2AU1A

Crystal structure of group a streptococcus mac-1 orthorhombic form
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
292
structure length
292
Chain Sequence
VTSVWTKGVTPPANFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKDQIKRYLEEHPEKQKINFNGEQMFDVKEAIDTKNHQLDSKLFEYFKEKAFPYLSTKHLGVFPDHVIDMFINGYRLSLTNHGPTPVKEGSKDPRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG-degrading protease
publication title Crystal structure of group a streptococcus mac-1: insight into dimer-mediated specificity for recognition of human IgG.
pubmed doi rcsb
molecule tags Hydrolase
total genus 83
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2005-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2au1A01
1ATKA 2AYNA 1ME4A 4N8WA 2G8EA 1KHQA 3HWNA 4BQVA 4MZSA 3QJ3A 2FT2A 5PADA 4W4UA 2YJ2A 4QRVA 3H6SA 4WA6A 2R9CA 1MHWA 1PBHA 1EWMA 5CHTA 2BDLA 4CZWA 1QXPA 1O0EA 1MIRA 4CDEB 1NB3A 1U9WA 2NQDB 3H89A 2FO5A 3ZUAA 1AU2A 2NQIA 1U9XA 2DC6A 3WXGA 2DC7A 3OVZA 1MDWA 1ITOA 4OEMA 1A6RA 3PBHA 2YJ9A 2C0YA 4YYVA 4I07A 2O6XA 3V6CA 1NB5A 1PCIA 1DEUA 4QH6A 1CB5A 2OULA 2DJGB 3BCNA 4X6HA 2HD5A 3O1GA 4X6IA 2DCDA 1MS6A 1PE6A 2XU5A 2R9NA 3IOQA 2JQFR 1MEMA 2YJ8A 1CQDA 1GMYA 4DMXA 3OISA 5JH3A 2FRQA 1YALA 3GCBA 1TU6A 2ACTA 2Y6EA 1F29A 4P6EA 2GFOA 2E03A 2DCAA 1F2AA 3PNRA 4PP1A 3PW3A 3KWZA 3D6SA 2ATOA 4CDCB 4QBBA 2OP3A 2AYOA 4BSQA 2CB5A 2PADA 2AUXA 1CSBB 1KXRA 3IV2A 2DZZA 1CPJA 4PADA 3CH2X 4FIPA 3H7DA 1THEA 8PCHA 2R6NA 2G8JA 2F7DA 4YYQA 4G54A 1YK8A 5FPWA 1FH0A 3LXSA 1QDQA 1POPA 3V6EA 3K9MA 1PPOA 1NLJA 3OF8A 3BOWA 2YJCA 4PP2E 4BS5A 2XU3A 3HD3A 1Y4HA 4AXLA 4QRGA 3O0UA 1CVZA 2P7UA 1SP4B 3IHPA 3QT4A 3N3KA 2BDZA 4MSXA 2HHNA 2F1GA 1PPPA 5CVOB 1AU3A 1IWDA 1GCBA 2DZYA 4P6GA 5CHVA 1NPZA 3P5VA 3MHSA 1GLOA 4XR7A 3M99A 2R9OA 2PNSA 4CDDB 3B79A 5J94A 4N79A 4Q8GA 3USVA 3MHHA 3P5UA 3K8UA 1F2BA 3F75A 1STFE 4PI3A 4YVAA 1YVBA 3P5XA 5EGWA 1U9VA 2G6DA 2DC9A 2VHSA 2XU4A 3ERVA 2AU1A 3K24A 3BC3A 2PBHA 1AU4A 1X9YA 4FJCA 4HWYA 3DF0A 5F02A 2IBIA 2HH5A 1CV8A 2DJFB 4FK5A 3N3GA 1M6DA 4YYUA 1VJVA 3KWBX 3MORA 4YYSA 2E00A 4CDFB 2YJBA 2NQGA 9PAPA 2R9FA 3N4CA 2B1NA 3IEJA 1PIPA 3HHIA 3KKUA 3WXEA 2XU1A 2WBFX 3IUTA 3OVXA 2HXZA 4W5BA 2CIOA 3AI8A 1AU0A 1PPDA 2DCCA 2PREA 3H8BA 4N4ZA 2H7JA 3OF9A 1F2CA 3WXFA 1AECA 5K16A 3E1ZB 4BPVA 4K7CA 2R9MA 2JQGR 2P86A 1MEGA 3HHAA 1EWOA 3I06A 4W5CA 1VSNA 4I04A 2G7YA 1U5IA 1AYWA 2FUDA 1ZIVA 1YK7A 1XKGA 1CTEA 5JA7A 2ARYA 1TLOA 2AUZA 3LFYA 3PDFA 4DMYA 1QOLA 3CH3X 3IMAA 1SNKA 4KLBA 3KFQA 1NL6A 1CJLA 1ICFA 1EWPA 4OELA 