3WXGA

Crystal structure of cyld usp domain (c596a) in complex with lys63-linked diubiquitin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
300
Chain Sequence
MGLEVMVGKKKGIQGHYNSAYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
total genus 83
structure length 300
sequence length 309
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxgA00
1ZIVA 4I04A 1QXPA 3KWZA 5CHTA 6PADA 3HHAA 2E02A 2O6XA 4N79A 1NB3A 3N3KA 2FT2A 2G8JA 1VSNA 5K16A 4W4UA 3K24A 3TNXA 3E1ZB 2B1MA 4MZSA 1S4VA 3H7DA 4YV8A 2F1GA 2FYEA 1U9XA 1F2BA 3KKUA 4WA6A 3CBKA 1NLJA 1YK8A 4YYUA 1IWDA 3B79A 4PP2E 3S3QA 5F02A 1QOLA 2DC9A 1MEMA 2YJ2A 2PREA 3QSDA 1U9QX 1O0EA 1MS6A 2AS8A 2DZZA 4PI3A 3OVXA 3IOQA 4I05A 1GECE 1THEA 5CHVA 3K8UA 1ME4A 2FQ9A 1AU4A 1POPA 5CVMA 1PCIA 1KXRA 1NQCA 3USVA 5CVNB 2Y6EA 1PPPA 3LXSA 1GMYA 3GCBA 1PADA 1BGOA 1PXVA 1EWMA 2E00A 3N3GA 3P5UA 4FJCA 2NQAA 2XU1A 1MEGA 4YYQA 1NB5A 3C9EA 4KLBA 1DF0A 1AYUA 1HUCB 3BOWA 5A24A 1PE6A 4YYVA 3F5VA 4P6EA 4AXLA 1U5IA 2G8EA 2R9NA 2CIOA 1YT7A 4PP1A 3U8EA 3KX1A 7PCKA 3MTNA 2B1NA 3F75A 1CVZA 1ZCMA 4CDEB 2DZYA 1BP4A 4BPVA 4X6HA 3WXGA 4QRVA 1AU3A 4DMYA 1A6RA 2ARYA 2Y5BA 3P5XA 4YYSA 1F29A 2FO5A 1GLOA 4CDDB 3I06A 3H89A 1PBHA 3CH3X 3LFYA 3IHPA 4Q8GA 1SP4B 5CVOB 3BCNA 4W5BA 4G54A 3O0UA 3K9MA 3PDFA 3BC3A 2DC7A 3CH2X 2FTDA 4BS5A 2HHNA 3ZUAA 1MDWA 2DCCA 3P5VA 4K7CA 1KFXL 1MHWA 1BQIA 2E03A 2FRQA 3QJ3A 2XU4A 2F7DA 3PNRA 1TL9A 2BDZA 1FH0A 2WBFX 2DCAA 3ERVA 3KFQA 1CB5A 2FRAA 3HD3A 4RY2A 3HHIA 2OZ2A 3WXEA 2H7JA 2R9FA 3H6SA 4CDCB 1YVBA 4FK5A 2ACTA 4AXMA 1CS8A 2P7UA 1M6DA 2AVWA 5PADA 3KSEA 2DCDA 4CDFB 3QT4A 3V6EA 4CZWA 2VHFA 4P6GA 1AU0A 1MIRA 3M99A 2YJBA 2C0YA 2FUDA 1EWPA 4QRXA 2AUXA 2PNSA 1U9WA 2IBIA 2DJFB 5EGWA 2NQIA 2P0RA 4HWYA 1PPOA 1AU2A 1KHQA 2HH5A 1F2AA 3RVWA 1CPJA 3IUTA 3OF8A 3RVVA 1YALA 3OISA 3KW9A 2JQFR 3S3RA 3IMAA 2AUZA 4FIPA 2DC8A 3PBHA 