4PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
total genus 54
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4padA00
1VSNA 4WA6A 4MSXA 8PCHA 2CIOA 4CDDB 3OF9A 1CQDA 2G7YA 3MORA 3P5XA 2O6XA 3N3GA 4I07A 4DMYA 2VHSA 1AYVA 4QRGA 1PPOA 1PADA 2NQDB 1JQPA 3H8BA 3KFQA 2NQAA 1MIRA 1HUCB 3KW9A 2AYNA 2AUZA 4CDFB 3IMAA 1PXVA 3H89A 1AU0A 4X6HA 1AYUA 3IV2A 1ZCMA 3OVXA 2DC6A 1U9VA 3LXSA 5CVMA 3U8EA 1Y4HA 2YJ8A 1A6RA 1NQCA 2FT2A 1S4VA 1SNKA 3HHAA 2B1MA 1ME3A 2G8EA 3PW3A 4P6GA 3CBKA 3K8UA 3D6SA 4BQVA 3WXFA 3LFYA 3QT4A 1FH0A 1O0EA 1NL6A 1NLJA 2DZYA 1CTEA 3C9EA 2DCBA 2PADA 2DCDA 3F5VA 5JA7A 3IOQA 2AYOA 1EWMA 1XKGA 1CV8A 1U9QX 4OEMA 1EWLA 4K7CA 1AYWA 4QH6A 4CDEB 3KX1A 3I3TA 2FO5A 4KLBA 4AXLA 1TLOA 1NPZA 3N4CA 1CSBB 4YYVA 4PADA 5CHTA 1NB3A 2R9FA 1GLOA 4YYUA 1MEMA 1CVZA 2DCAA 2YJBA 2E02A 1PE6A 1AU4A 1CPJA 1M6DA 2DC8A 5F02A 2E03A 3TNXA 1U9XA 4YYSA 4BS5A 2ARYA 2VHFA 1YVBA 2R9MA 4G54A 3USVA 3ERVA 2AVWA 1GECE 4PP2E 3GCBA 2PREA 1CJLA 3QSDA 3E1ZB 3PDFA 3BC3A 5JH3A 2G6DA 3HHIA 1QXPA 4Q8GA 2ACTA 1ICFA 1KXRA 2Y6EA 2DC7A 2E00A 1K3BB 2E01A 2IPPB 3P5WA 2YJ2A 6PADA 2C0YA 1KFUL 4XUIA 3OF8A 1VJVA 1Y08A 3H8CA 2OP3A 1TU6A 3K24A 2GFOA 4I04A 1ITOA 2OULA 2AU1A 2XU1A 7PCKA 3CH2X 4CZWA 1GCBA 1KFXL 1POPA 2R6NA 1PCIA 4FIPA 3MHSA 3ZUAA 1IWDA 1MS6A 4ZUXU 4X6JA 3I06A 1BGOA 2ATOA 2F7DA 3IHPA 1PPPA 3KWZA 2DJFB 1F2CA 2P86A 2FRQA 4FJCA 5FPWA 1PIPA 4YVAA 3CH3X 1U9WA 1PPDA 2FQ9A 4DMXA 3CBJA 4I05A 4PI3A 2FTDA 2BDZA 2BDLA 4W5BA 3BCNA 1AU2A 3NHEA 3OISA 2G8JA 3K9MA 4W4UA 2HD5A 1CB5A 2YJ9A 1F2AA 5EGWA 3WXGA 2B1NA 2H7JA 2R9OA 4W5CA 9PAPA 4YYRA 4QRVA 3HD3A 2OZ2A 2GHUA 1KHQA 4X6IA 3M99A 1DEUA 2XU3A 2HH5A 4N8WA 1F29A 2IBIA 1ATKA 2FRAA 4YYWA 3KSEA 2HHNA 5CVNB 1YK7A 5A24A 1STFE 1U5IA 3BPMA 1QMYA 1NB5A 3N3KA 1BQIA 2R9NA 3V6CA 2AIMA 1YT7A 3RVWA 1GMYA 3O1GA 1TL9A 2DJGB 3IUTA 1EWOA 1SP4B 2FUDA 3IEJA 3O0UA 2F1GA 1YK8A 4N79A 2R9CA 2XU4A 4QRXA 2JQFR 5K16A 3H7DA 2WBFX 5PADA 4N4ZA 2DCCA 3P5VA 2P0RA 2FYEA 4YYQA 2PBHA 3RVXA 4P6EA 3H6SA 3MHHA 4BPVA 3AI8A 1BP4A 3F75A 1PBHA 4BSQA 1QOLA 1AIMA 3BPFA 1EF7A 4FK5A 4XR7A 4PP1A 5CVOB 3OVZA 3WXEA 2YJCA 1MDWA 5EF4A 1AECA 2P7UA 2NQGA 2XU5A 1QDQA 3P5UA 3KWBX 4HWYA 4CDCB 1BY8A 3S3QA 4OELA 3HWNA 1ZIVA 1MHWA 2DZZA 1THEA 5CHVA 3V6EA 3MTNA 2DC9A 3DF0A 4QBBA 2Y5BA 1ME4A 2NQIA 3RVVA 2AS8A 2CB5A 1CS8A 1DF0A 1EWPA 4AXMA 2HXZA 4MZSA 3PNRA 4MZOA 4YV8A 5J94A 1YALA 3KKUA 1MEGA 2JQGR 3QJ3A 1AU3A 1Q6KA 2PNSA 1F2BA 1PPNA 1KHPA 3BWKA 3PBHA 3BOWA 3B79A 4RY2A 2AUXA 1X9YA 4BS6A 4Q8HA 3S3RA
