1CQDA

The 2.1 angstrom structure of a cysteine protease with proline specificity from ginger rhizome, zingiber officinale
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
LPDSIDWRENGAVVPVKNQGGCGSCWAFSTVAAVEGINQIVTGDLISLSEQQLVDCTTANHGCRGGWMNPAFQFIVNNGGINSEETYPYRGQDGICNSTVNAPVVSIDSYENVPSHNEQSLQKAVANQPVSVTMDAAGRDFQLYRSGIFTGSCNISANHALTVVGYGTENDKDFWIVKNSWGKNWGESGYIRAERNIENPDGKCGITRFASYPVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PROTEASE II)
publication title The 2.1 A structure of a cysteine protease with proline specificity from ginger rhizome, Zingiber officinale.
pubmed doi rcsb
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.67: Zingipain.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cqdA00
2F7DA 3OF8A 1TU6A 1BQIA 2HH5A 4YYVA 1CVZA 3OVXA 2DC8A 1GLOA 1STFE 2P7UA 1AYVA 1TLOA 4HWYA 1A6RA 2AUXA 2DJGB 3P5WA 1SNKA 2E02A 2HHNA 2B1MA 1QMYA 3N3KA 2FO5A 3HHIA 1M6DA 1NPZA 2HD5A 2CIOA 1ME3A 1F2BA 5EF4A 3S3RA 4YYUA 3H7DA 4CZWA 3KWBX 1S4VA 3KX1A 3I06A 1KHPA 2P0RA 2YJ9A 3HWNA 2P86A 3P5XA 1BY8A 3PNRA 1MHWA 4PP2E 3IV2A 3AI8A 4BS5A 3KSEA 1U9XA 2E01A 4Q8HA 4QRVA 2DJFB 3RVVA 4QH6A 1DEUA 1EWOA 2Y5BA 3V6CA 3CBKA 2C0YA 1VJVA 1AU0A 1Y08A 2NQAA 1O0EA 4N4ZA 3PW3A 1KHQA 4BQVA 1Y4HA 1PXVA 1AYUA 2ARYA 2AIMA 3OISA 4YYRA 3I3TA 4X6JA 2DCDA 2AUZA 3F75A 4N8WA 4QRXA 3CH2X 1MS6A 3BPFA 3F5VA 2NQDB 2YJ2A 9PAPA 2PADA 1MIRA 4MZOA 4YYSA 1EWMA 1YK8A 2JQGR 2G6DA 4FK5A 1KXRA 4YV8A 3HD3A 3N3GA 3NHEA 1FH0A 1PADA 4X6IA 5FPWA 1QDQA 4AXLA 1KFXL 1CSBB 4P6EA 2GFOA 4DMXA 1Q6KA 2OP3A 3E1ZB 7PCKA 2FT2A 4PI3A 2NQIA 3QT4A 1CJLA 3LFYA 1EF7A 2ACTA 4WA6A 1NQCA 3QSDA 4FJCA 8PCHA 2YJCA 3BC3A 5F02A 3B79A 4Q8GA 4P6GA 2B1NA 3H89A 2JQFR 4OEMA 1YALA 5JH3A 4BPVA 3OVZA 2HXZA 2BDLA 3TNXA 2G7YA 5PADA 3IHPA 3PBHA 4I04A 4CDEB 4QRGA 2PNSA 1CQDA 6PADA 3LXSA 3CBJA 4MZSA 3H8CA 2IPPB 1NLJA 3O1GA 1EWLA 2XU5A 4CDFB 3WXEA 2VHFA 2R9NA 3RVWA 1XKGA 1KFUL 2DZZA 4N79A 2R9MA 1U9VA 4ZUXU 1YVBA 2DCCA 3WXGA 1CV8A 2YJ8A 2IBIA 1CPJA 1BP4A 3ERVA 1AIMA 1ME4A 1YT7A 3V6EA 3H8BA 1QOLA 1U5IA 2Y6EA 2OULA 2R9OA 1CB5A 1SP4B 1AU4A 1ITOA 2R9CA 3CH3X 1JQPA 1PBHA 4CDDB 1PPOA 1TL9A 1U9QX 3WXFA 4CDCB 3HHAA 3ZUAA 1AECA 5EGWA 1MEGA 4YYQA 2NQGA 2FTDA 1POPA 3RVXA 1VSNA 3MTNA 1ICFA 4RY2A 3DF0A 4MSXA 2YJBA 1PIPA 4W5BA 4BS6A 2DC6A 3USVA 2AS8A 1PPNA 2WBFX 2DCAA 1THEA 1DF0A 3D6SA 4OELA 5CVMA 3KKUA 2AYNA 4W4UA 4K7CA 1X9YA 2VHSA 2G8JA 3BWKA 3BPMA 2AU1A 3U8EA 2DCBA 4YYWA 2E00A 2AVWA 5CHVA 4DMYA 4YVAA 1QXPA 1ATKA 4FIPA 3OF9A 4PP1A 5J94A 2PREA 1CS8A 3S3QA 1YK7A 1ZCMA 