1EWLA 4BSQA 1JQPA 3OVZA 1QMYA 2YJ9A 1U9VA 4I07A 1K3BB 2DC6A 4MZOA 3AI8A 2DJGB 4QRGA 4X6IA 3IEJA 1ICFA 3BPFA 2R6NA 2YJCA 4OELA 5FPWA 2VHSA 1CQDA 2NQGA 3H8BA 1SNKA 1CSBB 2YJ8A 4ZUXU 1PPNA 2R9MA 4QH6A 2ATOA 2OP3A 4PADA 3N4CA 2G6DA 2JQGR 2E01A 2NQDB 1Q6KA 2OULA 1BY8A 1GCBA 4N4ZA 1ME3A 3BWKA 2R9CA 1AIMA 4QBBA 3WXFA 1STFE 4DMXA 1AECA 4XR7A 9PAPA 1X9YA 2BDLA 2HD5A 1TLOA 4YYRA 3MHHA 2R9OA 4OEMA 3RVXA 2AYNA 1ITOA 1NPZA 1QDQA 3D6SA 1NL6A 1XKGA 2G7YA 2XU3A 3I3TA 8PCHA 4YYWA 1YK7A 1Y4HA 5EF4A 2AIMA 1DEUA 3OF9A 3HWNA 2HXZA 1PPDA 1VJVA 3NHEA 2PBHA 2GHUA 3DF0A 1PIPA 4N8WA 4XUIA 1EF7A 5J94A 4BS6A 1Y08A 4BQVA 3V6CA 4YVAA 2XU5A 2PADA 3O1GA 4MSXA 4X6JA 1ATKA 3BPMA 3MORA 5JH3A 2P86A 3P5WA 2GFOA 2IPPB 2AYOA 1CJLA 1CTEA 3MHSA 2DCBA 4Q8HA 5JA7A 1AYWA 1EWOA 1AYVA 2AU1A 3PW3A 1F2CA 3H8CA 1KHPA 2CB5A 3KWBX 3CBJA 1KFUL 3IV2A 1TU6A 4W5CA 1CV8A
chains in the Genus database with same CATH superfamily
1ZIVA 4I04A 1QXPA 3KWZA 5CHTA 6PADA 3HHAA 2E02A 2O6XA 4N79A 1NB3A 3N3KA 2FT2A 2G8JA 1VSNA 5K16A 4W4UA 3K24A 3TNXA 3E1ZB 3B21A 2B1MA 4MZSA 1S4VA 3H7DA 4YV8A 2BTWA 2F1GA 2FYEA 1U9XA 1F2BA 3KKUA 4MM3B 4WA6A 3CBKA 1NLJA 1YK8A 4YYUA 1IWDA 3B79A 4PP2E 3S3QA 5F02A 1QOLA 4HXDB 2DC9A 2AGAA 1MEMA 2YJ2A 2PREA 3QSDA 1UKFA 1U9QX 1O0EA 1MS6A 2AS8A 2DZZA 4PI3A 4GUAA 3OVXA 3IOQA 4I05A 1GECE 1THEA 5CHVA 3K8UA 1ME4A 4ZTBA 2FQ9A 1AU4A 3PRPA 1POPA 5CVMA 1PCIA 1KXRA 1NQCA 1PVJA 4D8BA 4BOUA 5EZSA 3O65A 3USVA 5CVNB 2Y6EA 1PPPA 3LXSA 1GMYA 3PT2A 3GCBA 1PADA 1BGOA 1PXVA 1EWMA 2E00A 3N3GA 3P5UA 4FJCA 2NQAA 2XU1A 1MEGA 4YYQA 1NB5A 1DKIA 3C9EA 2DOSA 4KLBA 1DF0A 1AYUA 4D8EA 3W30A 1HUCB 2Z84A 3BOWA 3OQCA 5A24A 1PE6A 4YYVA 3F5VA 4P6EA 4AXLA 1U5IA 2G8EA 2R9NA 2CIOA 4M0WA 1YT7A 4MI7A 3ZNHA 4PP1A 3U8EA 3KX1A 7PCKA 3MTNA 3RNVA 2B1NA 3F75A 1CVZA 1ZCMA 3BB7A 4CDEB 2DZYA 1BP4A 4BPVA 4R3DA 4X6HA 2HWKA 3WXGA 4QRVA 1AU3A 4DMYA 