3BPFA 2AS8A 7PCKA 5EF4A 1QMYA 2AVWA 1BQIA 1PADA 2B1MA 2DCBA 3KSEA 2IPPB 2P0RA 3S3QA 5CVNB 1YT7A 5CVMA 2Y5BA 1PPNA 1K3BB 3BPMA 4YYRA 3QSDA 3KW9A 2E02A 3RVXA 3P5WA 2GHUA 1KFXL 2OZ2A 1GECE 1Y08A 4X6JA 3KX1A 4Q8HA 3CBKA 1KHPA 1ZCMA 4AXMA 1TL9A 2FTDA 3C9EA 1BP4A 3U8EA 4YV8A 1ME3A 3F5VA 1HUCB 4RY2A 2DC8A 1CS8A 3I3TA 1S4VA 3CBJA 2E01A 1AYUA 2NQAA 1EWLA 3RVWA 2FRAA 3RVVA 3TNXA 1BY8A 6PADA 3BWKA 4I05A 4ZUXU 1EF7A 1AIMA 5A24A 1U9QX 2FQ9A 3MTNA 1KFUL 1PXVA 4YYWA 2VHFA 1NQCA 1Q6KA 3NHEA 4XUIA 2FYEA 4MZOA 1DF0A 1AYVA 4BS6A 3H8CA 2AIMA 1BGOA 4QRXA 3S3RA 1JQPA
chains in the Genus database with same CATH superfamily
1ATKA 2AYNA 1ME4A 4N8WA 2G8EA 4BOZA 1KHQA 3HWNA 4BQVA 4MZSA 3PHUA 3QJ3A 2FT2A 5PADA 4W4UA 2YJ2A 4QRVA 4ZTBA 3PRPA 3H6SA 3PT2A 4WA6A 2R9CA 1MHWA 1PBHA 1EWMA 5CHTA 2BDLA 4CZWA 1QXPA 2Z84A 1O0EA 1MIRA 4CDEB 3E9SA 1NB3A 1U9WA 2NQDB 3H89A 2FO5A 3ZUAA 1AU2A 2BTWB 1U9XA 2DC6A 2NQIA 3WXGA 3MTVA 2DC7A 3OVZA 1MDWA 4GUAA 1ITOA 4XZXA 3BY4A 4OEMA 1A6RA 3PBHA 2YJ9A 2C0YA 4YYVA 4I07A 2O6XA 3V6CA 1NB5A 1PCIA 1DEUA 4QH6A 1CB5A 2OULA 2DJGB 3BCNA 3BBAA 4X6HA 2HD5A 3O1GA 4X6IA 2DCDA 1MS6A 1PE6A 2XU5A 2R9NA 3IOQA 2JQFR 1MEMA 4RNAA 2YJ8A 4REZA 5JZEA 1CQDA 1GMYA 4DMXA 3OISA 5JH3A 2FRQA 1YALA 5EZQA 3GCBA 1TU6A 2ACTA 2Y6EA 1F29A 4P6EA 2GFOA 2E03A 2DCAA 3BB7A 1F2AA 3PNRA 4PP1A 3PW3A 3KWZA 4IP3A 3D6SA 2ATOA 4CDCB 4QBBA 2OP3A 3PSEA 4R3DA 2AYOA 4BSQA 2CB5A 2PADA 2AUXA 1CSBB 4BOSA 1KXRA 3IV2A 2DZZA 1CPJA 3IFUA 4PADA 4RKXA 3CH2X 4FIPA 3H7DA 1THEA 8PCHA 2R6NA 2G8JA 2F7DA 4YYQA 4G54A 1YK8A 5FPWA 1FH0A 3LXSA 1QDQA 1POPA 3V6EA 3K9MA 1PPOA 1NLJA 3OF8A 2JRIA 2YJCA 3BOWA 4PP2E 4BS5A 2XU3A 3HD3A 1Y4HA 4AXLA 4QRGA 3O0UA 1CVZA 2P7UA 1SP4B 3IHPA 3QT4A 3N3KA 4IUMA 2BDZA 4MSXA 4OVZA 4HXDB 4A5UA 2HHNA 2F1GA 1PPPA 5CVOB 1AU3A 1IWDA 1GCBA 2DZYA 1UKFA 4P6GA 5CHVA 5E6JA 1NPZA 3P5VA 3MHSA 1GLOA 4XR7A 3M99A 2R9OA 2DOSA 2PNSA 3PRMA 4CDDB 3B79A 5J94A 4N79A 4Q8GA 3USVA 3MHHA 3P5UA 3K8UA 1F2BA 3F75A 1STFE 4PI3A 4YVAA 1YVBA 3P5XA 4BOPA 5EGWA 1U9VA 2G6DA 2DC9A 2VHSA 4OW0A 2XU4A 3ERVA 2AU1A 3K24A 3BC3A 2PBHA 1PVJA 1AU4A 1X9YA 4FJCA 4HWYA 3DF0A 4MI7A 5F02A 2IBIA 2HH5A 1CV8A 2DJFB 1DKIA 2J7QA 4FK5A 3N3GA 1M6DA 4YYUA 1VJVA 3KWBX 3MORA 4YYSA 3C0RA 2E00A 4CDFB 2YJBA 2NQGA 9PAPA 2R9FA 3N4CA 2B1NA 3IEJA 1PIPA 3ZNHA 3HHIA 3KKUA 3WXEA 3RNVA 2XU1A 2WBFX 3IUTA 3OVXA 4D8EA 3O65A 2HXZA 4W5BA 2CIOA 3AI8A 1AU0A 1PPDA 2DCCA 4OVZB 2PREA 3H8BA 4N4ZA 2H7JA 3OF9A 1F2CA 4BOQA 3WXFA 1AECA 5K16A 3E1ZB 4BPVA 3W31A 3TMPA 4K7CA 2R9MA 2JQGR 2P86A 1MEGA 3HHAA 4RF1A 