2ATOA 2H7JA 2FRQA 3IUTA 4G54A 1AU2A 1K3BB 1ZIVA 3BOWA 2F1GA 4XUIA 5CVNB 1EWPA 4AXMA 2FUDA 2DC7A 2GHUA 1MEMA 3PDFA 4X6HA 1F29A 3P5VA 1PPDA 3IEJA 1F2AA 1NB3A 4BSQA 4I07A 5JA7A 3MHSA 1GECE 2DC9A 3IOQA 5CHTA 1HUCB 2O6XA 3C9EA 3MORA 2FRAA 2BDZA 5CVOB 1PCIA 3K8UA 1IWDA 3KW9A 3KWZA 2FYEA 1NB5A 5K16A 2R9FA 4KLBA 1MDWA 2E03A 1PPPA 2OZ2A 2DZYA 2XU4A 1U9WA 3K24A 1BGOA 1GCBA 3QJ3A 3P5UA 2PBHA 3GCBA 3KFQA 1CTEA 5A24A 2XU3A 2XU1A 3MHHA 1GMYA 3IMAA 4QBBA 3H6SA 1AU3A 1F2CA 3BCNA 3M99A 1PE6A 2AYOA 3N4CA 2R6NA 2FQ9A 4I05A 2G8EA 4PADA 4W5CA 2CB5A 3K9MA 1AYWA 1NL6A 4XR7A 3O0UA
chains in the Genus database with same CATH superfamily
2F7DA 3OF8A 2FE8A 1TU6A 1BQIA 2HH5A 4YYVA 1CVZA 3OVXA 4BOQA 2DC8A 4GUAA 1GLOA 1STFE 2P7UA 1AYVA 1TLOA 4REZA 3IFUA 4HWYA 1A6RA 2AUXA 3E9SA 3PRMA 4OVZB 2DJGB 3PHXA 3P5WA 1SNKA 2E02A 2HHNA 4RF1A 3OQCA 2B1MA 1QMYA 5EZSA 3N3KA 2FO5A 3HHIA 1M6DA 1NPZA 4D8IA 2HD5A 2CIOA 1ME3A 4WURA 1F2BA 5EF4A 3S3RA 4BOSA 4YYUA 3W31A 3H7DA 4CZWA 3KWBX 1S4VA 3KX1A 2AGAA 3I06A 1KHPA 3PHWA 4P16A 2P0RA 2YJ9A 1DKIA 3HWNA 2P86A 3P5XA 1BY8A 3PNRA 1MHWA 4PP2E 3IV2A 2Z84A 3AI8A 4BS5A 3KSEA 1U9XA 2E01A 4Q8HA 4QRVA 2DJFB 3RVVA 4QH6A 1DEUA 1EWOA 2DOSA 2Y5BA 3V6CA 3CBKA 2C0YA 1VJVA 4OVZA 4M0WA 1AU0A 1Y08A 4RKXA 2NQAA 1O0EA 3MJ5A 4N4ZA 3PW3A 1KHQA 4BQVA 2HWKA 1Y4HA 1PXVA 1AYUA 2ARYA 2AIMA 3OISA 4YYRA 3I3TA 4X6JA 2DCDA 2AUZA 3F75A 4N8WA 4QRXA 3CH2X 1MS6A 3BPFA 3F5VA 2NQDB 2YJ2A 9PAPA 2PADA 4BOPA 1MIRA 4MZOA 4YYSA 1EWMA 1YK8A 2JQGR 2G6DA 4FK5A 1KXRA 4YV8A 2UZJA 2JRIA 3HD3A 3N3GA 3NHEA 1FH0A 1PADA 4X6IA 5FPWA 1QDQA 4AXLA 1KFXL 1CSBB 4P6EA 2GFOA 4DMXA 1Q6KA 2BU3A 3O65A 2OP3A 3E1ZB 4MI7A 7PCKA 2FT2A 4D8EA 4PI3A 2NQIA 3QT4A 1CJLA 3LFYA 1EF7A 2ACTA 4WA6A 1NQCA 3QSDA 4FJCA 8PCHA 2YJCA 3BC3A 5F02A 3B79A 4Q8GA 2BTWB 4HXDB 4P6GA 2B1NA 3H89A 2JQFR 4OEMA 1YALA 5JH3A 4BPVA 3BY4A 3OVZA 2HXZA 2BDLA 3TNXA 4IUMA 2G7YA 5PADA 3IHPA 3PBHA 4I04A 4CDEB 4QRGA 3PT2A 2PNSA 1CQDA 6PADA 3LXSA 3CBJA 4MZSA 3H8CA 2IPPB 1NLJA 3O1GA 1EWLA 2XU5A 4CDFB 3WXEA 3TRKA 2VHFA 2R9NA 3RVWA 1XKGA 1KFUL 2DZZA 4N79A 2R9MA 1PVJA 1U9VA 4ZUXU 1YVBA 2DCCA 3WXGA 1CV8A 2YJ8A 2IBIA 1CPJA 4R3DA 1BP4A 3ERVA 1AIMA 1ME4A 1YT7A 2BTWA 3V6EA 3H8BA 1QOLA 1U5IA 2Y6EA 2OULA 2JTCA 2R9OA 1CB5A 4BOUA 1SP4B 1AU4A 1ITOA 2R9CA 4XZXA 3CH3X 3TMPA 1JQPA 1PBHA 3PSEA 4CDDB 1PPOA 1TL9A 1U9QX 3WXFA 4CDCB 3HHAA 3ZUAA 1AECA 1UKFA 1MEGA 5EGWA 3PHUA 3RNVA 4YYQA 2NQGA 2FTDA 1POPA 3RVXA 1VSNA 3MTNA 1ICFA 4RY2A 3DF0A 4MSXA 2YJBA 1PIPA 4W5BA 4BS6A 2DC6A 3USVA 2AS8A 1PPNA 2WBFX 2J7QC 3B21A 