1A6RA 2ARYA 4BOQA 2Y5BA 3P5XA 4YYSA 1F29A 2FO5A 1GLOA 4CDDB 3I06A 3H89A 3MTVA 1PBHA 3CH3X 3LFYA 3IHPA 4Q8GA 3MP2A 1SP4B 5CVOB 3BCNA 4W5BA 4G54A 3O0UA 3E9SA 3K9MA 3PDFA 3BC3A 2DC7A 3CH2X 2FTDA 4BS5A 2HHNA 3ZUAA 1MDWA 2DCCA 3P5VA 4K7CA 1KFXL 4BOZA 1MHWA 1BQIA 4A5UA 2E03A 2FRQA 3QJ3A 2XU4A 2F7DA 3PNRA 1TL9A 2J7QC 2BDZA 1FH0A 2WBFX 4BOPA 2DCAA 3ERVA 3KFQA 1CB5A 3PHUA 2FRAA 3HD3A 4RY2A 3HHIA 2OZ2A 3WXEA 2H7JA 2R9FA 3H6SA 4CDCB 1YVBA 4IP3A 4FK5A 2ACTA 4AXMA 1CS8A 2P7UA 3PHWA 1M6DA 2AVWA 5PADA 3KSEA 2DCDA 4CDFB 3MJ5A 3QT4A 3V6EA 3BBAA 2JRIA 4CZWA 2VHFA 4P6GA 1AU0A 1MIRA 3M99A 2YJBA 2C0YA 2FUDA 1EWPA 4QRXA 2AUXA 2PNSA 1U9WA 2IBIA 2DJFB 5EGWA 2NQIA 4WURA 2P0RA 4OVZA 3TMPA 4HWYA 1PPOA 5JZEA 1AU2A 1KHQA 2HH5A 4OVZB 1F2AA 3RVWA 1CPJA 3IUTA 3OF8A 3RVVA 1YALA 4P16A 3OISA 2BTWB 3KW9A 2JQFR 3BY4A 3S3RA 3IMAA 2AUZA 5EZQA 4RF0A 4FIPA 2DC8A 3PBHA 1EWLA 2BU3A 4BSQA 1JQPA 3OVZA 1QMYA 2JTCA 2YJ9A 1U9VA 4I07A 1K3BB 2DC6A 4MZOA 3AI8A 2DJGB 2UZJA 4QRGA 4X6IA 3IEJA 1ICFA 3BPFA 2R6NA 2YJCA 3IFUA 4OELA 5FPWA 2VHSA 1CQDA 2NQGA 3H8BA 1SNKA 1CSBB 2YJ8A 4ZUXU 1PPNA 2R9MA 4QH6A 2ATOA 2OP3A 2JQGR 3N4CA 2G6DA 2E01A 2NQDB 4PADA 1Q6KA 2OULA 1BY8A 1GCBA 4D8IA 4N4ZA 3PSEA 1ME3A 4RNAA 3BWKA 2R9CA 1AIMA 4QBBA 3WXFA 1STFE 4DMXA 1AECA 4XR7A 9PAPA 1X9YA 2BDLA 2HD5A 1TLOA 4YYRA 3MHHA 2R9OA 4OEMA 3RVXA 4REZA 2AYNA 1ITOA 3W31A 1NPZA 1QDQA 3D6SA 1NL6A 1XKGA 4PT5A 2G7YA 2XU3A 3I3TA 8PCHA 4YYWA 4RF1A 1YK7A 1Y4HA 5EF4A 2AIMA 1DEUA 3OF9A 3HWNA 5E6JA 2HXZA 1PPDA 1VJVA 3NHEA 2PBHA 2GHUA 3DF0A 4OW0A 1PIPA 4N8WA 4XUIA 1EF7A 5J94A 4BS6A 1Y08A 3C0RA 4BQVA 3V6CA 3PHXA 2XU5A 4YVAA 2PADA 3O1GA 4MSXA 4X6JA 1ATKA 3BPMA 3MORA 2FE8A 1YZBA 3TRKA 5JH3A 2P86A 3P5WA 2J7QA 2GFOA 2IPPB 2AYOA 1CJLA 1CTEA 3MHSA 2DCBA 4IUMA 4XZXA 4Q8HA 1AYWA 5JA7A 1EWOA 1AYVA 2AU1A 4BOSA 3PW3A 4RKXA 1F2CA 3H8CA 1KHPA 2CB5A 5KO3A 3KWBX 3CBJA 1KFUL 3IV2A 1TU6A 3PRMA 4W5CA 1CV8A
