1CQDA

The 2.1 angstrom structure of a cysteine protease with proline specificity from ginger rhizome, zingiber officinale
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
LPDSIDWRENGAVVPVKNQGGCGSCWAFSTVAAVEGINQIVTGDLISLSEQQLVDCTTANHGCRGGWMNPAFQFIVNNGGINSEETYPYRGQDGICNSTVNAPVVSIDSYENVPSHNEQSLQKAVANQPVSVTMDAAGRDFQLYRSGIFTGSCNISANHALTVVGYGTENDKDFWIVKNSWGKNWGESGYIRAERNIENPDGKCGITRFASYPVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.1 A structure of a cysteine protease with proline specificity from ginger rhizome, Zingiber officinale.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (PROTEASE II)
total genus 64
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.67: Zingipain.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cqdA00
1YALA 1POPA 3MHHA 2CIOA 1GLOA 2DZYA 1AECA 1U9WA 3IHPA 2R9CA 2VHSA 1MEGA 1XKGA 4I05A 1EWLA 1U5IA 1O0EA 2DC9A 2OP3A 1EWOA 1F2AA 3HD3A 3QT4A 1STFE 4CDFB 3QJ3A 1A6RA 3E1ZB 1QDQA 2P7UA 2CB5A 4N8WA 1EWMA 3PNRA 1ME3A 4QRVA 1SP4B 4FIPA 4ZUXU 1YK8A 1ATKA 4I04A 1KFUL 1MDWA 2ARYA 1Y4HA 3AI8A 3OISA 2ACTA 3PW3A 3MTNA 3P5VA 3IEJA 5K16A 3WXEA 3CBJA 3P5UA 4PP2E 1AU0A 2YJ2A 3O0UA 1YT7A 4WA6A 3HWNA 2IBIA 4XR7A 2FUDA 4PADA 5CVOB 1ITOA 4YYVA 2HH5A 1Y08A 2DZZA 4YV8A 2IPPB 1VSNA 2DCBA 3BC3A 1CQDA 2OULA 3V6EA 1THEA 3S3RA 4RY2A 2XU3A 3IUTA 4Q8HA 5A24A 2FYEA 1U9VA 2BDZA 3H8CA 1ZIVA 4FK5A 2DJGB 2NQGA 2E00A 2E03A 3RVWA 4MSXA 6PADA 4W5CA 3S3QA 2DC7A 4YYUA 1BGOA 1KXRA 2G7YA 3V6CA 3USVA 1AYVA 1S4VA 3IMAA 3KWBX 2AUXA 1VJVA 4MZSA 2Y5BA 5JH3A 1PE6A 4BSQA 3RVVA 1GECE 5JA7A 2YJBA 3I06A 3LXSA 3H8BA 3P5WA 3KX1A 2XU5A 1CVZA 4K7CA 2DCAA 4G54A 3I3TA 3OVXA 1ZCMA 4BPVA 2AU1A 2R9NA 3CH3X 3KSEA 4X6JA 2XU4A 2Y6EA 2E02A 2DCCA 3KFQA 1ME4A 3N3GA 3U8EA 5CVNB 4YVAA 2P86A 1PPOA 2R9FA 4CZWA 1PPDA 4YYWA 1PPNA 2AIMA 1F2BA 4XUIA 2NQIA 2DCDA 3DF0A 1GCBA 1NB5A 1PPPA 3HHAA 1MS6A 5F02A 1PCIA 2H7JA 2ATOA 4AXMA 1M6DA 4QBBA 1PADA 3K8UA 3KKUA 2AVWA 2JQFR 2GFOA 2F7DA 4BS5A 1GMYA 3BWKA 1CB5A 2C0YA 9PAPA 4W5BA 1NLJA 2PNSA 2OZ2A 1JQPA 2VHFA 2YJ8A 3OF8A 4N4ZA 4YYSA 1CTEA 3CBKA 3PBHA 3RVXA 1PBHA 1TU6A 4X6IA 3OF9A 4CDCB 2R9OA 2P0RA 1F2CA 2NQAA 2XU1A 3M99A 3WXGA 1EF7A 4YYRA 3BOWA 1EWPA 1X9YA 2HHNA 4P6EA 4DMYA 4N79A 3BPFA 4X6HA 1AYWA 1AU2A 1NPZA 1BY8A 4AXLA 4YYQA 2G8JA 4FJCA 2R6NA 4KLBA 4BQVA 1Q6KA 2R9MA 5CHTA 2HXZA 3C9EA 3MORA 3QSDA 3N4CA 2NQDB 8PCHA 1QXPA 3K9MA 5PADA 1BP4A 3CH2X 1AU4A 3P5XA 7PCKA 1NQCA 3ERVA 2JQGR 4P6GA 5J94A 1KHQA 3ZUAA 4CDEB 2F1GA 1U9XA 2AUZA 1TL9A 3H6SA 2AS8A 1TLOA 2GHUA 3BPMA 2E01A 3F5VA 