4RF0A 2DCAA 1THEA 1DF0A 3D6SA 4OELA 4BOZA 5CVMA 3KKUA 2AYNA 4W4UA 4K7CA 3ZNHA 1X9YA 4D8BA 2VHSA 2G8JA 4A5UA 4OW0A 3BWKA 5EZQA 3BPMA 4IP3A 2AU1A 3U8EA 2DCBA 4YYWA 2E00A 2AVWA 5CHVA 4DMYA 4YVAA 1QXPA 4PT5A 3BBAA 1ATKA 4FIPA 3OF9A 4PP1A 5J94A 2PREA 1CS8A 3S3QA 4RNAA 1YK7A 1ZCMA 2ATOA 2H7JA 2FRQA 3IUTA 4G54A 1AU2A 1K3BB 1ZIVA 3BOWA 2F1GA 4XUIA 5CVNB 1EWPA 4AXMA 2FUDA 2DC7A 2GHUA 1MEMA 3PDFA 4X6HA 1F29A 3P5VA 1PPDA 3PRPA 3IEJA 1F2AA 1NB3A 4BSQA 4I07A 5JA7A 3MHSA 1GECE 2DC9A 3IOQA 5CHTA 3W30A 1HUCB 2O6XA 3C9EA 2J7QA 3MORA 2FRAA 2BDZA 5CVOB 1PCIA 3K8UA 3MTVA 1IWDA 3KW9A 3KWZA 2FYEA 1NB5A 5K16A 2R9FA 4KLBA 1MDWA 2E03A 1PPPA 2OZ2A 2DZYA 2XU4A 5JZEA 1U9WA 3K24A 1BGOA 1GCBA 3QJ3A 3P5UA 4MM3B 3MP2A 2PBHA 3BB7A 3GCBA 3KFQA 4ZTBA 1CTEA 5A24A 2XU3A 2XU1A 3MHHA 1GMYA 3IMAA 3H6SA 4QBBA 1AU3A 1F2CA 3BCNA 3M99A 5KO3A 1PE6A 2AYOA 5E6JA 3N4CA 2R6NA 2FQ9A 4I05A 2G8EA 4PADA 4W5CA 2CB5A 3C0RA 3K9MA 1YZBA 1AYWA 1NL6A 4XR7A 3O0UA
chains in the Genus database with same CATH topology
2F7DA 3OF8A 1TU6A 1BQIA 2HH5A 4YYVA 1CVZA 3OVXA 2DC8A 1GLOA 1STFE 2P7UA 1AYVA 1TLOA 4HWYA 1A6RA 2AUXA 2DJGB 3P5WA 4NV7A 1SNKA 2E02A 2HHNA 1W4TA 2B1MA 1QMYA 3N3KA 2FO5A 3HHIA 1M6DA 1NPZA 2HD5A 2CIOA 1ME3A 1F2BA 5EF4A 4BGFA 3S3RA 4YYUA 3H7DA 4CZWA 3KWBX 1S4VA 3KX1A 3I06A 1KHPA 2P0RA 2YJ9A 4NV8A 3HWNA 2P86A 3P5XA 1BY8A 3PNRA 1MHWA 4PP2E 3IV2A 3AI8A 4BS5A 3KSEA 1U9XA 2E01A 4Q8HA 4QRVA 3D9WA 2DJFB 3RVVA 4QH6A 1DEUA 1EWOA 2Y5BA 4GUZA 3CBKA 3LTWA 3V6CA 2C0YA 1VJVA 1AU0A 1Y08A 2NQAA 1O0EA 4N4ZA 3PW3A 1KHQA 4BQVA 1Y4HA 1PXVA 1AYUA 2ARYA 2AIMA 3OISA 4B55A 4YYRA 3I3TA 4X6JA 2DCDA 2BSZA 2AUZA 3F75A 4N8WA 4QRXA 3CH2X 1MS6A 3BPFA 3F5VA 2NQDB 2YJ2A 9PAPA 2PADA 1MIRA 4MZOA 4YYSA 1EWMA 1YK8A 2JQGR 2G6DA 2VFBA 4FK5A 1KXRA 4YV8A 3HD3A 3N3GA 3NHEA 1FH0A 1PADA 4X6IA 5FPWA 1QDQA 4AXLA 1KFXL 1CSBB 4P6EA 2GFOA 4DMXA 1Q6KA 2OP3A 3E1ZB 7PCKA 2FT2A 4PI3A 2NQIA 3QT4A 1CJLA 3LFYA 1EF7A 2ACTA 4WA6A 1NQCA 3QSDA 4FJCA 8PCHA 2YJCA 3BC3A 5F02A 3B79A 4Q8GA 4P6GA 2B1NA 3H89A 2JQFR 4OEMA 1YALA 5JH3A 4BPVA 3OVZA 2HXZA 2BDLA 3TNXA 2G7YA 5PADA 3IHPA 3PBHA 4I04A 4CDEB 4QRGA 2PNSA 1CQDA 1W6FA 6PADA 3LXSA 3CBJA 4MZSA 3H8CA 2IPPB 1NLJA 3O1GA 1EWLA 2XU5A 4CDFB 3WXEA 2VHFA 2R9NA 3RVWA 1XKGA 1KFUL 2DZZA 4N79A 2R9MA 1U9VA 4ZUXU 1YVBA 2DCCA 3WXGA 1CV8A 2YJ8A 2IBIA 1CPJA 1BP4A 3ERVA 1AIMA 1ME4A 1YT7A 3V6EA 3H8BA 1QOLA 1U5IA 2Y6EA 2OULA 2R9OA 1CB5A 1SP4B 1AU4A 1ITOA 2R9CA 3CH3X 1JQPA 1PBHA 4CDDB 1PPOA 1TL9A 1U9QX 3WXFA 4CDCB 3HHAA 3ZUAA 1AECA 5EGWA 1MEGA 1GX3A 4YYQA 2NQGA 