chains in the Genus database with same CATH topology
1ZIVA 4I04A 1QXPA 3KWZA 5CHTA 6PADA 3HHAA 2E02A 2O6XA 4N79A 1NB3A 3N3KA 2FT2A 2G8JA 1VSNA 5K16A 4W4UA 3K24A 3TNXA 3E1ZB 2B1MA 4B55A 4MZSA 1S4VA 3H7DA 4YV8A 2F1GA 2FYEA 1W4TA 1U9XA 1F2BA 3KKUA 4WA6A 3CBKA 1NLJA 1YK8A 4YYUA 1IWDA 3B79A 4PP2E 3S3QA 5F02A 1QOLA 2DC9A 1MEMA 2YJ2A 2PREA 3QSDA 1U9QX 1O0EA 1MS6A 3D9WA 2AS8A 2DZZA 4PI3A 3OVXA 3IOQA 4I05A 1GECE 1THEA 5CHVA 3K8UA 1ME4A 2FQ9A 1AU4A 1POPA 5CVMA 1PCIA 1KXRA 1NQCA 1E2TA 3USVA 5CVNB 2Y6EA 1PPPA 3LXSA 1GMYA 3GCBA 1PADA 1BGOA 1PXVA 1EWMA 2E00A 3N3GA 3P5UA 4FJCA 2BSZA 2NQAA 2XU1A 1MEGA 4YYQA 1NB5A 1GX3A 3C9EA 4KLBA 1DF0A 1AYUA 1HUCB 3BOWA 5A24A 1PE6A 4YYVA 3F5VA 4BGFA 4P6EA 4AXLA 1U5IA 2G8EA 2R9NA 2CIOA 1W5RA 1YT7A 4PP1A 3U8EA 3KX1A 7PCKA 3MTNA 2B1NA 3F75A 1CVZA 1ZCMA 4CDEB 2DZYA 1BP4A 4BPVA 4X6HA 3WXGA 4QRVA 1AU3A 4DMYA 1A6RA 2ARYA 2Y5BA 3P5XA 4YYSA 1F29A 2FO5A 1GLOA 4CDDB 3I06A 3H89A 1PBHA 3CH3X 3LFYA 3IHPA 4Q8GA 1SP4B 5CVOB 3BCNA 4W5BA 4G54A 3O0UA 4NV8A 3K9MA 3PDFA 3BC3A 2DC7A 3CH2X 2FTDA 4BS5A 2HHNA 3ZUAA 1MDWA 2DCCA 3P5VA 4K7CA 1KFXL 1MHWA 1BQIA 2E03A 2FRQA 3QJ3A 2XU4A 2F7DA 3PNRA 1TL9A 2BDZA 1FH0A 2WBFX 4C5PA 2DCAA 3ERVA 3KFQA 1CB5A 2FRAA 3HD3A 4RY2A 3HHIA 2OZ2A 3WXEA 2H7JA 2R9FA 3H6SA 4CDCB 1YVBA 4FK5A 2ACTA 4AXMA 1CS8A 2P7UA 1M6DA 2AVWA 5PADA 3KSEA 2DCDA 4CDFB 3QT4A 3V6EA 4CZWA 2VHFA 4P6GA 1AU0A 1MIRA 3M99A 2YJBA 2C0YA 2FUDA 1EWPA 4QRXA 2AUXA 2PNSA 1U9WA 2IBIA 2DJFB 5EGWA 4GUZA 2NQIA 2P0RA 4HWYA 1PPOA 1AU2A 1KHQA 2HH5A 1F2AA 3RVWA 1CPJA 3IUTA 3OF8A 3RVVA 1YALA 3OISA 3KW9A 2JQFR 3S3RA 3IMAA 2AUZA 4FIPA 2DC8A 3PBHA 1EWLA 3LTWA 4BSQA 1JQPA 3OVZA 1QMYA 2YJ9A 1U9VA 4I07A 1K3BB 2DC6A 4MZOA 3AI8A 2DJGB 4QRGA 4X6IA 3IEJA 1ICFA 3BPFA 2R6NA 2YJCA 4OELA 5FPWA 2VHSA 1CQDA 2NQGA 3H8BA 1SNKA 1CSBB 2YJ8A 4ZUXU 1PPNA 2R9MA 2VFCA 