2AYOA 1U9QX 4DMXA 1CSBB 3MHSA 2FTDA 3KWZA 3NHEA 3HHIA 1AIMA 1CV8A 1AYUA 5EGWA 3KW9A 1QMYA 2YJCA 2AYNA 2PBHA 3IV2A 1K3BB 1IWDA 2DC8A 2PREA 4QH6A 2B1NA 1DEUA 1SNKA 1DF0A 3OVZA 3TNXA 3LFYA 3B79A 1QOLA 2HD5A 1AU3A 2WBFX 4OEMA 2FO5A 1MEMA 3H89A 4QRXA 2FQ9A 2O6XA 3K24A 3BCNA 2PADA 1MIRA 4W4UA 1F29A 2DJFB 1FH0A 3GCBA 2G6DA 1BQIA 1MHWA 3O1GA 2G8EA 3PDFA 4PI3A 5EF4A 4HWYA 2YJ9A 4CDDB 1PIPA 2FT2A 3IOQA 5FPWA 2B1MA 1HUCB 3N3KA 4QRGA 2DC6A 1ICFA 1NB3A 4Q8GA 1YK7A 1CPJA 1CS8A 4OELA 4PP1A 2FRAA 3H7DA 3WXFA 1NL6A 1KFXL 2FRQA 1YVBA 4BS6A 5CHVA 2BDLA 3D6SA 4I07A 3F75A 1PXVA 1CJLA 4MZOA 1KHPA 5CVMA
chains in the Genus database with same CATH superfamily
1YALA 1POPA 3MHHA 2CIOA 1GLOA 2DZYA 2BTWB 3TMPA 2BU3A 1AECA 1U9WA 3IHPA 2R9CA 2VHSA 1MEGA 1XKGA 4I05A 1EWLA 1U5IA 1O0EA 2DC9A 2OP3A 1EWOA 1F2AA 3HD3A 3QT4A 1STFE 4GUAA 5JZEA 4CDFB 3QJ3A 1A6RA 5E6JA 3E1ZB 1QDQA 2P7UA 2CB5A 4N8WA 1EWMA 3E9SA 3PNRA 4A5UA 1ME3A 4QRVA 1SP4B 4FIPA 4ZUXU 1YK8A 1ATKA 1UKFA 4I04A 1KFUL 4ZTBA 4BOPA 1MDWA 2ARYA 1Y4HA 3AI8A 3OISA 2ACTA 3PRPA 3PW3A 3MTNA 3P5VA 3IEJA 5K16A 2FE8A 3WXEA 3CBJA 3P5UA 4PP2E 1AU0A 2YJ2A 3O0UA 4PT5A 1YT7A 4WA6A 3HWNA 2IBIA 4XR7A 2FUDA 4PADA 5CVOB 1ITOA 4YYVA 2HH5A 1Y08A 2DZZA 4YV8A 2IPPB 3RNVA 1DKIA 1VSNA 2AGAA 2DCBA 3BC3A 1YZBA 1CQDA 2OULA 3V6EA 1THEA 3S3RA 4RY2A 2XU3A 3IUTA 4Q8HA 5A24A 2FYEA 1U9VA 2BDZA 4BOUA 3PT2A 3H8CA 1ZIVA 4FK5A 2DJGB 3B21A 2NQGA 2E00A 2E03A 3RVWA 4MI7A 4MSXA 6PADA 4W5CA 3S3QA 2DC7A 4YYUA 1BGOA 1KXRA 2G7YA 4OVZB 3V6CA 3USVA 2JTCA 1AYVA 1S4VA 3IMAA 3KWBX 4D8BA 3BB7A 2AUXA 1VJVA 4MZSA 5CVMA 4WURA 2Y5BA 3PHUA 3OQCA 5JH3A 3TRKA 1PE6A 4BSQA 3RVVA 1GECE 5JA7A 2YJBA 3I06A 3LXSA 3H8BA 3P5WA 3KX1A 3C0RA 2XU5A 1CVZA 4RKXA 4K7CA 4R3DA 2DCAA 4G54A 3I3TA 3OVXA 1ZCMA 4BPVA 2AU1A 2R9NA 3CH3X 3KSEA 3ZNHA 4X6JA 2XU4A 2UZJA 2Y6EA 2E02A 2DCCA 3KFQA 1ME4A 3W30A 4RNAA 3N3GA 3U8EA 5CVNB 4YVAA 3O65A 2P86A 1PPOA 2R9FA 4CZWA 4P16A 1PPDA 4YYWA 1PPNA 3PHWA 2AIMA 1F2BA 3MP2A 4XUIA 2NQIA 2DCDA 3DF0A 1GCBA 1NB5A 1PPPA 3HHAA 1MS6A 5F02A 1PCIA 4OW0A 2H7JA 2ATOA 4AXMA 1M6DA 2Z84A 4QBBA 1PADA 3K8UA 3KKUA 2AVWA 2JQFR 2GFOA 2F7DA 4BS5A 1GMYA 3BWKA 1CB5A 2C0YA 9PAPA 4W5BA 1NLJA 2PNSA 2OZ2A 1JQPA 2VHFA 2YJ8A 3OF8A 4N4ZA 4YYSA 4XZXA 2J7QA 1CTEA 3CBKA 3PBHA 3RVXA 1PBHA 1TU6A 4X6IA 3OF9A 4CDCB 2R9OA 2P0RA 1F2CA 2NQAA 2XU1A 3M99A 3WXGA 1EF7A 4YYRA 3BOWA 1EWPA 1X9YA 2HHNA 4OVZA 4P6EA 4DMYA 4N79A 3BPFA 3BY4A 4X6HA 1AYWA 4HXDB 1AU2A 1NPZA 3BBAA 1BY8A 4AXLA 5EZSA 4YYQA 2G8JA 4FJCA 2R6NA 4KLBA 4BQVA 1Q6KA 2R9MA 4BOQA 2HXZA 