2FTDA 1POPA 3RVXA 1VSNA 3MTNA 1ICFA 4RY2A 3DF0A 4MSXA 2YJBA 1PIPA 4W5BA 4BS6A 2DC6A 3USVA 2AS8A 1PPNA 2WBFX 2DCAA 1THEA 1DF0A 3D6SA 4OELA 5CVMA 3KKUA 2AYNA 4W4UA 4K7CA 1X9YA 2VHSA 2G8JA 3BWKA 3BPMA 2AU1A 3U8EA 2DCBA 4YYWA 2E00A 2AVWA 5CHVA 4DMYA 4YVAA 1QXPA 1ATKA 4FIPA 3OF9A 4PP1A 5J94A 2PREA 1CS8A 3S3QA 1YK7A 1ZCMA 2ATOA 2H7JA 2FRQA 3IUTA 4G54A 1AU2A 1K3BB 1ZIVA 3BOWA 2F1GA 4XUIA 5CVNB 1EWPA 4AXMA 2FUDA 2DC7A 2GHUA 2VFCA 1MEMA 3PDFA 4X6HA 1F29A 3P5VA 1PPDA 3IEJA 1F2AA 1NB3A 4BSQA 4I07A 5JA7A 3MHSA 1GECE 2DC9A 3IOQA 5CHTA 4C5PA 1HUCB 2O6XA 3C9EA 3MORA 2FRAA 2BDZA 5CVOB 1PCIA 3K8UA 1IWDA 3KW9A 3KWZA 2FYEA 1NB5A 5K16A 2R9FA 4KLBA 1MDWA 2E03A 1PPPA 2OZ2A 2DZYA 2XU4A 1U9WA 3K24A 1BGOA 1GCBA 3QJ3A 3P5UA 2PBHA 3GCBA 3KFQA 1CTEA 5A24A 2XU3A 2XU1A 3MHHA 1GMYA 3IMAA 3H6SA 4QBBA 1AU3A 1F2CA 3BCNA 3M99A 1E2TA 1PE6A 2AYOA 3N4CA 2R6NA 2FQ9A 4I05A 2G8EA 4PADA 4W5CA 2CB5A 3K9MA 1W5RA 1AYWA 1NL6A 4XR7A 3O0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7D A;  3OF8 A;  1TU6 A;  1BQI A;  2HH5 A;  4YYV A;  1CVZ A;  3OVX A;  2DC8 A;  1GLO A;  1STF E;  2P7U A;  1AYV A;  1TLO A;  4HWY A;  1A6R A;  2AUX A;  2DJG B;  3P5W A;  1SNK A;  2E02 A;  2HHN A;  2B1M A;  1QMY A;  3N3K A;  2FO5 A;  3HHI A;  1M6D A;  1NPZ A;  2HD5 A;  2CIO A;  1ME3 A;  1F2B A;  5EF4 A;  3S3R A;  4YYU A;  3H7D A;  4CZW A;  3KWB X;  1S4V A;  3KX1 A;  3I06 A;  1KHP A;  2P0R A;  2YJ9 A;  3HWN A;  2P86 A;  3P5X A;  1BY8 A;  3PNR A;  1MHW A;  4PP2 E;  3IV2 A;  3AI8 A;  4BS5 A;  3KSE A;  1U9X A;  2E01 A;  4Q8H A;  4QRV A;  2DJF B;  3RVV A;  4QH6 A;  1DEU A;  1EWO A;  2Y5B A;  3V6C A;  3CBK A;  2C0Y A;  1VJV A;  1AU0 A;  1Y08 A;  2NQA A;  1O0E A;  4N4Z A;  3PW3 A;  1KHQ A;  4BQV A;  1Y4H A;  1PXV A;  1AYU A;  2ARY A;  2AIM A;  3OIS A;  4YYR A;  3I3T A;  4X6J A;  2DCD A;  2AUZ A;  3F75 A;  4N8W A;  4QRX A;  3CH2 X;  1MS6 A;  3BPF A;  3F5V A;  2NQD B;  2YJ2 A;  9PAP A;  2PAD A;  1MIR A;  4MZO A;  4YYS A;  1EWM A;  1YK8 A;  2JQG R;  2G6D A;  4FK5 A;  1KXR A;  4YV8 A;  3HD3 A;  3N3G A;  3NHE A;  1FH0 A;  1PAD A;  4X6I A;  5FPW A;  1QDQ A;  4AXL A;  1KFX L;  1CSB B;  4P6E A;  2GFO A;  4DMX A;  1Q6K A;  2OP3 A;  3E1Z B;  7PCK A;  2FT2 A;  4PI3 A;  2NQI A;  3QT4 A;  1CJL A;  3LFY A;  1EF7 A;  2ACT A;  4WA6 A;  1NQC A;  3QSD A;  4FJC A;  8PCH A;  2YJC A;  3BC3 A;  5F02 A;  3B79 A;  4Q8G A;  4P6G A;  2B1N A;  3H89 A;  2JQF R;  4OEM A;  1YAL A;  5JH3 A;  4BPV A;  3OVZ A;  2HXZ A;  2BDL A;  3TNX A;  2G7Y A;  5PAD A;  3IHP A;  3PBH A;  4I04 A;  4CDE B;  4QRG A;  2PNS A;  1CQD A;  6PAD A;  3LXS A;  3CBJ A;  4MZS A;  3H8C A;  2IPP B;  1NLJ A;  3O1G A;  1EWL A;  2XU5 A;  4CDF B;  3WXE A;  2VHF A;  2R9N A;  3RVW A;  1XKG A;  1KFU L;  2DZZ A;  4N79 A;  2R9M A;  1U9V A;  4ZUX U;  1YVB A;  2DCC A;  3WXG A;  1CV8 A;  2YJ8 A;  2IBI A;  1CPJ A;  1BP4 A;  3ERV A;  1AIM A;  1ME4 A;  1YT7 A;  3V6E A;  3H8B A;  1QOL A;  1U5I A;  2Y6E A;  2OUL A;  2R9O A;  1CB5 A;  1SP4 B;  1AU4 A;  1ITO A;  2R9C A;  3CH3 X;  1JQP A;  1PBH A;  4CDD B;  1PPO A;  1TL9 A;  1U9Q X;  3WXF A;  4CDC B;  3HHA A;  3ZUA A;  1AEC A;  5EGW A;  1MEG A;  4YYQ A;  2NQG A;  2FTD A;  1POP A;  3RVX A;  1VSN A;  3MTN A;  1ICF A;  4RY2 A;  3DF0 A;  4MSX A;  2YJB A;  1PIP A;  4W5B A;  4BS6 A;  2DC6 A;  3USV A;  2AS8 A;  1PPN A;  2WBF X;  2DCA A;  1THE A;  1DF0 A;  3D6S A;  4OEL A;  5CVM A;  3KKU A;  2AYN A;  4W4U A;  4K7C A;  1X9Y A;  2VHS A;  2G8J A;  3BWK A;  3BPM A;  2AU1 A;  3U8E A;  2DCB A;  4YYW A;  2E00 A;  2AVW A;  5CHV A;  4DMY A;  4YVA A;  1QXP A;  1ATK A;  4FIP A;  3OF9 A;  4PP1 A;  5J94 A;  2PRE A;  1CS8 A;  3S3Q A;  1YK7 A;  1ZCM A;  2ATO A;  2H7J A;  2FRQ A;  3IUT A;  4G54 A;  1AU2 A;  1K3B B;  1ZIV A;  3BOW A;  2F1G A;  4XUI A;  5CVN B;  1EWP A;  4AXM A;  2FUD A;  2DC7 A;  2GHU A;  1MEM A;  3PDF A;  4X6H A;  1F29 A;  3P5V A;  1PPD A;  3IEJ A;  1F2A A;  1NB3 A;  4BSQ A;  4I07 A;  5JA7 A;  3MHS A;  1GEC E;  2DC9 A;  3IOQ A;  5CHT A;  1HUC B;  2O6X A;  3C9E A;  3MOR A;  2FRA A;  2BDZ A;  5CVO B;  1PCI A;  3K8U A;  1IWD A;  3KW9 A;  3KWZ A;  2FYE A;  1NB5 A;  5K16 A;  2R9F A;  4KLB A;  1MDW A;  2E03 A;  1PPP A;  2OZ2 A;  2DZY A;  2XU4 A;  1U9W A;  3K24 A;  1BGO A;  1GCB A;  3QJ3 A;  3P5U A;  2PBH A;  3GCB A;  3KFQ A;  1CTE A;  5A24 A;  2XU3 A;  2XU1 A;  3MHH A;  1GMY A;  3IMA A;  4QBB A;  3H6S A;  1AU3 A;  1F2C A;  3BCN A;  3M99 A;  1PE6 A;  2AYO A;  3N4C A;  2R6N A;  2FQ9 A;  4I05 A;  2G8E A;  4PAD A;  4W5C A;  2CB5 A;  3K9M A;  1AYW A;  1NL6 A;  4XR7 A;  3O0U A; 
#chains in the Genus database with same CATH topology
 2F7D A;  3OF8 A;  2FE8 A;  1TU6 A;  1BQI A;  2HH5 A;  4YYV A;  1CVZ A;  3OVX A;  4BOQ A;  2DC8 A;  4GUA A;  1GLO A;  1STF E;  2P7U A;  1AYV A;  1TLO A;  4REZ A;  3IFU A;  4HWY A;  1A6R A;  2AUX A;  3E9S A;  3PRM A;  4OVZ B;  2DJG B;  3PHX A;  3P5W A;  1SNK A;  2E02 A;  2HHN A;  4RF1 A;  3OQC A;  2B1M A;  1QMY A;  5EZS A;  3N3K A;  2FO5 A;  3HHI A;  1M6D A;  1NPZ A;  4D8I A;  2HD5 A;  2CIO A;  1ME3 A;  4WUR A;  1F2B A;  5EF4 A;  3S3R A;  4BOS A;  