chains in the Genus database with same CATH superfamily
1VSNA 4WA6A 4D8EA 4MSXA 4OVZB 8PCHA 2CIOA 4CDDB 1PVJA 1CQDA 3OF9A 2G7YA 3MORA 3P5XA 2O6XA 3N3GA 4I07A 3E9SA 4DMYA 2VHSA 1AYVA 4QRGA 1PPOA 1PADA 2NQDB 1JQPA 3H8BA 3KFQA 2NQAA 1MIRA 1HUCB 3KW9A 2AYNA 4BOSA 2AUZA 4CDFB 3IMAA 1PXVA 2JTCA 3H89A 1AU0A 4X6HA 1AYUA 3IV2A 1ZCMA 3OVXA 2DC6A 1U9VA 2BU3A 2J7QA 3LXSA 4MI7A 4M0WA 5CVMA 3U8EA 1Y4HA 2YJ8A 1A6RA 1NQCA 2FT2A 1S4VA 1SNKA 3HHAA 2B1MA 1ME3A 2G8EA 3PW3A 4OW0A 4P6GA 3CBKA 3K8UA 2HWKA 3D6SA 2AGAA 3WXFA 4BQVA 3LFYA 3QT4A 1FH0A 1O0EA 1NL6A 1NLJA 2DZYA 3PRMA 1CTEA 3C9EA 2DCBA 4PT5A 4RF0A 2PADA 2DCDA 3F5VA 5JA7A 3IOQA 2AYOA 1EWMA 1XKGA 1CV8A 1U9QX 4OEMA 1EWLA 4K7CA 1AYWA 4QH6A 4CDEB 3KX1A 3I3TA 2FO5A 4KLBA 4AXLA 1TLOA 1NPZA 3N4CA 1CSBB 4YYVA 4PADA 5CHTA 1NB3A 2R9FA 1GLOA 4ZTBA 4YYUA 1MEMA 1CVZA 2DCAA 2YJBA 2E02A 1PE6A 4A5UA 1AU4A 1CPJA 1M6DA 2DC8A 5F02A 2E03A 3TNXA 1U9XA 4BOUA 4YYSA 4BS5A 2BTWB 2ARYA 2VHFA 5EZQA 1DKIA 1YVBA 3PSEA 2JRIA 4IP3A 2R9MA 4G54A 3USVA 3ERVA 2AVWA 1GECE 4IUMA 4PP2E 3GCBA 2PREA 1CJLA 3QSDA 3E1ZB 3PDFA 3BC3A 5JH3A 2G6DA 3HHIA 1QXPA 4Q8GA 2ACTA 1ICFA 1KXRA 2Y6EA 2DC7A 2E00A 5JZEA 3C0RA 1K3BB 2E01A 2IPPB 3P5WA 2YJ2A 6PADA 2C0YA 1KFUL 4XUIA 3OF8A 1VJVA 3TRKA 1Y08A 3H8CA 2OP3A 1TU6A 4XZXA 3K24A 4RNAA 2GFOA 1ITOA 2OULA 4I04A 2AU1A 2XU1A 3OQCA 7PCKA 3CH2X 4CZWA 1GCBA 1KFXL 1POPA 2R6NA 4HXDB 1PCIA 4FIPA 4BOQA 3MHSA 3ZUAA 1IWDA 1MS6A 4ZUXU 3BY4A 4X6JA 3I06A 4BOPA 1BGOA 2ATOA 2F7DA 2Z84A 3IHPA 4MM3B 1PPPA 3KWZA 2DJFB 1F2CA 2P86A 3W31A 1YZBA 2DOSA 2FRQA 4FJCA 5FPWA 3PHUA 1PIPA 4YVAA 3CH3X 1UKFA 2FE8A 3PT2A 1U9WA 1PPDA 2FQ9A 4DMXA 3CBJA 4I05A 4PI3A 2FTDA 3MJ5A 2BDZA 2BDLA 4W5BA 3BCNA 3MTVA 1AU2A 4P16A 3NHEA 3OISA 2G8JA 3IFUA 3K9MA 4W4UA 2HD5A 1CB5A 3PHWA 2YJ9A 1F2AA 5EGWA 3WXGA 2B1NA 2H7JA 2R9OA 4W5CA 9PAPA 4WURA 4YYRA 3O65A 4QRVA 3HD3A 2OZ2A 2GHUA 1KHQA 4X6IA 3M99A 1DEUA 2XU3A 2HH5A 3PHXA 4N8WA 1F29A 2IBIA 1ATKA 2FRAA 3TMPA 4YYWA 3KSEA 2HHNA 5CVNB 1YK7A 5A24A 1STFE 1U5IA 3BPMA 1QMYA 1NB5A 3N3KA 1BQIA 3RNVA 2R9NA 3V6CA 2AIMA 1YT7A 3RVWA 1GMYA 3O1GA 1TL9A 2DJGB 3IUTA 1EWOA 4RKXA 1SP4B 3PRPA 2FUDA 3IEJA 3ZNHA 3O0UA 2F1GA 1YK8A 4N79A 2R9CA 2XU4A 4QRXA 2JQFR 5K16A 3H7DA 2WBFX 5PADA 3B21A 2DCCA 4N4ZA 3P5VA 4GUAA 2P0RA 2FYEA 4YYQA 2PBHA 2BTWA 3RVXA 4P6EA 3BB7A 3H6SA 3MHHA 4BPVA 3AI8A 1BP4A 3F75A 1PBHA 4BSQA 1QOLA 1AIMA 3BPFA 1EF7A 4FK5A 4XR7A 4PP1A 4OVZA 5CVOB 