5CHTA 3C9EA 3MORA 3QSDA 2DOSA 3N4CA 2NQDB 8PCHA 2BTWA 3PHXA 1QXPA 3K9MA 5PADA 1BP4A 3CH2X 1AU4A 3P5XA 7PCKA 3IFUA 1NQCA 4RF0A 3ERVA 2JQGR 4P6GA 2J7QC 5J94A 1KHQA 3ZUAA 4D8EA 4CDEB 2F1GA 1U9XA 2AUZA 1TL9A 3H6SA 2AS8A 1TLOA 2GHUA 3BPMA 2E01A 3F5VA 2AYOA 1U9QX 4DMXA 1CSBB 3MHSA 2FTDA 3KWZA 3NHEA 3HHIA 1AIMA 1CV8A 4BOSA 1AYUA 5EGWA 3KW9A 1QMYA 2YJCA 2AYNA 4IUMA 2PBHA 3IV2A 3MJ5A 1K3BB 1IWDA 2DC8A 2PREA 4QH6A 2B1NA 1DEUA 1SNKA 1DF0A 3OVZA 3TNXA 3LFYA 3B79A 1QOLA 5KO3A 2HD5A 1AU3A 4IP3A 2WBFX 4OEMA 2FO5A 1MEMA 3H89A 4QRXA 2FQ9A 2O6XA 3K24A 3BCNA 2PADA 1MIRA 4W4UA 1F29A 2DJFB 1FH0A 2JRIA 3GCBA 2HWKA 2G6DA 1BQIA 1MHWA 3O1GA 3PSEA 2G8EA 3PDFA 4PI3A 5EF4A 4D8IA 4RF1A 4HWYA 2YJ9A 5EZQA 3MTVA 4CDDB 1PIPA 2FT2A 3IOQA 5FPWA 3W31A 2B1MA 1HUCB 3N3KA 4QRGA 3PRMA 2DC6A 1ICFA 1NB3A 4Q8GA 4BOZA 1CPJA 1CS8A 4OELA 4PP1A 1PVJA 2FRAA 3H7DA 3WXFA 1NL6A 4M0WA 1KFXL 2FRQA 4REZA 1YVBA 4BS6A 5CHVA 2BDLA 3D6SA 4I07A 4MM3B 3F75A 1PXVA 1CJLA 4MZOA 1KHPA 1YK7A
chains in the Genus database with same CATH topology
1YALA 1POPA 3MHHA 2CIOA 1GLOA 2DZYA 1AECA 1U9WA 3IHPA 2R9CA 2VHSA 1MEGA 1XKGA 4I05A 1EWLA 1U5IA 2BSZA 1O0EA 2DC9A 2OP3A 1EWOA 1F2AA 3HD3A 3QT4A 1STFE 4CDFB 3QJ3A 1A6RA 3E1ZB 1QDQA 2P7UA 2CB5A 4N8WA 1EWMA 3PNRA 1ME3A 4QRVA 1SP4B 4FIPA 4ZUXU 1YK8A 1ATKA 4I04A 1KFUL 1MDWA 2ARYA 1Y4HA 1W4TA 3AI8A 3OISA 2ACTA 3PW3A 3MTNA 3P5VA 3IEJA 5K16A 3WXEA 3CBJA 3P5UA 4PP2E 1AU0A 2YJ2A 3O0UA 1YT7A 4WA6A 3HWNA 2IBIA 4XR7A 2FUDA 4PADA 5CVOB 1ITOA 4YYVA 4C5PA 2HH5A 1Y08A 2DZZA 4YV8A 2IPPB 1VSNA 2DCBA 3BC3A 1CQDA 2OULA 3V6EA 1THEA 3S3RA 4RY2A 2XU3A 3IUTA 4Q8HA 5A24A 2FYEA 1U9VA 2BDZA 3H8CA 1ZIVA 4FK5A 2DJGB 2NQGA 2E00A 2VFCA 2E03A 3RVWA 4MSXA 6PADA 4W5CA 3S3QA 2DC7A 4YYUA 1BGOA 1KXRA 2G7YA 3V6CA 3USVA 1AYVA 1S4VA 3IMAA 3KWBX 2AUXA 1VJVA 4MZSA 2Y5BA 5JH3A 1PE6A 4BSQA 3RVVA 1GECE 5JA7A 2YJBA 3I06A 3LXSA 3H8BA 3P5WA 3KX1A 2XU5A 1CVZA 4K7CA 2DCAA 4G54A 3I3TA 3OVXA 1ZCMA 4BPVA 2AU1A 1GX3A 2R9NA 3CH3X 3KSEA 4X6JA 2XU4A 2Y6EA 2E02A 2DCCA 3KFQA 1ME4A 3N3GA 3U8EA 5CVNB 4YVAA 2P86A 1PPOA 2R9FA 4CZWA 1PPDA 4YYWA 1PPNA 2AIMA 1F2BA 4XUIA 2NQIA 2DCDA 3DF0A 1GCBA 1NB5A 1PPPA 3HHAA 1MS6A 5F02A 4BGFA 1PCIA 2H7JA 2ATOA 4AXMA 1M6DA 4B55A 4QBBA 1PADA 3K8UA 3KKUA 2AVWA 2JQFR 2GFOA 2F7DA 4BS5A 1GMYA 3BWKA 1CB5A 2C0YA 9PAPA 4W5BA 1W6FA 1NLJA 2PNSA 2OZ2A 1JQPA 2VHFA 2YJ8A 3OF8A 4N4ZA 4YYSA 1CTEA 3CBKA 3PBHA 3RVXA 1PBHA 1TU6A 4X6IA 3OF9A 4CDCB 2R9OA 2P0RA 1F2CA 2NQAA 2XU1A 3M99A 3WXGA 1EF7A 4YYRA 3BOWA 1EWPA 1X9YA 2HHNA 4P6EA 4DMYA 4N79A 3BPFA 4X6HA 