4QH6A 2ATOA 2OP3A 4PADA 3N4CA 2G6DA 2JQGR 2E01A 2NQDB 1Q6KA 2OULA 1BY8A 1GCBA 4N4ZA 1ME3A 3BWKA 2R9CA 1AIMA 4QBBA 3WXFA 1STFE 4DMXA 1AECA 4XR7A 9PAPA 1X9YA 2BDLA 2HD5A 1TLOA 4YYRA 3MHHA 2R9OA 4OEMA 3RVXA 2AYNA 1ITOA 1NPZA 1QDQA 3D6SA 1NL6A 1XKGA 2G7YA 2XU3A 3I3TA 8PCHA 4YYWA 1YK7A 1Y4HA 5EF4A 3OF9A 2AIMA 1DEUA 3HWNA 2HXZA 1PPDA 1VJVA 3NHEA 2PBHA 2GHUA 1W6FA 3DF0A 1PIPA 4N8WA 4XUIA 1EF7A 5J94A 4BS6A 1Y08A 4BQVA 3V6CA 4YVAA 2XU5A 2PADA 3O1GA 4MSXA 4X6JA 1ATKA 3BPMA 3MORA 2VFBA 5JH3A 2P86A 3P5WA 2GFOA 2IPPB 2AYOA 1CJLA 1CTEA 3MHSA 2DCBA 4Q8HA 5JA7A 1AYWA 1EWOA 1AYVA 2AU1A 3PW3A 1F2CA 4NV7A 3H8CA 1KHPA 2CB5A 3KWBX 3CBJA 1KFUL 3IV2A 1TU6A 4W5CA 1CV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZIV A;  4I04 A;  1QXP A;  3KWZ A;  5CHT A;  6PAD A;  3HHA A;  2E02 A;  2O6X A;  4N79 A;  1NB3 A;  3N3K A;  2FT2 A;  2G8J A;  1VSN A;  5K16 A;  4W4U A;  3K24 A;  3TNX A;  3E1Z B;  2B1M A;  4MZS A;  1S4V A;  3H7D A;  4YV8 A;  2F1G A;  2FYE A;  1U9X A;  1F2B A;  3KKU A;  4WA6 A;  3CBK A;  1NLJ A;  1YK8 A;  4YYU A;  1IWD A;  3B79 A;  4PP2 E;  3S3Q A;  5F02 A;  1QOL A;  2DC9 A;  1MEM A;  2YJ2 A;  2PRE A;  3QSD A;  1U9Q X;  1O0E A;  1MS6 A;  2AS8 A;  2DZZ A;  4PI3 A;  3OVX A;  3IOQ A;  4I05 A;  1GEC E;  1THE A;  5CHV A;  3K8U A;  1ME4 A;  2FQ9 A;  1AU4 A;  1POP A;  5CVM A;  1PCI A;  1KXR A;  1NQC A;  3USV A;  5CVN B;  2Y6E A;  1PPP A;  3LXS A;  1GMY A;  3GCB A;  1PAD A;  1BGO A;  1PXV A;  1EWM A;  2E00 A;  3N3G A;  3P5U A;  4FJC A;  2NQA A;  2XU1 A;  1MEG A;  4YYQ A;  1NB5 A;  3C9E A;  4KLB A;  1DF0 A;  1AYU A;  1HUC B;  3BOW A;  5A24 A;  1PE6 A;  4YYV A;  3F5V A;  4P6E A;  4AXL A;  1U5I A;  2G8E A;  2R9N A;  2CIO A;  1YT7 A;  4PP1 A;  3U8E A;  3KX1 A;  7PCK A;  3MTN A;  2B1N A;  3F75 A;  1CVZ A;  1ZCM A;  4CDE B;  2DZY A;  1BP4 A;  4BPV A;  4X6H A;  3WXG A;  4QRV A;  