3OVZA 4BOZA 3WXEA 2YJCA 2UZJA 1MDWA 4D8IA 5EF4A 1AECA 5KO3A 2P7UA 4REZA 2NQGA 2XU5A 1QDQA 3P5UA 3KWBX 4HWYA 4CDCB 1BY8A 2J7QC 4OELA 3HWNA 3S3QA 1ZIVA 1MHWA 2DZZA 1THEA 5CHVA 3V6EA 3MTNA 2DC9A 3DF0A 4QBBA 5EZSA 2Y5BA 1ME4A 4RF1A 2NQIA 3MP2A 3RVVA 2AS8A 2CB5A 4D8BA 1CS8A 1DF0A 1EWPA 3W30A 4AXMA 2HXZA 4MZSA 3PNRA 4MZOA 4YV8A 3BBAA 5J94A 1YALA 3KKUA 1MEGA 2JQGR 3QJ3A 1AU3A 1Q6KA 2PNSA 1F2BA 1PPNA 1KHPA 3BWKA 3PBHA 3BOWA 3B79A 4RY2A 2AUXA 5E6JA 1X9YA 4BS6A 4Q8HA 3S3RA 4R3DA
chains in the Genus database with same CATH topology
1VSNA 4WA6A 4MSXA 8PCHA 2CIOA 4CDDB 3OF9A 1CQDA 2G7YA 3MORA 3P5XA 2O6XA 3N3GA 4I07A 4DMYA 2VHSA 1AYVA 4QRGA 1PPOA 1PADA 2NQDB 1JQPA 3H8BA 3KFQA 2NQAA 1MIRA 1HUCB 3KW9A 2AYNA 2AUZA 4CDFB 3IMAA 1PXVA 3H89A 1AU0A 4X6HA 1AYUA 3IV2A 1ZCMA 3OVXA 2DC6A 1U9VA 2VFBA 3LXSA 5CVMA 3U8EA 1Y4HA 2YJ8A 1A6RA 1NQCA 2FT2A 1S4VA 1SNKA 3HHAA 2B1MA 1ME3A 2G8EA 3PW3A 4P6GA 3CBKA 3K8UA 3D6SA 4BQVA 3WXFA 3LFYA 3QT4A 1FH0A 1O0EA 1NL6A 1NLJA 2DZYA 1CTEA 3C9EA 2DCBA 2PADA 2DCDA 3F5VA 5JA7A 3IOQA 2AYOA 1EWMA 1XKGA 1CV8A 1U9QX 4OEMA 1EWLA 4K7CA 1AYWA 4QH6A 4CDEB 3KX1A 3I3TA 2FO5A 4KLBA 4AXLA 1TLOA 1NPZA 3N4CA 1CSBB 4YYVA 4PADA 5CHTA 1NB3A 2R9FA 1GLOA 4YYUA 1MEMA 1CVZA 2DCAA 2YJBA 3D9WA 2E02A 1PE6A 1AU4A 1CPJA 1M6DA 2DC8A 5F02A 2E03A 3TNXA 3LTWA 1U9XA 4YYSA 4BS5A 2ARYA 2VHFA 1YVBA 2R9MA 4G54A 3USVA 3ERVA 2AVWA 1GECE 4PP2E 3GCBA 2PREA 1CJLA 3QSDA 3E1ZB 3PDFA 3BC3A 5JH3A 2G6DA 3HHIA 1QXPA 4Q8GA 2ACTA 1ICFA 1KXRA 2Y6EA 2DC7A 2E00A 1K3BB 2E01A 2IPPB 3P5WA 2YJ2A 6PADA 2C0YA 1KFUL 4XUIA 3OF8A 1VJVA 1Y08A 3H8CA 2OP3A 1TU6A 3K24A 2GFOA 1W6FA 4I04A 1ITOA 2OULA 2AU1A 2XU1A 7PCKA 3CH2X 4CZWA 4B55A 1GCBA 1KFXL 1POPA 2R6NA 1PCIA 4FIPA 3MHSA 3ZUAA 1IWDA 1MS6A 4ZUXU 4X6JA 2BSZA 3I06A 1BGOA 2ATOA 2F7DA 3IHPA 1PPPA 3KWZA 2DJFB 1F2CA 2P86A 2FRQA 4FJCA 5FPWA 1PIPA 4YVAA 3CH3X 1U9WA 1E2TA 1PPDA 2FQ9A 4DMXA 3CBJA 4I05A 4PI3A 2FTDA 2BDZA 2BDLA 4W5BA 3BCNA 1AU2A 3NHEA 3OISA 2G8JA 3K9MA 4W4UA 2HD5A 2VFCA 1CB5A 2YJ9A 1F2AA 5EGWA 3WXGA 2B1NA 2H7JA 2R9OA 4W5CA 9PAPA 4YYRA 4QRVA 3HD3A 2OZ2A 2GHUA 1KHQA 4X6IA 3M99A 1DEUA 2XU3A 2HH5A 4N8WA 1F29A 2IBIA 1ATKA 2FRAA 1GX3A 4YYWA 3KSEA 2HHNA 5CVNB 1YK7A 5A24A 1STFE 1U5IA 3BPMA 1QMYA 1NB5A 3N3KA 1BQIA 2R9NA 3V6CA 2AIMA 1YT7A 3RVWA 4NV8A 1GMYA 3O1GA 1TL9A 2DJGB 3IUTA 1EWOA 1SP4B 2FUDA 3IEJA 3O0UA 2F1GA 1YK8A 4N79A 2R9CA 2XU4A 4QRXA 2JQFR 5K16A 3H7DA 2WBFX 5PADA 4N4ZA 2DCCA 3P5VA 2P0RA 2FYEA 4YYQA 2PBHA 3RVXA 