1EWOA 2JTCA 3I06A 4W5CA 1VSNA 4I04A 2G7YA 1U5IA 2UZJA 1AYWA 2J7QC 2FUDA 4D8BA 1ZIVA 1YZBA 1YK7A 1XKGA 1CTEA 5JA7A 2ARYA 1TLOA 2AUZA 2AGAA 3LFYA 3PDFA 4DMYA 1QOLA 3CH3X 3IMAA 1SNKA 4KLBA 3KFQA 1NL6A 3TRKA 1CJLA 1ICFA 1EWPA 3MJ5A 2HWKA 3B21A 4OELA 3BPFA 2AS8A 7PCKA 3OQCA 5EF4A 1QMYA 2AVWA 1BQIA 1PADA 2B1MA 2DCBA 3KSEA 4MM3B 2IPPB 2P0RA 4M0WA 3S3QA 5CVNB 1YT7A 5CVMA 4P16A 2Y5BA 1PPNA 1K3BB 3BPMA 4YYRA 3QSDA 3KW9A 2E02A 3RVXA 3P5WA 2GHUA 1KFXL 2OZ2A 1GECE 1Y08A 4X6JA 3KX1A 4Q8HA 3CBKA 3PHWA 1KHPA 1ZCMA 4AXMA 1TL9A 2FTDA 3C9EA 4PT5A 1BP4A 3U8EA 4YV8A 2FE8A 1ME3A 3F5VA 1HUCB 4RY2A 3PHXA 2DC8A 2BU3A 5KO3A 3W30A 1CS8A 3I3TA 1S4VA 3CBJA 2E01A 1AYUA 2NQAA 1EWLA 3RVWA 2FRAA 3RVVA 3TNXA 1BY8A 4D8IA 6PADA 4RF0A 4BOUA 3BWKA 2BTWA 5EZSA 4I05A 4ZUXU 1EF7A 1AIMA 3MP2A 5A24A 1U9QX 2FQ9A 3MTNA 1KFUL 1PXVA 4YYWA 2VHFA 1NQCA 1Q6KA 3NHEA 4XUIA 2FYEA 4MZOA 1DF0A 1AYVA 4BS6A 3H8CA 4WURA 2AIMA 1BGOA 4QRXA 3S3RA 1JQPA
chains in the Genus database with same CATH topology
1ATKA 2AYNA 1ME4A 4N8WA 2G8EA 1KHQA 4C5PA 3HWNA 2VFBA 4B55A 4NV7A 4NV8A 4BQVA 4MZSA 3QJ3A 2FT2A 5PADA 4W4UA 2YJ2A 4QRVA 3H6SA 4WA6A 2R9CA 1MHWA 1PBHA 1EWMA 5CHTA 2BDLA 4CZWA 1QXPA 1O0EA 1MIRA 4CDEB 1NB3A 1U9WA 2NQDB 3H89A 2FO5A 3ZUAA 1AU2A 2NQIA 1U9XA 2DC6A 3WXGA 2DC7A 3OVZA 1MDWA 1ITOA 4OEMA 1A6RA 3PBHA 2YJ9A 2C0YA 4YYVA 4I07A 2O6XA 3V6CA 1NB5A 1PCIA 1DEUA 4QH6A 1CB5A 2OULA 2DJGB 3BCNA 4X6HA 2HD5A 3O1GA 4X6IA 2DCDA 1MS6A 1PE6A 2XU5A 2R9NA 3IOQA 2JQFR 1MEMA 2YJ8A 3D9WA 1CQDA 1GMYA 4DMXA 3OISA 5JH3A 2FRQA 1YALA 3GCBA 1TU6A 2ACTA 2Y6EA 1F29A 4P6EA 2GFOA 2E03A 2DCAA 1F2AA 3PNRA 4PP1A 3PW3A 3KWZA 3D6SA 2ATOA 4CDCB 4QBBA 2OP3A 2AYOA 4BSQA 2CB5A 2PADA 2AUXA 1CSBB 1KXRA 3IV2A 2DZZA 1CPJA 4PADA 3CH2X 4FIPA 3H7DA 1THEA 8PCHA 2R6NA 2G8JA 2F7DA 2VFCA 4YYQA 4G54A 1YK8A 5FPWA 1FH0A 3LXSA 1QDQA 1POPA 3V6EA 3K9MA 1PPOA 1NLJA 3OF8A 3BOWA 2YJCA 4PP2E 4BS5A 2XU3A 3HD3A 1Y4HA 4AXLA 4QRGA 3O0UA 1CVZA 2P7UA 1SP4B 3IHPA 3QT4A 3N3KA 2BDZA 4MSXA 2HHNA 2F1GA 1PPPA 5CVOB 1AU3A 1IWDA 1GCBA 2DZYA 4P6GA 5CHVA 1NPZA 3P5VA 3MHSA 1GLOA 1W5RA 4XR7A 3M99A 2R9OA 2PNSA 4CDDB 3B79A 5J94A 4N79A 4Q8GA 3USVA 3MHHA 3P5UA 3K8UA 1F2BA 3F75A 1STFE 4PI3A 4YVAA 1YVBA 3P5XA 5EGWA 1U9VA 2BSZA 2G6DA 2DC9A 2VHSA 2XU4A 3ERVA 2AU1A 3LTWA 3K24A 3BC3A 2PBHA 1AU4A 1X9YA 4FJCA 4HWYA 1W4TA 3DF0A 5F02A 2IBIA 2HH5A 1CV8A 2DJFB 4FK5A 3N3GA 1M6DA 4YYUA 1VJVA 3KWBX 3MORA 4YYSA 2E00A 4CDFB 2YJBA 2NQGA 9PAPA 2R9FA 3N4CA 2B1NA 3IEJA 1PIPA 1GX3A 3HHIA 3KKUA 3WXEA 2XU1A 2WBFX 3IUTA 3OVXA 2HXZA 4W5BA 