1AYWA 1AU2A 1NPZA 1BY8A 4AXLA 4YYQA 2G8JA 4FJCA 2R6NA 4KLBA 4BQVA 1Q6KA 2R9MA 5CHTA 2HXZA 3C9EA 3MORA 3QSDA 3N4CA 2NQDB 8PCHA 1QXPA 3K9MA 5PADA 1BP4A 3CH2X 1AU4A 3P5XA 7PCKA 1NQCA 3ERVA 2JQGR 4P6GA 5J94A 1KHQA 3ZUAA 4CDEB 2F1GA 1U9XA 2AUZA 1TL9A 3H6SA 2AS8A 1TLOA 2GHUA 3BPMA 2E01A 3F5VA 2AYOA 1U9QX 4DMXA 1CSBB 3MHSA 2FTDA 3KWZA 3NHEA 3HHIA 1AIMA 1CV8A 1AYUA 5EGWA 3KW9A 1QMYA 2YJCA 2AYNA 2PBHA 3IV2A 1K3BB 1IWDA 2DC8A 2PREA 4QH6A 2B1NA 1DEUA 1SNKA 1DF0A 3OVZA 3TNXA 3LFYA 3B79A 1QOLA 2HD5A 1AU3A 2WBFX 4OEMA 2FO5A 1MEMA 3H89A 1E2TA 4QRXA 2FQ9A 2O6XA 3K24A 3BCNA 2PADA 1MIRA 4W4UA 1F29A 2VFBA 2DJFB 1FH0A 4GUZA 1W5RA 3GCBA 2G6DA 1BQIA 1MHWA 3O1GA 2G8EA 3PDFA 4PI3A 5EF4A 4HWYA 2YJ9A 4CDDB 1PIPA 2FT2A 3IOQA 5FPWA 2B1MA 1HUCB 3N3KA 4QRGA 2DC6A 1ICFA 1NB3A 4Q8GA 1YK7A 1CPJA 1CS8A 4OELA 4PP1A 2FRAA 3H7DA 4NV8A 3WXFA 1NL6A 1KFXL 2FRQA 3D9WA 1YVBA 4BS6A 5CHVA 2BDLA 3D6SA 4I07A 3F75A 1PXVA 1CJLA 3LTWA 4NV7A 4MZOA 1KHPA 5CVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAL A;  1POP A;  3MHH A;  2CIO A;  1GLO A;  2DZY A;  1AEC A;  1U9W A;  3IHP A;  2R9C A;  2VHS A;  1MEG A;  1XKG A;  4I05 A;  1EWL A;  1U5I A;  1O0E A;  2DC9 A;  2OP3 A;  1EWO A;  1F2A A;  3HD3 A;  3QT4 A;  1STF E;  4CDF B;  3QJ3 A;  1A6R A;  3E1Z B;  1QDQ A;  2P7U A;  2CB5 A;  4N8W A;  1EWM A;  3PNR A;  1ME3 A;  4QRV A;  1SP4 B;  4FIP A;  4ZUX U;  1YK8 A;  1ATK A;  4I04 A;  1KFU L;  1MDW A;  2ARY A;  1Y4H A;  3AI8 A;  3OIS A;  2ACT A;  3PW3 A;  3MTN A;  3P5V A;  3IEJ A;  5K16 A;  3WXE A;  3CBJ A;  3P5U A;  4PP2 E;  1AU0 A;  2YJ2 A;  3O0U A;  1YT7 A;  4WA6 A;  3HWN A;  2IBI A;  4XR7 A;  2FUD A;  4PAD A;  5CVO B;  1ITO A;  4YYV A;  2HH5 A;  1Y08 A;  2DZZ A;  4YV8 A;  2IPP B;  1VSN A;  2DCB A;  3BC3 A;  1CQD A;  2OUL A;  3V6E A;  1THE A;  3S3R A;  4RY2 A;  2XU3 A;  3IUT A;  4Q8H A;  5A24 A;  2FYE A;  1U9V A;  2BDZ A;  3H8C A;  1ZIV A;  4FK5 A;  2DJG B;  2NQG A;  2E00 A;  2E03 A;  3RVW A;  4MSX A;  6PAD A;  4W5C A;  3S3Q A;  2DC7 A;  4YYU A;  1BGO A;  1KXR A;  2G7Y A;  3V6C A;  3USV A;  1AYV A;  1S4V A;  3IMA A;  3KWB X;  2AUX A;  1VJV A;  4MZS A;  2Y5B A;  5JH3 A;  1PE6 A;  4BSQ A;  3RVV A;  1GEC E;  5JA7 A;  2YJB A;  3I06 A;  3LXS A;  3H8B A;  3P5W A;  3KX1 A;  2XU5 A;  1CVZ A;  4K7C A;  2DCA A;  4G54 A;  3I3T A;  3OVX A;  1ZCM A;  4BPV A;  2AU1 A;  2R9N A;  3CH3 X;  3KSE A;  4X6J A;  2XU4 A;  2Y6E A;  2E02 A;  2DCC A;  3KFQ A;  1ME4 A;  3N3G A;  3U8E A;  5CVN B;  4YVA A;  2P86 A;  1PPO A;  2R9F A;  4CZW A;  1PPD A;  4YYW A;  1PPN