4YYU A;  3W31 A;  3H7D A;  4CZW A;  3KWB X;  1S4V A;  3KX1 A;  2AGA A;  3I06 A;  1KHP A;  3PHW A;  4P16 A;  2P0R A;  2YJ9 A;  1DKI A;  3HWN A;  2P86 A;  3P5X A;  1BY8 A;  3PNR A;  1MHW A;  4PP2 E;  3IV2 A;  2Z84 A;  3AI8 A;  4BS5 A;  3KSE A;  1U9X A;  2E01 A;  4Q8H A;  4QRV A;  2DJF B;  3RVV A;  4QH6 A;  1DEU A;  1EWO A;  2DOS A;  2Y5B A;  3V6C A;  3CBK A;  2C0Y A;  1VJV A;  4OVZ A;  4M0W A;  1AU0 A;  1Y08 A;  4RKX A;  2NQA A;  1O0E A;  3MJ5 A;  4N4Z A;  3PW3 A;  1KHQ A;  4BQV A;  2HWK A;  1Y4H A;  1PXV A;  1AYU A;  2ARY A;  2AIM A;  3OIS A;  4YYR A;  3I3T A;  4X6J A;  2DCD A;  2AUZ A;  3F75 A;  4N8W A;  4QRX A;  3CH2 X;  1MS6 A;  3BPF A;  3F5V A;  2NQD B;  2YJ2 A;  9PAP A;  2PAD A;  4BOP A;  1MIR A;  4MZO A;  4YYS A;  1EWM A;  1YK8 A;  2JQG R;  2G6D A;  4FK5 A;  1KXR A;  4YV8 A;  2UZJ A;  2JRI A;  3HD3 A;  3N3G A;  3NHE A;  1FH0 A;  1PAD A;  4X6I A;  5FPW A;  1QDQ A;  4AXL A;  1KFX L;  1CSB B;  4P6E A;  2GFO A;  4DMX A;  1Q6K A;  2BU3 A;  3O65 A;  2OP3 A;  3E1Z B;  4MI7 A;  7PCK A;  2FT2 A;  4D8E A;  4PI3 A;  2NQI A;  3QT4 A;  1CJL A;  3LFY A;  1EF7 A;  2ACT A;  4WA6 A;  1NQC A;  3QSD A;  4FJC A;  8PCH A;  2YJC A;  3BC3 A;  5F02 A;  3B79 A;  4Q8G A;  2BTW B;  4HXD B;  4P6G A;  2B1N A;  3H89 A;  2JQF R;  4OEM A;  1YAL A;  5JH3 A;  4BPV A;  3BY4 A;  3OVZ A;  2HXZ A;  2BDL A;  3TNX A;  4IUM A;  2G7Y A;  5PAD A;  3IHP A;  3PBH A;  4I04 A;  4CDE B;  4QRG A;  3PT2 A;  2PNS A;  1CQD A;  6PAD A;  3LXS A;  3CBJ A;  4MZS A;  3H8C A;  2IPP B;  1NLJ A;  3O1G A;  1EWL A;  2XU5 A;  4CDF B;  3WXE A;  3TRK A;  2VHF A;  2R9N A;  3RVW A;  1XKG A;  1KFU L;  2DZZ A;  4N79 A;  2R9M A;  1PVJ A;  1U9V A;  4ZUX U;  1YVB A;  2DCC A;  3WXG A;  1CV8 A;  2YJ8 A;  2IBI A;  1CPJ A;  4R3D A;  1BP4 A;  3ERV A;  1AIM A;  1ME4 A;  1YT7 A;  2BTW A;  3V6E A;  3H8B A;  1QOL A;  1U5I A;  2Y6E A;  2OUL A;  2JTC A;  2R9O A;  1CB5 A;  4BOU A;  1SP4 B;  1AU4 A;  1ITO A;  2R9C A;  4XZX A;  3CH3 X;  3TMP A;  1JQP A;  1PBH A;  3PSE A;  4CDD B;  1PPO A;  1TL9 A;  1U9Q X;  3WXF A;  4CDC B;  3HHA A;  3ZUA A;  1AEC A;  1UKF A;  1MEG A;  5EGW A;  3PHU A;  3RNV A;  4YYQ A;  2NQG A;  2FTD A;  1POP A;  3RVX A;  1VSN A;  3MTN A;  1ICF A;  4RY2 A;  3DF0 A;  4MSX A;  2YJB A;  1PIP A;  4W5B A;  4BS6 A;  2DC6 A;  3USV A;  2AS8 A;  1PPN A;  2WBF X;  2J7Q C;  3B21 A;  4RF0 A;  2DCA A;  1THE A;  1DF0 A;  3D6S A;  4OEL A;  4BOZ A;  5CVM A;  3KKU A;  2AYN A;  4W4U A;  4K7C A;  3ZNH A;  1X9Y A;  4D8B A;  2VHS A;  2G8J A;  4A5U A;  4OW0 A;  