2CIOA 3AI8A 1AU0A 1PPDA 2DCCA 2PREA 3H8BA 4N4ZA 2H7JA 3OF9A 1F2CA 3WXFA 1AECA 5K16A 3E1ZB 4BPVA 4K7CA 2R9MA 2JQGR 2P86A 1MEGA 3HHAA 1EWOA 3I06A 4W5CA 1VSNA 4I04A 2G7YA 1U5IA 1AYWA 2FUDA 1ZIVA 1YK7A 1XKGA 1CTEA 5JA7A 2ARYA 1TLOA 2AUZA 3LFYA 3PDFA 4DMYA 1QOLA 3CH3X 3IMAA 1SNKA 4KLBA 3KFQA 1NL6A 1CJLA 1W6FA 4BGFA 1ICFA 1EWPA 4OELA 3BPFA 2AS8A 7PCKA 5EF4A 1QMYA 2AVWA 1BQIA 1PADA 2B1MA 2DCBA 3KSEA 2IPPB 2P0RA 3S3QA 5CVNB 1YT7A 5CVMA 2Y5BA 1PPNA 1K3BB 3BPMA 4YYRA 3QSDA 3KW9A 2E02A 3RVXA 3P5WA 2GHUA 1KFXL 2OZ2A 1GECE 1Y08A 4X6JA 3KX1A 4Q8HA 3CBKA 1KHPA 1ZCMA 4AXMA 1TL9A 2FTDA 3C9EA 1BP4A 3U8EA 4YV8A 1ME3A 3F5VA 1HUCB 4RY2A 2DC8A 1CS8A 3I3TA 1S4VA 3CBJA 2E01A 1AYUA 2NQAA 1EWLA 3RVWA 2FRAA 3RVVA 3TNXA 1BY8A 1E2TA 6PADA 3BWKA 4I05A 4ZUXU 1EF7A 1AIMA 5A24A 1U9QX 2FQ9A 4GUZA 3MTNA 1KFUL 1PXVA 4YYWA 2VHFA 1NQCA 1Q6KA 3NHEA 4XUIA 2FYEA 4MZOA 1DF0A 1AYVA 4BS6A 3H8CA 2AIMA 1BGOA 4QRXA 3S3RA 1JQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATK A;  2AYN A;  1ME4 A;  4N8W A;  2G8E A;  1KHQ A;  3HWN A;  4BQV A;  4MZS A;  3QJ3 A;  2FT2 A;  5PAD A;  4W4U A;  2YJ2 A;  4QRV A;  3H6S A;  4WA6 A;  2R9C A;  1MHW A;  1PBH A;  1EWM A;  5CHT A;  2BDL A;  4CZW A;  1QXP A;  1O0E A;  1MIR A;  4CDE B;  1NB3 A;  1U9W A;  2NQD B;  3H89 A;  2FO5 A;  3ZUA A;  1AU2 A;  2NQI A;  1U9X A;  2DC6 A;  3WXG A;  2DC7 A;  3OVZ A;  1MDW A;  1ITO A;  4OEM A;  1A6R A;  3PBH A;  2YJ9 A;  2C0Y A;  4YYV A;  4I07 A;  2O6X A;  3V6C A;  1NB5 A;  1PCI A;  1DEU A;  4QH6 A;  1CB5 A;  2OUL A;  2DJG B;  3BCN A;  4X6H A;  2HD5 A;  3O1G A;  4X6I A;  2DCD A;  1MS6 A;  1PE6 A;  2XU5 A;  2R9N A;  3IOQ A;  2JQF R;  1MEM A;  2YJ8 A;  1CQD A;  1GMY A;  4DMX A;  3OIS A;  5JH3 A;  2FRQ A;  1YAL A;  3GCB A;  1TU6 A;  2ACT A;  2Y6E A;  1F29 A;  4P6E A;  2GFO A;  2E03 A;  2DCA A;  1F2A A;  3PNR A;  4PP1 A;  3PW3 A;  3KWZ A;  3D6S A;  2ATO A;  4CDC B;  4QBB A;  2OP3 A;  2AYO A;  4BSQ A;  2CB5 A;  2PAD A;  2AUX A;  1CSB B;  1KXR A;  3IV2 A;  2DZZ A;  1CPJ A;  4PAD A;  3CH2 X;  4FIP A;  3H7D A;  1THE A;  8PCH A;  2R6N A;  2G8J A;  2F7D A;  4YYQ A;  4G54 A;  1YK8 A;  5FPW A;  1FH0 A;  3LXS A;  1QDQ A;  1POP A;  3V6E A;  3K9M A;  1PPO A;  1NLJ A;  3OF8 A;  3BOW A;  2YJC A;  4PP2 E;  4BS5 A;  2XU3 A;  3HD3 A;  1Y4H A;  4AXL A;  4QRG A;  3O0U A;  1CVZ A;  2P7U A;  1SP4 B;  3IHP A;  3QT4 A;  3N3K A;  2BDZ A;  4MSX A;  2HHN A;  2F1G A;  1PPP A;  5CVO B;  1AU3 A;  1IWD A;  1GCB A;  2DZY A;  4P6G A;  5CHV A;  1NPZ A;  3P5V A;  3MHS A;  1GLO A;  4XR7 A;  