4P6EA 3H6SA 3MHHA 4BPVA 3AI8A 1BP4A 3F75A 1PBHA 4BSQA 1QOLA 1AIMA 3BPFA 1EF7A 4FK5A 4C5PA 4XR7A 4PP1A 5CVOB 3OVZA 3WXEA 2YJCA 1MDWA 5EF4A 1AECA 2P7UA 2NQGA 2XU5A 1QDQA 3P5UA 3KWBX 4HWYA 4CDCB 1BY8A 3S3QA 4OELA 3HWNA 1ZIVA 1MHWA 2DZZA 3S3RA 1THEA 5CHVA 3V6EA 3MTNA 2DC9A 3DF0A 4QBBA 2Y5BA 1ME4A 2NQIA 3RVVA 4BGFA 4GUZA 2AS8A 2CB5A 1CS8A 1DF0A 1EWPA 4AXMA 2HXZA 4MZSA 3PNRA 4MZOA 4YV8A 5J94A 1YALA 3KKUA 1MEGA 2JQGR 3QJ3A 1AU3A 1Q6KA 2PNSA 1F2BA 1PPNA 1KHPA 3BWKA 3PBHA 3BOWA 1W4TA 4NV7A 3B79A 4RY2A 2AUXA 1X9YA 4BS6A 4Q8HA 1W5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSN A;  4WA6 A;  4MSX A;  8PCH A;  2CIO A;  4CDD B;  3OF9 A;  1CQD A;  2G7Y A;  3MOR A;  3P5X A;  2O6X A;  3N3G A;  4I07 A;  4DMY A;  2VHS A;  1AYV A;  4QRG A;  1PPO A;  1PAD A;  2NQD B;  1JQP A;  3H8B A;  3KFQ A;  2NQA A;  1MIR A;  1HUC B;  3KW9 A;  2AYN A;  2AUZ A;  4CDF B;  3IMA A;  1PXV A;  3H89 A;  1AU0 A;  4X6H A;  1AYU A;  3IV2 A;  1ZCM A;  3OVX A;  2DC6 A;  1U9V A;  3LXS A;  5CVM A;  3U8E A;  1Y4H A;  2YJ8 A;  1A6R A;  1NQC A;  2FT2 A;  1S4V A;  1SNK A;  3HHA A;  2B1M A;  1ME3 A;  2G8E A;  3PW3 A;  4P6G A;  3CBK A;  3K8U A;  3D6S A;  4BQV A;  3WXF A;  3LFY A;  3QT4 A;  1FH0 A;  1O0E A;  1NL6 A;  1NLJ A;  2DZY A;  1CTE A;  3C9E A;  2DCB A;  2PAD A;  2DCD A;  3F5V A;  5JA7 A;  3IOQ A;  2AYO A;  1EWM A;  1XKG A;  1CV8 A;  1U9Q X;  4OEM A;  1EWL A;  4K7C A;  1AYW A;  4QH6 A;  4CDE B;  3KX1 A;  3I3T A;  2FO5 A;  4KLB A;  4AXL A;  1TLO A;  1NPZ A;  3N4C A;  1CSB B;  4YYV A;  4PAD A;  5CHT A;  1NB3 A;  2R9F A;  1GLO A;  4YYU A;  1MEM A;  1CVZ A;  2DCA A;  2YJB A;  2E02 A;  1PE6 A;  1AU4 A;  1CPJ A;  1M6D A;  2DC8 A;  5F02 A;  2E03 A;  3TNX A;  1U9X A;  4YYS A;  4BS5 A;  2ARY A;  2VHF A;  1YVB A;  2R9M A;  4G54 A;  3USV A;  3ERV A;  2AVW A;  1GEC E;  4PP2 E;  3GCB A;  2PRE A;  1CJL A;  3QSD A;  3E1Z B;  3PDF A;  3BC3 A;  5JH3 A;  2G6D A;  3HHI A;  1QXP A;  4Q8G A;  2ACT A;  1ICF A;  1KXR A;  2Y6E A;  2DC7 A;  2E00 A;  1K3B B;  2E01 A;  2IPP B;  3P5W A;  2YJ2 A;  6PAD A;  2C0Y A;  1KFU L;  4XUI A;  3OF8 A;  1VJV A;  1Y08 A;  3H8C A;  2OP3 A;  1TU6 A;  3K24 A;  2GFO A;  4I04 A;  1ITO A;  2OUL A;  2AU1 A;  2XU1 A;  7PCK A;  3CH2 X;  4CZW A;  1GCB A;  1KFX L;  1POP A;  2R6N A;  1PCI A;  4FIP A;  3MHS A;  3ZUA A;  1IWD A;  1MS6 A;  4ZUX U;  4X6J A;  3I06 A;  1BGO A;  2ATO A;  2F7D A;  3IHP A;  1PPP A;  3KWZ A;  2DJF B;  1F2C A;  2P86 A;  2FRQ A;  4FJC A;  5FPW A;  1PIP A;  4YVA A;  3CH3 X;  1U9W A;  1PPD A;  2FQ9 A;  4DMX A;  3CBJ A;  4I05 A;  4PI3 A;  2FTD A;  2BDZ A;  2BDL A;  4W5B A;  3BCN A;  1AU2 A;  3NHE A;  3OIS A;  2G8J A;  3K9M A;  4W4U A;  2HD5 A;  1CB5 A;  2YJ9 A;  1F2A A;  5EGW A;  3WXG A;  2B1N A;  2H7J A;  2R9O A;  4W5C A;  9PAP A;  4YYR A;  4QRV A;  3HD3 A;  2OZ2 A;  2GHU A;  1KHQ A;  4X6I A;  3M99 A;  1DEU A;  2XU3 A;  2HH5 A;  4N8W A;  1F29 A;  2IBI A;  1ATK A;  2FRA A;  4YYW A;  3KSE A;  2HHN A;  5CVN B;  1YK7 A;  5A24 A;  1STF E;  1U5I A;  3BPM A;  1QMY A;  1NB5 A;  3N3K A;  1BQI A;  2R9N A;  3V6C A;  2AIM A;  1YT7 A;  3RVW A;  1GMY A;  3O1G A;  1TL9 A;  2DJG B;  3IUT A;  1EWO A;  1SP4 B;  2FUD A;  3IEJ A;  3O0U A;  2F1G A;  1YK8 A;  4N79 A;  2R9C A;  2XU4 A;  4QRX A;  2JQF R;  5K16 A;  3H7D A;  2WBF X;  5PAD A;  4N4Z A;  2DCC A;  3P5V A;  2P0R A;  2FYE A;  4YYQ A;  2PBH A;  3RVX A;  4P6E A;  3H6S A;  3MHH A;  4BPV A;  3AI8 A;  1BP4 A;  3F75 A;  1PBH A;  4BSQ A;  1QOL A;  1AIM A;  3BPF A;  1EF7 A;  4FK5 A;  4XR7 A;  4PP1 A;  5CVO B;  3OVZ A;  3WXE A;  2YJC A;  1MDW A;  5EF4 A;  1AEC A;  2P7U A;  2NQG A;  2XU5 A;  1QDQ A;  3P5U A;  3KWB X;  4HWY A;  4CDC B;  1BY8 A;  3S3Q A;  4OEL A;  3HWN A;  1ZIV A;  1MHW A;  2DZZ A;  1THE A;  5CHV A;  3V6E A;  3MTN A;  2DC9 A;  3DF0 A;  4QBB A;  2Y5B A;  1ME4 A;  2NQI A;  3RVV A;  2AS8 A;  2CB5 A;  1CS8 A;  1DF0 A;  1EWP A;  4AXM A;  2HXZ A;  4MZS A;  3PNR A;  4MZO A;  4YV8 A;  5J94 A;  1YAL A;  3KKU A;  1MEG A;  2JQG R;  3QJ3 A;  1AU3 A;  1Q6K A;  2PNS A;  1F2B A;  1PPN A;  1KHP A;  3BWK A;  3PBH A;  3BOW A;  3B79 A;  4RY2 A;  2AUX A;  1X9Y A;  4BS6 A;  4Q8H A;  3S3R A; 
#chains in the Genus database with same CATH topology
 1VSN A;  4WA6 A;  4D8E A;  4MSX A;  4OVZ B;  8PCH A;  2CIO A;  4CDD B;  1PVJ A;  1CQD A;  3OF9 A;  2G7Y A;  3MOR A;  3P5X A;  2O6X A;  3N3G A;  4I07 A;  3E9S A;  4DMY A;  2VHS A;  1AYV A;  4QRG A;  1PPO A;  1PAD A;  2NQD B;  1JQP A;  3H8B A;  3KFQ A;  2NQA A;  1MIR A;  1HUC B;  3KW9 A;  2AYN A;  4BOS A;  2AUZ A;  4CDF B;  3IMA A;  1PXV A;  2JTC A;  3H89 A;  1AU0 A;  4X6H A;  1AYU A;  3IV2 A;  1ZCM A;  3OVX A;  2DC6 A;  1U9V A;  2BU3 A;  2J7Q A;  3LXS A;  4MI7 A;  4M0W A;  5CVM A;  3U8E A;  1Y4H A;  2YJ8 A;  1A6R A;  1NQC A;  2FT2 A;  1S4V A;  1SNK A;  3HHA A;  2B1M A;  1ME3 A;  2G8E A;  3PW3 A;  4OW0 A;  4P6G A;  3CBK A;  3K8U A;  2HWK A;  3D6S A;  2AGA A;  3WXF A;  