3BWK A;  5EZQ A;  3BPM A;  4IP3 A;  2AU1 A;  3U8E A;  2DCB A;  4YYW A;  2E00 A;  2AVW A;  5CHV A;  4DMY A;  4YVA A;  1QXP A;  4PT5 A;  3BBA A;  1ATK A;  4FIP A;  3OF9 A;  4PP1 A;  5J94 A;  2PRE A;  1CS8 A;  3S3Q A;  4RNA A;  1YK7 A;  1ZCM A;  2ATO A;  2H7J A;  2FRQ A;  3IUT A;  4G54 A;  1AU2 A;  1K3B B;  1ZIV A;  3BOW A;  2F1G A;  4XUI A;  5CVN B;  1EWP A;  4AXM A;  2FUD A;  2DC7 A;  2GHU A;  1MEM A;  3PDF A;  4X6H A;  1F29 A;  3P5V A;  1PPD A;  3PRP A;  3IEJ A;  1F2A A;  1NB3 A;  4BSQ A;  4I07 A;  5JA7 A;  3MHS A;  1GEC E;  2DC9 A;  3IOQ A;  5CHT A;  3W30 A;  1HUC B;  2O6X A;  3C9E A;  2J7Q A;  3MOR A;  2FRA A;  2BDZ A;  5CVO B;  1PCI A;  3K8U A;  3MTV A;  1IWD A;  3KW9 A;  3KWZ A;  2FYE A;  1NB5 A;  5K16 A;  2R9F A;  4KLB A;  1MDW A;  2E03 A;  1PPP A;  2OZ2 A;  2DZY A;  2XU4 A;  5JZE A;  1U9W A;  3K24 A;  1BGO A;  1GCB A;  3QJ3 A;  3P5U A;  4MM3 B;  3MP2 A;  2PBH A;  3BB7 A;  3GCB A;  3KFQ A;  4ZTB A;  1CTE A;  5A24 A;  2XU3 A;  2XU1 A;  3MHH A;  1GMY A;  3IMA A;  3H6S A;  4QBB A;  1AU3 A;  1F2C A;  3BCN A;  3M99 A;  5KO3 A;  1PE6 A;  2AYO A;  5E6J A;  3N4C A;  2R6N A;  2FQ9 A;  4I05 A;  2G8E A;  4PAD A;  4W5C A;  2CB5 A;  3C0R A;  3K9M A;  1YZB A;  1AYW A;  1NL6 A;  4XR7 A;  3O0U A; 
#chains in the Genus database with same CATH homology
 2F7D A;  3OF8 A;  1TU6 A;  1BQI A;  2HH5 A;  4YYV A;  1CVZ A;  3OVX A;  2DC8 A;  1GLO A;  1STF E;  2P7U A;  1AYV A;  1TLO A;  4HWY A;  1A6R A;  2AUX A;  2DJG B;  3P5W A;  4NV7 A;  1SNK A;  2E02 A;  2HHN A;  1W4T A;  2B1M A;  1QMY A;  3N3K A;  2FO5 A;  3HHI A;  1M6D A;  1NPZ A;  2HD5 A;  2CIO A;  1ME3 A;  1F2B A;  5EF4 A;  4BGF A;  3S3R A;  4YYU A;  3H7D A;  4CZW A;  3KWB X;  1S4V A;  3KX1 A;  3I06 A;  1KHP A;  2P0R A;  2YJ9 A;  4NV8 A;  3HWN A;  2P86 A;  3P5X A;  1BY8 A;  3PNR A;  1MHW A;  4PP2 E;  3IV2 A;  3AI8 A;  4BS5 A;  3KSE A;  1U9X A;  2E01 A;  4Q8H A;  4QRV A;  3D9W A;  2DJF B;  3RVV A;  4QH6 A;  1DEU A;  1EWO A;  2Y5B A;  4GUZ A;  3CBK A;  3LTW A;  3V6C A;  2C0Y A;  1VJV A;  1AU0 A;  1Y08 A;  2NQA A;  1O0E A;  4N4Z A;  3PW3 A;  1KHQ A;  4BQV A;  1Y4H A;  1PXV A;  1AYU A;  2ARY A;  2AIM A;  3OIS A;  4B55 A;  4YYR A;  3I3T A;  4X6J A;  2DCD A;  2BSZ A;  2AUZ A;  3F75 A;  4N8W A;  4QRX A;  3CH2 X;  1MS6 A;  3BPF A;  3F5V A;  2NQD B;  2YJ2 A;  9PAP A;  2PAD A;  1MIR A;  4MZO A;  4YYS A;  1EWM A;  1YK8 A;  2JQG R;  2G6D A;  2VFB A;  4FK5 A;  1KXR A;  4YV8 A;  3HD3 A;  3N3G A;  3NHE A;  1FH0 A;  1PAD A;  4X6I A;  5FPW A;  1QDQ A;  4AXL