3M99 A;  2R9O A;  2PNS A;  4CDD B;  3B79 A;  5J94 A;  4N79 A;  4Q8G A;  3USV A;  3MHH A;  3P5U A;  3K8U A;  1F2B A;  3F75 A;  1STF E;  4PI3 A;  4YVA A;  1YVB A;  3P5X A;  5EGW A;  1U9V A;  2G6D A;  2DC9 A;  2VHS A;  2XU4 A;  3ERV A;  2AU1 A;  3K24 A;  3BC3 A;  2PBH A;  1AU4 A;  1X9Y A;  4FJC A;  4HWY A;  3DF0 A;  5F02 A;  2IBI A;  2HH5 A;  1CV8 A;  2DJF B;  4FK5 A;  3N3G A;  1M6D A;  4YYU A;  1VJV A;  3KWB X;  3MOR A;  4YYS A;  2E00 A;  4CDF B;  2YJB A;  2NQG A;  9PAP A;  2R9F A;  3N4C A;  2B1N A;  3IEJ A;  1PIP A;  3HHI A;  3KKU A;  3WXE A;  2XU1 A;  2WBF X;  3IUT A;  3OVX A;  2HXZ A;  4W5B A;  2CIO A;  3AI8 A;  1AU0 A;  1PPD A;  2DCC A;  2PRE A;  3H8B A;  4N4Z A;  2H7J A;  3OF9 A;  1F2C A;  3WXF A;  1AEC A;  5K16 A;  3E1Z B;  4BPV A;  4K7C A;  2R9M A;  2JQG R;  2P86 A;  1MEG A;  3HHA A;  1EWO A;  3I06 A;  4W5C A;  1VSN A;  4I04 A;  2G7Y A;  1U5I A;  1AYW A;  2FUD A;  1ZIV A;  1YK7 A;  1XKG A;  1CTE A;  5JA7 A;  2ARY A;  1TLO A;  2AUZ A;  3LFY A;  3PDF A;  4DMY A;  1QOL A;  3CH3 X;  3IMA A;  1SNK A;  4KLB A;  3KFQ A;  1NL6 A;  1CJL A;  1ICF A;  1EWP A;  4OEL A;  3BPF A;  2AS8 A;  7PCK A;  5EF4 A;  1QMY A;  2AVW A;  1BQI A;  1PAD A;  2B1M A;  2DCB A;  3KSE A;  2IPP B;  2P0R A;  3S3Q A;  5CVN B;  1YT7 A;  5CVM A;  2Y5B A;  1PPN A;  1K3B B;  3BPM A;  4YYR A;  3QSD A;  3KW9 A;  2E02 A;  3RVX A;  3P5W A;  2GHU A;  1KFX L;  2OZ2 A;  1GEC E;  1Y08 A;  4X6J A;  3KX1 A;  4Q8H A;  3CBK A;  1KHP A;  1ZCM A;  4AXM A;  1TL9 A;  2FTD A;  3C9E A;  1BP4 A;  3U8E A;  4YV8 A;  1ME3 A;  3F5V A;  1HUC B;  4RY2 A;  2DC8 A;  1CS8 A;  3I3T A;  1S4V A;  3CBJ A;  2E01 A;  1AYU A;  2NQA A;  1EWL A;  3RVW A;  2FRA A;  3RVV A;  3TNX A;  1BY8 A;  6PAD A;  3BWK A;  4I05 A;  4ZUX U;  1EF7 A;  1AIM A;  5A24 A;  1U9Q X;  2FQ9 A;  3MTN A;  1KFU L;  1PXV A;  4YYW A;  2VHF A;  1NQC A;  1Q6K A;  3NHE A;  4XUI A;  2FYE A;  4MZO A;  1DF0 A;  1AYV A;  4BS6 A;  3H8C A;  2AIM A;  1BGO A;  4QRX A;  3S3R A;  1JQP A; 
#chains in the Genus database with same CATH topology
 1ATK A;  2AYN A;  1ME4 A;  4N8W A;  2G8E A;  4BOZ A;  1KHQ A;  3HWN A;  4BQV A;  4MZS A;  3PHU A;  3QJ3 A;  2FT2 A;  5PAD A;  4W4U A;  2YJ2 A;  4QRV A;  4ZTB A;  3PRP A;  3H6S A;  3PT2 A;  4WA6 A;  2R9C A;  1MHW A;  1PBH A;  1EWM A;  5CHT A;  2BDL A;  4CZW A;  1QXP A;  2Z84 A;  1O0E A;  1MIR A;  4CDE B;  3E9S A;  1NB3 A;  1U9W A;  2NQD B;  3H89 A;  2FO5 A;  3ZUA A;  1AU2 A;  2BTW B;  1U9X A;  2DC6 A;  2NQI A;  3WXG A;  3MTV A;  2DC7 A;  3OVZ A;  1MDW