4BQV A;  3LFY A;  3QT4 A;  1FH0 A;  1O0E A;  1NL6 A;  1NLJ A;  2DZY A;  3PRM A;  1CTE A;  3C9E A;  2DCB A;  4PT5 A;  4RF0 A;  2PAD A;  2DCD A;  3F5V A;  5JA7 A;  3IOQ A;  2AYO A;  1EWM A;  1XKG A;  1CV8 A;  1U9Q X;  4OEM A;  1EWL A;  4K7C A;  1AYW A;  4QH6 A;  4CDE B;  3KX1 A;  3I3T A;  2FO5 A;  4KLB A;  4AXL A;  1TLO A;  1NPZ A;  3N4C A;  1CSB B;  4YYV A;  4PAD A;  5CHT A;  1NB3 A;  2R9F A;  1GLO A;  4ZTB A;  4YYU A;  1MEM A;  1CVZ A;  2DCA A;  2YJB A;  2E02 A;  1PE6 A;  4A5U A;  1AU4 A;  1CPJ A;  1M6D A;  2DC8 A;  5F02 A;  2E03 A;  3TNX A;  1U9X A;  4BOU A;  4YYS A;  4BS5 A;  2BTW B;  2ARY A;  2VHF A;  5EZQ A;  1DKI A;  1YVB A;  3PSE A;  2JRI A;  4IP3 A;  2R9M A;  4G54 A;  3USV A;  3ERV A;  2AVW A;  1GEC E;  4IUM A;  4PP2 E;  3GCB A;  2PRE A;  1CJL A;  3QSD A;  3E1Z B;  3PDF A;  3BC3 A;  5JH3 A;  2G6D A;  3HHI A;  1QXP A;  4Q8G A;  2ACT A;  1ICF A;  1KXR A;  2Y6E A;  2DC7 A;  2E00 A;  5JZE A;  3C0R A;  1K3B B;  2E01 A;  2IPP B;  3P5W A;  2YJ2 A;  6PAD A;  2C0Y A;  1KFU L;  4XUI A;  3OF8 A;  1VJV A;  3TRK A;  1Y08 A;  3H8C A;  2OP3 A;  1TU6 A;  4XZX A;  3K24 A;  4RNA A;  2GFO A;  1ITO A;  2OUL A;  4I04 A;  2AU1 A;  2XU1 A;  3OQC A;  7PCK A;  3CH2 X;  4CZW A;  1GCB A;  1KFX L;  1POP A;  2R6N A;  4HXD B;  1PCI A;  4FIP A;  4BOQ A;  3MHS A;  3ZUA A;  1IWD A;  1MS6 A;  4ZUX U;  3BY4 A;  4X6J A;  3I06 A;  4BOP A;  1BGO A;  2ATO A;  2F7D A;  2Z84 A;  3IHP A;  4MM3 B;  1PPP A;  3KWZ A;  2DJF B;  1F2C A;  2P86 A;  3W31 A;  1YZB A;  2DOS A;  2FRQ A;  4FJC A;  5FPW A;  3PHU A;  1PIP A;  4YVA A;  3CH3 X;  1UKF A;  2FE8 A;  3PT2 A;  1U9W A;  1PPD A;  2FQ9 A;  4DMX A;  3CBJ A;  4I05 A;  4PI3 A;  2FTD A;  3MJ5 A;  2BDZ A;  2BDL A;  4W5B A;  3BCN A;  3MTV A;  1AU2 A;  4P16 A;  3NHE A;  3OIS A;  2G8J A;  3IFU A;  3K9M A;  4W4U A;  2HD5 A;  1CB5 A;  3PHW A;  2YJ9 A;  1F2A A;  5EGW A;  3WXG A;  2B1N A;  2H7J A;  2R9O A;  4W5C A;  9PAP A;  4WUR A;  4YYR A;  3O65 A;  4QRV A;  3HD3 A;  2OZ2 A;  2GHU A;  1KHQ A;  4X6I A;  3M99 A;  1DEU A;  2XU3 A;  2HH5 A;  3PHX A;  4N8W A;  1F29 A;  2IBI A;  1ATK A;  2FRA A;  3TMP A;  4YYW A;  3KSE A;  2HHN A;  5CVN B;  1YK7 A;  5A24 A;  1STF E;  1U5I A;  3BPM A;  1QMY A;  1NB5 A;  3N3K A;  1BQI A;  3RNV A;  2R9N A;  3V6C A;  2AIM A;  1YT7 A;  3RVW A;  1GMY A;  3O1G A;  1TL9 A;  2DJG B;  3IUT A;  1EWO A;  4RKX A;  1SP4 B;  3PRP A;  2FUD A;  3IEJ A;  3ZNH A;  3O0U A;  2F1G A;  1YK8 A;  4N79 