A;  2AIM A;  1F2B A;  4XUI A;  2NQI A;  2DCD A;  3DF0 A;  1GCB A;  1NB5 A;  1PPP A;  3HHA A;  1MS6 A;  5F02 A;  1PCI A;  2H7J A;  2ATO A;  4AXM A;  1M6D A;  4QBB A;  1PAD A;  3K8U A;  3KKU A;  2AVW A;  2JQF R;  2GFO A;  2F7D A;  4BS5 A;  1GMY A;  3BWK A;  1CB5 A;  2C0Y A;  9PAP A;  4W5B A;  1NLJ A;  2PNS A;  2OZ2 A;  1JQP A;  2VHF A;  2YJ8 A;  3OF8 A;  4N4Z A;  4YYS A;  1CTE A;  3CBK A;  3PBH A;  3RVX A;  1PBH A;  1TU6 A;  4X6I A;  3OF9 A;  4CDC B;  2R9O A;  2P0R A;  1F2C A;  2NQA A;  2XU1 A;  3M99 A;  3WXG A;  1EF7 A;  4YYR A;  3BOW A;  1EWP A;  1X9Y A;  2HHN A;  4P6E A;  4DMY A;  4N79 A;  3BPF A;  4X6H A;  1AYW A;  1AU2 A;  1NPZ A;  1BY8 A;  4AXL A;  4YYQ A;  2G8J A;  4FJC A;  2R6N A;  4KLB A;  4BQV A;  1Q6K A;  2R9M A;  5CHT A;  2HXZ A;  3C9E A;  3MOR A;  3QSD A;  3N4C A;  2NQD B;  8PCH A;  1QXP A;  3K9M A;  5PAD A;  1BP4 A;  3CH2 X;  1AU4 A;  3P5X A;  7PCK A;  1NQC A;  3ERV A;  2JQG R;  4P6G A;  5J94 A;  1KHQ A;  3ZUA A;  4CDE B;  2F1G A;  1U9X A;  2AUZ A;  1TL9 A;  3H6S A;  2AS8 A;  1TLO A;  2GHU A;  3BPM A;  2E01 A;  3F5V A;  2AYO A;  1U9Q X;  4DMX A;  1CSB B;  3MHS A;  2FTD A;  3KWZ A;  3NHE A;  3HHI A;  1AIM A;  1CV8 A;  1AYU A;  5EGW A;  3KW9 A;  1QMY A;  2YJC A;  2AYN A;  2PBH A;  3IV2 A;  1K3B B;  1IWD A;  2DC8 A;  2PRE A;  4QH6 A;  2B1N A;  1DEU A;  1SNK A;  1DF0 A;  3OVZ A;  3TNX A;  3LFY A;  3B79 A;  1QOL A;  2HD5 A;  1AU3 A;  2WBF X;  4OEM A;  2FO5 A;  1MEM A;  3H89 A;  4QRX A;  2FQ9 A;  2O6X A;  3K24 A;  3BCN A;  2PAD A;  1MIR A;  4W4U A;  1F29 A;  2DJF B;  1FH0 A;  3GCB A;  2G6D A;  1BQI A;  1MHW A;  3O1G A;  2G8E A;  3PDF A;  4PI3 A;  5EF4 A;  4HWY A;  2YJ9 A;  4CDD B;  1PIP A;  2FT2 A;  3IOQ A;  5FPW A;  2B1M A;  1HUC B;  3N3K A;  4QRG A;  2DC6 A;  1ICF A;  1NB3 A;  4Q8G A;  1YK7 A;  1CPJ A;  1CS8 A;  4OEL A;  4PP1 A;  2FRA A;  3H7D A;  3WXF A;  1NL6 A;  1KFX L;  2FRQ A;  1YVB A;  4BS6 A;  5CHV A;  2BDL A;  3D6S A;  4I07 A;  3F75 A;  1PXV A;  1CJL A;  4MZO A;  1KHP A;  5CVM A; 
#chains in the Genus database with same CATH topology
 1YAL A;  1POP A;  3MHH A;  2CIO A;  1GLO A;  2DZY A;  2BTW B;  3TMP A;  2BU3 A;  1AEC A;  1U9W A;  3IHP A;  2R9C A;  2VHS A;  1MEG A;  1XKG A;  4I05 A;  1EWL A;  1U5I A;  1O0E A;  2DC9 A;  2OP3 A;  1EWO A;  1F2A A;  3HD3 A;  3QT4 A;  1STF E;  4GUA A;  5JZE A;  4CDF B;  3QJ3 A;  1A6R A;  5E6J A;  3E1Z B;  1QDQ A;  2P7U A;  2CB5 A;  4N8W A;  1EWM A;  3E9S A;  3PNR A;  4A5U A;  1ME3 A;  4QRV A;  1SP4 B;  4FIP A;  4ZUX U;  1YK8 A;  1ATK