A;  4GUA A;  1ITO A;  4XZX A;  3BY4 A;  4OEM A;  1A6R A;  3PBH A;  2YJ9 A;  2C0Y A;  4YYV A;  4I07 A;  2O6X A;  3V6C A;  1NB5 A;  1PCI A;  1DEU A;  4QH6 A;  1CB5 A;  2OUL A;  2DJG B;  3BCN A;  3BBA A;  4X6H A;  2HD5 A;  3O1G A;  4X6I A;  2DCD A;  1MS6 A;  1PE6 A;  2XU5 A;  2R9N A;  3IOQ A;  2JQF R;  1MEM A;  4RNA A;  2YJ8 A;  4REZ A;  5JZE A;  1CQD A;  1GMY A;  4DMX A;  3OIS A;  5JH3 A;  2FRQ A;  1YAL A;  5EZQ A;  3GCB A;  1TU6 A;  2ACT A;  2Y6E A;  1F29 A;  4P6E A;  2GFO A;  2E03 A;  2DCA A;  3BB7 A;  1F2A A;  3PNR A;  4PP1 A;  3PW3 A;  3KWZ A;  4IP3 A;  3D6S A;  2ATO A;  4CDC B;  4QBB A;  2OP3 A;  3PSE A;  4R3D A;  2AYO A;  4BSQ A;  2CB5 A;  2PAD A;  2AUX A;  1CSB B;  4BOS A;  1KXR A;  3IV2 A;  2DZZ A;  1CPJ A;  3IFU A;  4PAD A;  4RKX A;  3CH2 X;  4FIP A;  3H7D A;  1THE A;  8PCH A;  2R6N A;  2G8J A;  2F7D A;  4YYQ A;  4G54 A;  1YK8 A;  5FPW A;  1FH0 A;  3LXS A;  1QDQ A;  1POP A;  3V6E A;  3K9M A;  1PPO A;  1NLJ A;  3OF8 A;  2JRI A;  2YJC A;  3BOW A;  4PP2 E;  4BS5 A;  2XU3 A;  3HD3 A;  1Y4H A;  4AXL A;  4QRG A;  3O0U A;  1CVZ A;  2P7U A;  1SP4 B;  3IHP A;  3QT4 A;  3N3K A;  4IUM A;  2BDZ A;  4MSX A;  4OVZ A;  4HXD B;  4A5U A;  2HHN A;  2F1G A;  1PPP A;  5CVO B;  1AU3 A;  1IWD A;  1GCB A;  2DZY A;  1UKF A;  4P6G A;  5CHV A;  5E6J A;  1NPZ A;  3P5V A;  3MHS A;  1GLO A;  4XR7 A;  3M99 A;  2R9O A;  2DOS A;  2PNS A;  3PRM A;  4CDD B;  3B79 A;  5J94 A;  4N79 A;  4Q8G A;  3USV A;  3MHH A;  3P5U A;  3K8U A;  1F2B A;  3F75 A;  1STF E;  4PI3 A;  4YVA A;  1YVB A;  3P5X A;  4BOP A;  5EGW A;  1U9V A;  2G6D A;  2DC9 A;  2VHS A;  4OW0 A;  2XU4 A;  3ERV A;  2AU1 A;  3K24 A;  3BC3 A;  2PBH A;  1PVJ A;  1AU4 A;  1X9Y A;  4FJC A;  4HWY A;  3DF0 A;  4MI7 A;  5F02 A;  2IBI A;  2HH5 A;  1CV8 A;  2DJF B;  1DKI A;  2J7Q A;  4FK5 A;  3N3G A;  1M6D A;  4YYU A;  1VJV A;  3KWB X;  3MOR A;  4YYS A;  3C0R A;  2E00 A;  4CDF B;  2YJB A;  2NQG A;  9PAP A;  2R9F A;  3N4C A;  2B1N A;  3IEJ A;  1PIP A;  3ZNH A;  3HHI A;  3KKU A;  3WXE A;  3RNV A;  2XU1 A;  2WBF X;  3IUT A;  3OVX A;  4D8E A;  3O65 A;  2HXZ A;  4W5B A;  2CIO A;  3AI8 A;  1AU0 A;  1PPD A;  2DCC A;  4OVZ B;  2PRE A;  3H8B A;  4N4Z A;  2H7J A;  3OF9 A;  1F2C A;  4BOQ A;  3WXF A;  1AEC A;  5K16 A;  3E1Z B;  4BPV A;  3W31 A;  3TMP A;  4K7C A;  2R9M A;  2JQG R;  2P86 A;  1MEG A;  3HHA A;  4RF1 A;  1EWO A;  2JTC A;  3I06 A;  4W5C A;  1VSN A;  4I04 A;  2G7Y A;  1U5I A;  2UZJ A;  1AYW A;  2J7Q C;  2FUD A;  4D8B A;  1ZIV A;  1YZB A;  1YK7 A;  1XKG A;  