A;  1KFX L;  1CSB B;  4P6E A;  2GFO A;  4DMX A;  1Q6K A;  2OP3 A;  3E1Z B;  7PCK A;  2FT2 A;  4PI3 A;  2NQI A;  3QT4 A;  1CJL A;  3LFY A;  1EF7 A;  2ACT A;  4WA6 A;  1NQC A;  3QSD A;  4FJC A;  8PCH A;  2YJC A;  3BC3 A;  5F02 A;  3B79 A;  4Q8G A;  4P6G A;  2B1N A;  3H89 A;  2JQF R;  4OEM A;  1YAL A;  5JH3 A;  4BPV A;  3OVZ A;  2HXZ A;  2BDL A;  3TNX A;  2G7Y A;  5PAD A;  3IHP A;  3PBH A;  4I04 A;  4CDE B;  4QRG A;  2PNS A;  1CQD A;  1W6F A;  6PAD A;  3LXS A;  3CBJ A;  4MZS A;  3H8C A;  2IPP B;  1NLJ A;  3O1G A;  1EWL A;  2XU5 A;  4CDF B;  3WXE A;  2VHF A;  2R9N A;  3RVW A;  1XKG A;  1KFU L;  2DZZ A;  4N79 A;  2R9M A;  1U9V A;  4ZUX U;  1YVB A;  2DCC A;  3WXG A;  1CV8 A;  2YJ8 A;  2IBI A;  1CPJ A;  1BP4 A;  3ERV A;  1AIM A;  1ME4 A;  1YT7 A;  3V6E A;  3H8B A;  1QOL A;  1U5I A;  2Y6E A;  2OUL A;  2R9O A;  1CB5 A;  1SP4 B;  1AU4 A;  1ITO A;  2R9C A;  3CH3 X;  1JQP A;  1PBH A;  4CDD B;  1PPO A;  1TL9 A;  1U9Q X;  3WXF A;  4CDC B;  3HHA A;  3ZUA A;  1AEC A;  5EGW A;  1MEG A;  1GX3 A;  4YYQ A;  2NQG A;  2FTD A;  1POP A;  3RVX A;  1VSN A;  3MTN A;  1ICF A;  4RY2 A;  3DF0 A;  4MSX A;  2YJB A;  1PIP A;  4W5B A;  4BS6 A;  2DC6 A;  3USV A;  2AS8 A;  1PPN A;  2WBF X;  2DCA A;  1THE A;  1DF0 A;  3D6S A;  4OEL A;  5CVM A;  3KKU A;  2AYN A;  4W4U A;  4K7C A;  1X9Y A;  2VHS A;  2G8J A;  3BWK A;  3BPM A;  2AU1 A;  3U8E A;  2DCB A;  4YYW A;  2E00 A;  2AVW A;  5CHV A;  4DMY A;  4YVA A;  1QXP A;  1ATK A;  4FIP A;  3OF9 A;  4PP1 A;  5J94 A;  2PRE A;  1CS8 A;  3S3Q A;  1YK7 A;  1ZCM A;  2ATO A;  2H7J A;  2FRQ A;  3IUT A;  4G54 A;  1AU2 A;  1K3B B;  1ZIV A;  3BOW A;  2F1G A;  4XUI A;  5CVN B;  1EWP A;  4AXM A;  2FUD A;  2DC7 A;  2GHU A;  2VFC A;  1MEM A;  3PDF A;  4X6H A;  1F29 A;  3P5V A;  1PPD A;  3IEJ A;  1F2A A;  1NB3 A;  4BSQ A;  4I07 A;  5JA7 A;  3MHS A;  1GEC E;  2DC9 A;  3IOQ A;  5CHT A;  4C5P A;  1HUC B;  2O6X A;  3C9E A;  3MOR A;  2FRA A;  2BDZ A;  5CVO B;  1PCI A;  3K8U A;  1IWD A;  3KW9 A;  3KWZ A;  2FYE A;  1NB5 A;  5K16 A;  2R9F A;  4KLB A;  1MDW A;  2E03 A;  1PPP A;  2OZ2 A;  2DZY A;  2XU4 A;  1U9W A;  3K24 A;  1BGO A;  1GCB A;  3QJ3 A;  3P5U A;  2PBH A;  3GCB A;  3KFQ A;  1CTE A;  5A24 A;  2XU3 A;  2XU1 A;  3MHH A;  1GMY A;  3IMA A;  3H6S A;  4QBB A;  1AU3 A;  1F2C A;  3BCN A;  3M99 A;  1E2T A;  1PE6 A;  2AYO A;  3N4C A;  2R6N A;  2FQ9 A;  4I05 A;  2G8E A;  4PAD A;  4W5C A;  2CB5 A;  3K9M A;  1W5R A;  1AYW A;  1NL6 A;  4XR7 A;  3O0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...