A;  1UKF A;  4I04 A;  1KFU L;  4ZTB A;  4BOP A;  1MDW A;  2ARY A;  1Y4H A;  3AI8 A;  3OIS A;  2ACT A;  3PRP A;  3PW3 A;  3MTN A;  3P5V A;  3IEJ A;  5K16 A;  2FE8 A;  3WXE A;  3CBJ A;  3P5U A;  4PP2 E;  1AU0 A;  2YJ2 A;  3O0U A;  4PT5 A;  1YT7 A;  4WA6 A;  3HWN A;  2IBI A;  4XR7 A;  2FUD A;  4PAD A;  5CVO B;  1ITO A;  4YYV A;  2HH5 A;  1Y08 A;  2DZZ A;  4YV8 A;  2IPP B;  3RNV A;  1DKI A;  1VSN A;  2AGA A;  2DCB A;  3BC3 A;  1YZB A;  1CQD A;  2OUL A;  3V6E A;  1THE A;  3S3R A;  4RY2 A;  2XU3 A;  3IUT A;  4Q8H A;  5A24 A;  2FYE A;  1U9V A;  2BDZ A;  4BOU A;  3PT2 A;  3H8C A;  1ZIV A;  4FK5 A;  2DJG B;  3B21 A;  2NQG A;  2E00 A;  2E03 A;  3RVW A;  4MI7 A;  4MSX A;  6PAD A;  4W5C A;  3S3Q A;  2DC7 A;  4YYU A;  1BGO A;  1KXR A;  2G7Y A;  4OVZ B;  3V6C A;  3USV A;  2JTC A;  1AYV A;  1S4V A;  3IMA A;  3KWB X;  4D8B A;  3BB7 A;  2AUX A;  1VJV A;  4MZS A;  5CVM A;  4WUR A;  2Y5B A;  3PHU A;  3OQC A;  5JH3 A;  3TRK A;  1PE6 A;  4BSQ A;  3RVV A;  1GEC E;  5JA7 A;  2YJB A;  3I06 A;  3LXS A;  3H8B A;  3P5W A;  3KX1 A;  3C0R A;  2XU5 A;  1CVZ A;  4RKX A;  4K7C A;  4R3D A;  2DCA A;  4G54 A;  3I3T A;  3OVX A;  1ZCM A;  4BPV A;  2AU1 A;  2R9N A;  3CH3 X;  3KSE A;  3ZNH A;  4X6J A;  2XU4 A;  2UZJ A;  2Y6E A;  2E02 A;  2DCC A;  3KFQ A;  1ME4 A;  3W30 A;  4RNA A;  3N3G A;  3U8E A;  5CVN B;  4YVA A;  3O65 A;  2P86 A;  1PPO A;  2R9F A;  4CZW A;  4P16 A;  1PPD A;  4YYW A;  1PPN A;  3PHW A;  2AIM A;  1F2B A;  3MP2 A;  4XUI A;  2NQI A;  2DCD A;  3DF0 A;  1GCB A;  1NB5 A;  1PPP A;  3HHA A;  1MS6 A;  5F02 A;  1PCI A;  4OW0 A;  2H7J A;  2ATO A;  4AXM A;  1M6D A;  2Z84 A;  4QBB A;  1PAD A;  3K8U A;  3KKU A;  2AVW A;  2JQF R;  2GFO A;  2F7D A;  4BS5 A;  1GMY A;  3BWK A;  1CB5 A;  2C0Y A;  9PAP A;  4W5B A;  1NLJ A;  2PNS A;  2OZ2 A;  1JQP A;  2VHF A;  2YJ8 A;  3OF8 A;  4N4Z A;  4YYS A;  4XZX A;  2J7Q A;  1CTE A;  3CBK A;  3PBH A;  3RVX A;  1PBH A;  1TU6 A;  4X6I A;  3OF9 A;  4CDC B;  2R9O A;  2P0R A;  1F2C A;  2NQA A;  2XU1 A;  3M99 A;  3WXG A;  1EF7 A;  4YYR A;  3BOW A;  1EWP A;  1X9Y A;  2HHN A;  4OVZ A;  4P6E A;  4DMY A;  4N79 A;  3BPF A;  3BY4 A;  4X6H A;  1AYW A;  4HXD B;  1AU2 A;  1NPZ A;  3BBA A;  1BY8 A;  4AXL A;  5EZS A;  4YYQ A;  2G8J A;  4FJC A;  2R6N A;  4KLB A;  4BQV A;  1Q6K A;  2R9M A;  4BOQ A;  2HXZ A;  5CHT A;  3C9E A;  3MOR A;  3QSD A;  2DOS A;  3N4C A;  2NQD B;  8PCH A;  2BTW A;  3PHX A;  1QXP A;  3K9M A;  5PAD A;  1BP4 A;  3CH2 X;  1AU4 A;  3P5X A;  7PCK A;  3IFU A;  1NQC A;  4RF0 A;  3ERV A;  