  2OZ2 A;  3I3T A;  3RVX A;  3K8U A;  2FT2 A;  8PCH A;  4YYV A;  3RVV A;  4K7C A;  3O0U A;  2B1M A;  4G54 A;  1SNK A;  2DZZ A;  5CVN B;  3CBK A;  1AYU A;  1MIR A;  3H6S A;  4CDE B;  4PI3 A;  2AU1 A;  2FUD A;  1CVZ A;  2IBI A;  1KHQ A;  1IWD A;  1TL9 A;  3V6E A;  1KFU L;  1YT7 A;  7PCK A;  1E2T A;  3M99 A;  3WXG A;  1F2B A;  1AIM A;  1AU3 A;  3C9E A;  2R6N A;  4QBB A;  1VJV A;  2YJ9 A;  3CH3 X;  1PXV A;  1W5R A;  3HD3 A;  3N4C A;  4DMY A;  1PPD A;  2OUL A;  2AUX A;  4ZUX U;  1GMY A;  1CQD A;  5PAD A;  2YJ2 A;  3N3G A;  1AU0 A;  4FK5 A;  2E01 A;  3IV2 A;  3LTW A;  1CS8 A;  2XU4 A;  1QOL A;  3P5U A;  2JQF R;  4AXM A;  2P7U A;  1AEC A;  2P0R A;  4PAD A;  4YYS A;  3QJ3 A;  1MS6 A;  1NPZ A;  3TNX A;  3BPM A;  3D6S A;  3RVW A;  3IHP A;  2E02 A;  4MZS A;  3P5V A;  1Y08 A;  4XUI A;  2AVW A;  2DCD A;  2XU5 A;  1EWP A;  3NHE A;  2JQG R;  3S3R A;  2CIO A;  3P5W A;  4NV8 A;  3PBH A;  2YJC A;  3IEJ A;  1CPJ A;  1BQI A;  4Q8G A;  1EWO A;  1MDW A;  2BDL A;  3IMA A;  1JQP A;  5CVM A;  1CTE A;  1SP4 B;  1NB5 A;  2FRA A;  1CV8 A;  1BP4 A;  2YJ8 A;  1TLO A;  5JH3 A;  4GUZ A;  4OEL A;  1X9Y A;  3MHS A;  1ICF A;  1AYW A;  3USV A;  3KX1 A;  2G6D A;  2B1N A;  3WXE A;  2F1G A;  4YYQ A;  3IUT A;  3PNR A;  5K16 A;  4YYU A;  3K9M A;  2HH5 A;  2R9C A;  2AS8 A;  3H7D A;  4AXL A;  3OIS A;  2FRQ A;  2Y6E A;  3KWZ A;  2AUZ A;  1AU2 A;  2C0Y A;  5A24 A;  2R9F A;  2BDZ A;  2FYE A;  1ME4 A;  1TU6 A;  4FIP A;  3AI8 A;  1BY8 A;  1Y4H A;  1F2A A;  1ZCM A;  2DJG B;  2PRE A;  2VFB A;  3O1G A;  1NB3 A;  1YVB A;  2OP3 A;  2R9M A;  1PBH A;  3LFY A;  1K3B B;  2DZY A;  3BWK A;  2AIM A;  2XU3 A;  4CDC B;  1KXR A;  4QRX A;  2WBF X;  2DC7 A;  3B79 A;  4B55 A;  9PAP A;  2G8J A;  2R9N A;  4WA6 A;  1ZIV A;  3BOW A;  3PDF A;  1KHP A;  2ATO A;  4W5B A;  3PW3 A;  1DEU A;  2P86 A;  2VHS A;  2FO5 A;  1GEC E;  6PAD A;  5JA7 A;  2HHN A;  1F2C A;  1PE6 A;  3V6C A;  2VFC A;  1PPP A;  2FQ9 A;  4X6H A;  3ERV A;  2GFO A;  4N8W A;  4P6G A;  1MEM A;  4W5C A;  4QRV A;  1MHW A;  2O6X A;  2E00 A;  3D9W A;  3KSE A;  2IPP B;  4QRG A;  3N3K A;  3GCB A;  2Y5B A;  5CVO B;  1AU4 A;  1DF0 A;  1PCI A;  4CDF B;  2H7J A;  4Q8H A;  1HUC B;  3WXF A;  2NQA A;  1CSB B;  4RY2 A;  2VHF A;  1EWM A;  4CDD B;  4W4U A;  2DC6 A;  3F75 A;  4YVA A;  3LXS A;  2PBH A;  4DMX A;  3QT4 A;  1NL6 A;  1CB5 A;  3OVX A;  4YV8 A;  4HWY A;  1U5I A;  2ACT A;  3HWN A;  4PP1 A;  3CBJ A;  2G7Y A;  1AYV A;  3BC3 A;  2CB5 A;  1S4V A;  3OVZ A;  1XKG A;  4NV7 A;  1THE A;  2AYO A;  4P6E A;  2YJB A;  5J94 A;  3P5X A;  3K24 A;  2NQD B;  2FTD A;  3BPF A;  3HHI A;  1M6D A;  1NLJ A;  1U9W A;  5F02 A;  4MZO A;  3HHA A;  4MSX A;  3IOQ A;  3ZUA A;  1ME3 A;  2G8E A;  4OEM A;  2PNS A;  4BSQ A;  4PP2 E;  1STF E;  1O0E A;  3DF0 A;  4I04 A;  1EF7 A;  1PIP A;  4I07 A;  4QH6 A;  3MOR A;  2DCB A;  2GHU A;  3OF8 A;  3BCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...