A;  2R9C A;  2XU4 A;  4QRX A;  2JQF R;  5K16 A;  3H7D A;  2WBF X;  5PAD A;  3B21 A;  2DCC A;  4N4Z A;  3P5V A;  4GUA A;  2P0R A;  2FYE A;  4YYQ A;  2PBH A;  2BTW A;  3RVX A;  4P6E A;  3BB7 A;  3H6S A;  3MHH A;  4BPV A;  3AI8 A;  1BP4 A;  3F75 A;  1PBH A;  4BSQ A;  1QOL A;  1AIM A;  3BPF A;  1EF7 A;  4FK5 A;  4XR7 A;  4PP1 A;  4OVZ A;  5CVO B;  3OVZ A;  4BOZ A;  3WXE A;  2YJC A;  2UZJ A;  1MDW A;  4D8I A;  5EF4 A;  1AEC A;  5KO3 A;  2P7U A;  4REZ A;  2NQG A;  2XU5 A;  1QDQ A;  3P5U A;  3KWB X;  4HWY A;  4CDC B;  1BY8 A;  2J7Q C;  4OEL A;  3HWN A;  3S3Q A;  1ZIV A;  1MHW A;  2DZZ A;  1THE A;  5CHV A;  3V6E A;  3MTN A;  2DC9 A;  3DF0 A;  4QBB A;  5EZS A;  2Y5B A;  1ME4 A;  4RF1 A;  2NQI A;  3MP2 A;  3RVV A;  2AS8 A;  2CB5 A;  4D8B A;  1CS8 A;  1DF0 A;  1EWP A;  3W30 A;  4AXM A;  2HXZ A;  4MZS A;  3PNR A;  4MZO A;  4YV8 A;  3BBA A;  5J94 A;  1YAL A;  3KKU A;  1MEG A;  2JQG R;  3QJ3 A;  1AU3 A;  1Q6K A;  2PNS A;  1F2B A;  1PPN A;  1KHP A;  3BWK A;  3PBH A;  3BOW A;  3B79 A;  4RY2 A;  2AUX A;  5E6J A;  1X9Y A;  4BS6 A;  4Q8H A;  3S3R A;  4R3D A; 
#chains in the Genus database with same CATH homology
 1VSN A;  4WA6 A;  4MSX A;  8PCH A;  2CIO A;  4CDD B;  3OF9 A;  1CQD A;  2G7Y A;  3MOR A;  3P5X A;  2O6X A;  3N3G A;  4I07 A;  4DMY A;  2VHS A;  1AYV A;  4QRG A;  1PPO A;  1PAD A;  2NQD B;  1JQP A;  3H8B A;  3KFQ A;  2NQA A;  1MIR A;  1HUC B;  3KW9 A;  2AYN A;  2AUZ A;  4CDF B;  3IMA A;  1PXV A;  3H89 A;  1AU0 A;  4X6H A;  1AYU A;  3IV2 A;  1ZCM A;  3OVX A;  2DC6 A;  1U9V A;  2VFB A;  3LXS A;  5CVM A;  3U8E A;  1Y4H A;  2YJ8 A;  1A6R A;  1NQC A;  2FT2 A;  1S4V A;  1SNK A;  3HHA A;  2B1M A;  1ME3 A;  2G8E A;  3PW3 A;  4P6G A;  3CBK A;  3K8U A;  3D6S A;  4BQV A;  3WXF A;  3LFY A;  3QT4 A;  1FH0 A;  1O0E A;  1NL6 A;  1NLJ A;  2DZY A;  1CTE A;  3C9E A;  2DCB A;  2PAD A;  2DCD A;  3F5V A;  5JA7 A;  3IOQ A;  2AYO A;  1EWM A;  1XKG A;  1CV8 A;  1U9Q X;  4OEM A;  1EWL A;  4K7C A;  1AYW A;  4QH6 A;  4CDE B;  3KX1 A;  3I3T A;  2FO5 A;  4KLB A;  4AXL A;  1TLO A;  1NPZ A;  3N4C A;  1CSB B;  4YYV A;  4PAD A;  5CHT A;  1NB3 A;  2R9F A;  1GLO A;  4YYU A;  1MEM A;  1CVZ A;  2DCA A;  2YJB A;  3D9W A;  2E02 A;  1PE6 A;  1AU4 A;  1CPJ A;  1M6D A;  2DC8 A;  5F02 A;  2E03 A;  3TNX A;  3LTW A;  1U9X A;  4YYS A;  4BS5 A;  2ARY A;  2VHF A;  1YVB A;  2R9M A;  4G54 A;  3USV A;  3ERV A;  2AVW A;  1GEC E;  4PP2 E;  3GCB A;  2PRE A;  1CJL A;  