2JQG R;  4P6G A;  2J7Q C;  5J94 A;  1KHQ A;  3ZUA A;  4D8E A;  4CDE B;  2F1G A;  1U9X A;  2AUZ A;  1TL9 A;  3H6S A;  2AS8 A;  1TLO A;  2GHU A;  3BPM A;  2E01 A;  3F5V A;  2AYO A;  1U9Q X;  4DMX A;  1CSB B;  3MHS A;  2FTD A;  3KWZ A;  3NHE A;  3HHI A;  1AIM A;  1CV8 A;  4BOS A;  1AYU A;  5EGW A;  3KW9 A;  1QMY A;  2YJC A;  2AYN A;  4IUM A;  2PBH A;  3IV2 A;  3MJ5 A;  1K3B B;  1IWD A;  2DC8 A;  2PRE A;  4QH6 A;  2B1N A;  1DEU A;  1SNK A;  1DF0 A;  3OVZ A;  3TNX A;  3LFY A;  3B79 A;  1QOL A;  5KO3 A;  2HD5 A;  1AU3 A;  4IP3 A;  2WBF X;  4OEM A;  2FO5 A;  1MEM A;  3H89 A;  4QRX A;  2FQ9 A;  2O6X A;  3K24 A;  3BCN A;  2PAD A;  1MIR A;  4W4U A;  1F29 A;  2DJF B;  1FH0 A;  2JRI A;  3GCB A;  2HWK A;  2G6D A;  1BQI A;  1MHW A;  3O1G A;  3PSE A;  2G8E A;  3PDF A;  4PI3 A;  5EF4 A;  4D8I A;  4RF1 A;  4HWY A;  2YJ9 A;  5EZQ A;  3MTV A;  4CDD B;  1PIP A;  2FT2 A;  3IOQ A;  5FPW A;  3W31 A;  2B1M A;  1HUC B;  3N3K A;  4QRG A;  3PRM A;  2DC6 A;  1ICF A;  1NB3 A;  4Q8G A;  4BOZ A;  1CPJ A;  1CS8 A;  4OEL A;  4PP1 A;  1PVJ A;  2FRA A;  3H7D A;  3WXF A;  1NL6 A;  4M0W A;  1KFX L;  2FRQ A;  4REZ A;  1YVB A;  4BS6 A;  5CHV A;  2BDL A;  3D6S A;  4I07 A;  4MM3 B;  3F75 A;  1PXV A;  1CJL A;  4MZO A;  1KHP A;  1YK7 A; 
#chains in the Genus database with same CATH homology
 1YAL A;  1POP A;  3MHH A;  2CIO A;  1GLO A;  2DZY A;  1AEC A;  1U9W A;  3IHP A;  2R9C A;  2VHS A;  1MEG A;  1XKG A;  4I05 A;  1EWL A;  1U5I A;  2BSZ A;  1O0E A;  2DC9 A;  2OP3 A;  1EWO A;  1F2A A;  3HD3 A;  3QT4 A;  1STF E;  4CDF B;  3QJ3 A;  1A6R A;  3E1Z B;  1QDQ A;  2P7U A;  2CB5 A;  4N8W A;  1EWM A;  3PNR A;  1ME3 A;  4QRV A;  1SP4 B;  4FIP A;  4ZUX U;  1YK8 A;  1ATK A;  4I04 A;  1KFU L;  1MDW A;  2ARY A;  1Y4H A;  1W4T A;  3AI8 A;  3OIS A;  2ACT A;  3PW3 A;  3MTN A;  3P5V A;  3IEJ A;  5K16 A;  3WXE A;  3CBJ A;  3P5U A;  4PP2 E;  1AU0 A;  2YJ2 A;  3O0U A;  1YT7 A;  4WA6 A;  3HWN A;  2IBI A;  4XR7 A;  2FUD A;  4PAD A;  5CVO B;  1ITO A;  4YYV A;  4C5P A;  2HH5 A;  1Y08 A;  2DZZ A;  4YV8 A;  2IPP B;  1VSN A;  2DCB A;  3BC3 A;  1CQD A;  2OUL A;  3V6E A;  1THE A;  3S3R A;  4RY2 A;  2XU3 A;  3IUT A;  4Q8H A;  5A24 A;  2FYE A;  1U9V A;  2BDZ A;  3H8C A;  1ZIV A;  4FK5 A;  2DJG B;  2NQG A;  2E00 A;  2VFC A;  2E03 A;  3RVW A;  4MSX A;  6PAD A;  4W5C A;  3S3Q A;  2DC7 A;  4YYU A;  1BGO A;  1KXR A;  2G7Y A;  3V6C A;  3USV A;  1AYV A;  1S4V A;  3IMA A;  3KWB X;  2AUX A;  1VJV A;  4MZS A;  2Y5B A;  5JH3 A;  1PE6 A;  4BSQ A;  3RVV A;  1GEC E;  