1CTE A;  5JA7 A;  2ARY A;  1TLO A;  2AUZ A;  2AGA A;  3LFY A;  3PDF A;  4DMY A;  1QOL A;  3CH3 X;  3IMA A;  1SNK A;  4KLB A;  3KFQ A;  1NL6 A;  3TRK A;  1CJL A;  1ICF A;  1EWP A;  3MJ5 A;  2HWK A;  3B21 A;  4OEL A;  3BPF A;  2AS8 A;  7PCK A;  3OQC A;  5EF4 A;  1QMY A;  2AVW A;  1BQI A;  1PAD A;  2B1M A;  2DCB A;  3KSE A;  4MM3 B;  2IPP B;  2P0R A;  4M0W A;  3S3Q A;  5CVN B;  1YT7 A;  5CVM A;  4P16 A;  2Y5B A;  1PPN A;  1K3B B;  3BPM A;  4YYR A;  3QSD A;  3KW9 A;  2E02 A;  3RVX A;  3P5W A;  2GHU A;  1KFX L;  2OZ2 A;  1GEC E;  1Y08 A;  4X6J A;  3KX1 A;  4Q8H A;  3CBK A;  3PHW A;  1KHP A;  1ZCM A;  4AXM A;  1TL9 A;  2FTD A;  3C9E A;  4PT5 A;  1BP4 A;  3U8E A;  4YV8 A;  2FE8 A;  1ME3 A;  3F5V A;  1HUC B;  4RY2 A;  3PHX A;  2DC8 A;  2BU3 A;  5KO3 A;  3W30 A;  1CS8 A;  3I3T A;  1S4V A;  3CBJ A;  2E01 A;  1AYU A;  2NQA A;  1EWL A;  3RVW A;  2FRA A;  3RVV A;  3TNX A;  1BY8 A;  4D8I A;  6PAD A;  4RF0 A;  4BOU A;  3BWK A;  2BTW A;  5EZS A;  4I05 A;  4ZUX U;  1EF7 A;  1AIM A;  3MP2 A;  5A24 A;  1U9Q X;  2FQ9 A;  3MTN A;  1KFU L;  1PXV A;  4YYW A;  2VHF A;  1NQC A;  1Q6K A;  3NHE A;  4XUI A;  2FYE A;  4MZO A;  1DF0 A;  1AYV A;  4BS6 A;  3H8C A;  4WUR A;  2AIM A;  1BGO A;  4QRX A;  3S3R A;  1JQP A; 
#chains in the Genus database with same CATH homology
 1ATK A;  2AYN A;  1ME4 A;  4N8W A;  2G8E A;  1KHQ A;  4C5P A;  3HWN A;  2VFB A;  4B55 A;  4NV7 A;  4NV8 A;  4BQV A;  4MZS A;  3QJ3 A;  2FT2 A;  5PAD A;  4W4U A;  2YJ2 A;  4QRV A;  3H6S A;  4WA6 A;  2R9C A;  1MHW A;  1PBH A;  1EWM A;  5CHT A;  2BDL A;  4CZW A;  1QXP A;  1O0E A;  1MIR A;  4CDE B;  1NB3 A;  1U9W A;  2NQD B;  3H89 A;  2FO5 A;  3ZUA A;  1AU2 A;  2NQI A;  1U9X A;  2DC6 A;  3WXG A;  2DC7 A;  3OVZ A;  1MDW A;  1ITO A;  4OEM A;  1A6R A;  3PBH A;  2YJ9 A;  2C0Y A;  4YYV A;  4I07 A;  2O6X A;  3V6C A;  1NB5 A;  1PCI A;  1DEU A;  4QH6 A;  1CB5 A;  2OUL A;  2DJG B;  3BCN A;  4X6H A;  2HD5 A;  3O1G A;  4X6I A;  2DCD A;  1MS6 A;  1PE6 A;  2XU5 A;  2R9N A;  3IOQ A;  2JQF R;  1MEM A;  2YJ8 A;  3D9W A;  1CQD A;  1GMY A;  4DMX A;  3OIS A;  5JH3 A;  2FRQ A;  1YAL A;  3GCB A;  1TU6 A;  2ACT A;  2Y6E A;  1F29 A;  4P6E A;  2GFO A;  2E03 A;  2DCA A;  1F2A A;  3PNR A;  4PP1 A;  3PW3 A;  3KWZ A;  3D6S A;  2ATO A;  4CDC B;  4QBB A;  2OP3 A;  2AYO A;  4BSQ A;  2CB5 A;  2PAD A;  2AUX A;  1CSB B;  1KXR A;  3IV2 A;  2DZZ A;  1CPJ A;  4PAD A;  3CH2 X;  4FIP A;  3H7D A;  1THE A;  8PCH A;  2R6N A;  2G8J A;  2F7D A;  2VFC A;  4YYQ A;  4G54 A;  1YK8 A;  5FPW A;  