3QSD A;  3E1Z B;  3PDF A;  3BC3 A;  5JH3 A;  2G6D A;  3HHI A;  1QXP A;  4Q8G A;  2ACT A;  1ICF A;  1KXR A;  2Y6E A;  2DC7 A;  2E00 A;  1K3B B;  2E01 A;  2IPP B;  3P5W A;  2YJ2 A;  6PAD A;  2C0Y A;  1KFU L;  4XUI A;  3OF8 A;  1VJV A;  1Y08 A;  3H8C A;  2OP3 A;  1TU6 A;  3K24 A;  2GFO A;  1W6F A;  4I04 A;  1ITO A;  2OUL A;  2AU1 A;  2XU1 A;  7PCK A;  3CH2 X;  4CZW A;  4B55 A;  1GCB A;  1KFX L;  1POP A;  2R6N A;  1PCI A;  4FIP A;  3MHS A;  3ZUA A;  1IWD A;  1MS6 A;  4ZUX U;  4X6J A;  2BSZ A;  3I06 A;  1BGO A;  2ATO A;  2F7D A;  3IHP A;  1PPP A;  3KWZ A;  2DJF B;  1F2C A;  2P86 A;  2FRQ A;  4FJC A;  5FPW A;  1PIP A;  4YVA A;  3CH3 X;  1U9W A;  1E2T A;  1PPD A;  2FQ9 A;  4DMX A;  3CBJ A;  4I05 A;  4PI3 A;  2FTD A;  2BDZ A;  2BDL A;  4W5B A;  3BCN A;  1AU2 A;  3NHE A;  3OIS A;  2G8J A;  3K9M A;  4W4U A;  2HD5 A;  2VFC A;  1CB5 A;  2YJ9 A;  1F2A A;  5EGW A;  3WXG A;  2B1N A;  2H7J A;  2R9O A;  4W5C A;  9PAP A;  4YYR A;  4QRV A;  3HD3 A;  2OZ2 A;  2GHU A;  1KHQ A;  4X6I A;  3M99 A;  1DEU A;  2XU3 A;  2HH5 A;  4N8W A;  1F29 A;  2IBI A;  1ATK A;  2FRA A;  1GX3 A;  4YYW A;  3KSE A;  2HHN A;  5CVN B;  1YK7 A;  5A24 A;  1STF E;  1U5I A;  3BPM A;  1QMY A;  1NB5 A;  3N3K A;  1BQI A;  2R9N A;  3V6C A;  2AIM A;  1YT7 A;  3RVW A;  4NV8 A;  1GMY A;  3O1G A;  1TL9 A;  2DJG B;  3IUT A;  1EWO A;  1SP4 B;  2FUD A;  3IEJ A;  3O0U A;  2F1G A;  1YK8 A;  4N79 A;  2R9C A;  2XU4 A;  4QRX A;  2JQF R;  5K16 A;  3H7D A;  2WBF X;  5PAD A;  4N4Z A;  2DCC A;  3P5V A;  2P0R A;  2FYE A;  4YYQ A;  2PBH A;  3RVX A;  4P6E A;  3H6S A;  3MHH A;  4BPV A;  3AI8 A;  1BP4 A;  3F75 A;  1PBH A;  4BSQ A;  1QOL A;  1AIM A;  3BPF A;  1EF7 A;  4FK5 A;  4C5P A;  4XR7 A;  4PP1 A;  5CVO B;  3OVZ A;  3WXE A;  2YJC A;  1MDW A;  5EF4 A;  1AEC A;  2P7U A;  2NQG A;  2XU5 A;  1QDQ A;  3P5U A;  3KWB X;  4HWY A;  4CDC B;  1BY8 A;  3S3Q A;  4OEL A;  3HWN A;  1ZIV A;  1MHW A;  2DZZ A;  3S3R A;  1THE A;  5CHV A;  3V6E A;  3MTN A;  2DC9 A;  3DF0 A;  4QBB A;  2Y5B A;  1ME4 A;  2NQI A;  3RVV A;  4BGF A;  4GUZ A;  2AS8 A;  2CB5 A;  1CS8 A;  1DF0 A;  1EWP A;  4AXM A;  2HXZ A;  4MZS A;  3PNR A;  4MZO A;  4YV8 A;  5J94 A;  1YAL A;  3KKU A;  1MEG A;  2JQG R;  3QJ3 A;  1AU3 A;  1Q6K A;  2PNS A;  1F2B A;  1PPN A;  1KHP A;  3BWK A;  3PBH A;  3BOW A;  1W4T A;  4NV7 A;  3B79 A;  4RY2 A;  2AUX A;  1X9Y A;  4BS6 A;  4Q8H A;  1W5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...