5JA7 A;  2YJB A;  3I06 A;  3LXS A;  3H8B A;  3P5W A;  3KX1 A;  2XU5 A;  1CVZ A;  4K7C A;  2DCA A;  4G54 A;  3I3T A;  3OVX A;  1ZCM A;  4BPV A;  2AU1 A;  1GX3 A;  2R9N A;  3CH3 X;  3KSE A;  4X6J A;  2XU4 A;  2Y6E A;  2E02 A;  2DCC A;  3KFQ A;  1ME4 A;  3N3G A;  3U8E A;  5CVN B;  4YVA A;  2P86 A;  1PPO A;  2R9F A;  4CZW A;  1PPD A;  4YYW A;  1PPN A;  2AIM A;  1F2B A;  4XUI A;  2NQI A;  2DCD A;  3DF0 A;  1GCB A;  1NB5 A;  1PPP A;  3HHA A;  1MS6 A;  5F02 A;  4BGF A;  1PCI A;  2H7J A;  2ATO A;  4AXM A;  1M6D A;  4B55 A;  4QBB A;  1PAD A;  3K8U A;  3KKU A;  2AVW A;  2JQF R;  2GFO A;  2F7D A;  4BS5 A;  1GMY A;  3BWK A;  1CB5 A;  2C0Y A;  9PAP A;  4W5B A;  1W6F A;  1NLJ A;  2PNS A;  2OZ2 A;  1JQP A;  2VHF A;  2YJ8 A;  3OF8 A;  4N4Z A;  4YYS A;  1CTE A;  3CBK A;  3PBH A;  3RVX A;  1PBH A;  1TU6 A;  4X6I A;  3OF9 A;  4CDC B;  2R9O A;  2P0R A;  1F2C A;  2NQA A;  2XU1 A;  3M99 A;  3WXG A;  1EF7 A;  4YYR A;  3BOW A;  1EWP A;  1X9Y A;  2HHN A;  4P6E A;  4DMY A;  4N79 A;  3BPF A;  4X6H A;  1AYW A;  1AU2 A;  1NPZ A;  1BY8 A;  4AXL A;  4YYQ A;  2G8J A;  4FJC A;  2R6N A;  4KLB A;  4BQV A;  1Q6K A;  2R9M A;  5CHT A;  2HXZ A;  3C9E A;  3MOR A;  3QSD A;  3N4C A;  2NQD B;  8PCH A;  1QXP A;  3K9M A;  5PAD A;  1BP4 A;  3CH2 X;  1AU4 A;  3P5X A;  7PCK A;  1NQC A;  3ERV A;  2JQG R;  4P6G A;  5J94 A;  1KHQ A;  3ZUA A;  4CDE B;  2F1G A;  1U9X A;  2AUZ A;  1TL9 A;  3H6S A;  2AS8 A;  1TLO A;  2GHU A;  3BPM A;  2E01 A;  3F5V A;  2AYO A;  1U9Q X;  4DMX A;  1CSB B;  3MHS A;  2FTD A;  3KWZ A;  3NHE A;  3HHI A;  1AIM A;  1CV8 A;  1AYU A;  5EGW A;  3KW9 A;  1QMY A;  2YJC A;  2AYN A;  2PBH A;  3IV2 A;  1K3B B;  1IWD A;  2DC8 A;  2PRE A;  4QH6 A;  2B1N A;  1DEU A;  1SNK A;  1DF0 A;  3OVZ A;  3TNX A;  3LFY A;  3B79 A;  1QOL A;  2HD5 A;  1AU3 A;  2WBF X;  4OEM A;  2FO5 A;  1MEM A;  3H89 A;  1E2T A;  4QRX A;  2FQ9 A;  2O6X A;  3K24 A;  3BCN A;  2PAD A;  1MIR A;  4W4U A;  1F29 A;  2VFB A;  2DJF B;  1FH0 A;  4GUZ A;  1W5R A;  3GCB A;  2G6D A;  1BQI A;  1MHW A;  3O1G A;  2G8E A;  3PDF A;  4PI3 A;  5EF4 A;  4HWY A;  2YJ9 A;  4CDD B;  1PIP A;  2FT2 A;  3IOQ A;  5FPW A;  2B1M A;  1HUC B;  3N3K A;  4QRG A;  2DC6 A;  1ICF A;  1NB3 A;  4Q8G A;  1YK7 A;  1CPJ A;  1CS8 A;  4OEL A;  4PP1 A;  2FRA A;  3H7D A;  4NV8 A;  3WXF A;  1NL6 A;  1KFX L;  2FRQ A;  3D9W A;  1YVB A;  4BS6 A;  5CHV A;  2BDL A;  3D6S A;  4I07 A;  3F75 A;  1PXV A;  1CJL A;  3LTW A;  4NV7 A;  4MZO A;  1KHP A;  5CVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...