1FH0 A;  3LXS A;  1QDQ A;  1POP A;  3V6E A;  3K9M A;  1PPO A;  1NLJ A;  3OF8 A;  3BOW A;  2YJC A;  4PP2 E;  4BS5 A;  2XU3 A;  3HD3 A;  1Y4H A;  4AXL A;  4QRG A;  3O0U A;  1CVZ A;  2P7U A;  1SP4 B;  3IHP A;  3QT4 A;  3N3K A;  2BDZ A;  4MSX A;  2HHN A;  2F1G A;  1PPP A;  5CVO B;  1AU3 A;  1IWD A;  1GCB A;  2DZY A;  4P6G A;  5CHV A;  1NPZ A;  3P5V A;  3MHS A;  1GLO A;  1W5R A;  4XR7 A;  3M99 A;  2R9O A;  2PNS A;  4CDD B;  3B79 A;  5J94 A;  4N79 A;  4Q8G A;  3USV A;  3MHH A;  3P5U A;  3K8U A;  1F2B A;  3F75 A;  1STF E;  4PI3 A;  4YVA A;  1YVB A;  3P5X A;  5EGW A;  1U9V A;  2BSZ A;  2G6D A;  2DC9 A;  2VHS A;  2XU4 A;  3ERV A;  2AU1 A;  3LTW A;  3K24 A;  3BC3 A;  2PBH A;  1AU4 A;  1X9Y A;  4FJC A;  4HWY A;  1W4T A;  3DF0 A;  5F02 A;  2IBI A;  2HH5 A;  1CV8 A;  2DJF B;  4FK5 A;  3N3G A;  1M6D A;  4YYU A;  1VJV A;  3KWB X;  3MOR A;  4YYS A;  2E00 A;  4CDF B;  2YJB A;  2NQG A;  9PAP A;  2R9F A;  3N4C A;  2B1N A;  3IEJ A;  1PIP A;  1GX3 A;  3HHI A;  3KKU A;  3WXE A;  2XU1 A;  2WBF X;  3IUT A;  3OVX A;  2HXZ A;  4W5B A;  2CIO A;  3AI8 A;  1AU0 A;  1PPD A;  2DCC A;  2PRE A;  3H8B A;  4N4Z A;  2H7J A;  3OF9 A;  1F2C A;  3WXF A;  1AEC A;  5K16 A;  3E1Z B;  4BPV A;  4K7C A;  2R9M A;  2JQG R;  2P86 A;  1MEG A;  3HHA A;  1EWO A;  3I06 A;  4W5C A;  1VSN A;  4I04 A;  2G7Y A;  1U5I A;  1AYW A;  2FUD A;  1ZIV A;  1YK7 A;  1XKG A;  1CTE A;  5JA7 A;  2ARY A;  1TLO A;  2AUZ A;  3LFY A;  3PDF A;  4DMY A;  1QOL A;  3CH3 X;  3IMA A;  1SNK A;  4KLB A;  3KFQ A;  1NL6 A;  1CJL A;  1W6F A;  4BGF A;  1ICF A;  1EWP A;  4OEL A;  3BPF A;  2AS8 A;  7PCK A;  5EF4 A;  1QMY A;  2AVW A;  1BQI A;  1PAD A;  2B1M A;  2DCB A;  3KSE A;  2IPP B;  2P0R A;  3S3Q A;  5CVN B;  1YT7 A;  5CVM A;  2Y5B A;  1PPN A;  1K3B B;  3BPM A;  4YYR A;  3QSD A;  3KW9 A;  2E02 A;  3RVX A;  3P5W A;  2GHU A;  1KFX L;  2OZ2 A;  1GEC E;  1Y08 A;  4X6J A;  3KX1 A;  4Q8H A;  3CBK A;  1KHP A;  1ZCM A;  4AXM A;  1TL9 A;  2FTD A;  3C9E A;  1BP4 A;  3U8E A;  4YV8 A;  1ME3 A;  3F5V A;  1HUC B;  4RY2 A;  2DC8 A;  1CS8 A;  3I3T A;  1S4V A;  3CBJ A;  2E01 A;  1AYU A;  2NQA A;  1EWL A;  3RVW A;  2FRA A;  3RVV A;  3TNX A;  1BY8 A;  1E2T A;  6PAD A;  3BWK A;  4I05 A;  4ZUX U;  1EF7 A;  1AIM A;  5A24 A;  1U9Q X;  2FQ9 A;  4GUZ A;  3MTN A;  1KFU L;  1PXV A;  4YYW A;  2VHF A;  1NQC A;  1Q6K A;  3NHE A;  4XUI A;  2FYE A;  4MZO A;  1DF0 A;  1AYV A;  4BS6 A;  3H8C A;  2AIM A;  1BGO A;  4QRX A;  3S3R A;  1JQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...