1AU3 A;  4DMY A;  1A6R A;  2ARY A;  2Y5B A;  3P5X A;  4YYS A;  1F29 A;  2FO5 A;  1GLO A;  4CDD B;  3I06 A;  3H89 A;  1PBH A;  3CH3 X;  3LFY A;  3IHP A;  4Q8G A;  1SP4 B;  5CVO B;  3BCN A;  4W5B A;  4G54 A;  3O0U A;  3K9M A;  3PDF A;  3BC3 A;  2DC7 A;  3CH2 X;  2FTD A;  4BS5 A;  2HHN A;  3ZUA A;  1MDW A;  2DCC A;  3P5V A;  4K7C A;  1KFX L;  1MHW A;  1BQI A;  2E03 A;  2FRQ A;  3QJ3 A;  2XU4 A;  2F7D A;  3PNR A;  1TL9 A;  2BDZ A;  1FH0 A;  2WBF X;  2DCA A;  3ERV A;  3KFQ A;  1CB5 A;  2FRA A;  3HD3 A;  4RY2 A;  3HHI A;  2OZ2 A;  3WXE A;  2H7J A;  2R9F A;  3H6S A;  4CDC B;  1YVB A;  4FK5 A;  2ACT A;  4AXM A;  1CS8 A;  2P7U A;  1M6D A;  2AVW A;  5PAD A;  3KSE A;  2DCD A;  4CDF B;  3QT4 A;  3V6E A;  4CZW A;  2VHF A;  4P6G A;  1AU0 A;  1MIR A;  3M99 A;  2YJB A;  2C0Y A;  2FUD A;  1EWP A;  4QRX A;  2AUX A;  2PNS A;  1U9W A;  2IBI A;  2DJF B;  5EGW A;  2NQI A;  2P0R A;  4HWY A;  1PPO A;  1AU2 A;  1KHQ A;  2HH5 A;  1F2A A;  3RVW A;  1CPJ A;  3IUT A;  3OF8 A;  3RVV A;  1YAL A;  3OIS A;  3KW9 A;  2JQF R;  3S3R A;  3IMA A;  2AUZ A;  4FIP A;  2DC8 A;  3PBH A;  1EWL A;  4BSQ A;  1JQP A;  3OVZ A;  1QMY A;  2YJ9 A;  1U9V A;  4I07 A;  1K3B B;  2DC6 A;  4MZO A;  3AI8 A;  2DJG B;  4QRG A;  4X6I A;  3IEJ A;  1ICF A;  3BPF A;  2R6N A;  2YJC A;  4OEL A;  5FPW A;  2VHS A;  1CQD A;  2NQG A;  3H8B A;  1SNK A;  1CSB B;  2YJ8 A;  4ZUX U;  1PPN A;  2R9M A;  4QH6 A;  2ATO A;  2OP3 A;  4PAD A;  3N4C A;  2G6D A;  2JQG R;  2E01 A;  2NQD B;  1Q6K A;  2OUL A;  1BY8 A;  1GCB A;  4N4Z A;  1ME3 A;  3BWK A;  2R9C A;  1AIM A;  4QBB A;  3WXF A;  1STF E;  4DMX A;  1AEC A;  4XR7 A;  9PAP A;  1X9Y A;  2BDL A;  2HD5 A;  1TLO A;  4YYR A;  3MHH A;  2R9O A;  4OEM A;  3RVX A;  2AYN A;  1ITO A;  1NPZ A;  1QDQ A;  3D6S A;  1NL6 A;  1XKG A;  2G7Y A;  2XU3 A;  3I3T A;  8PCH A;  4YYW A;  1YK7 A;  1Y4H A;  5EF4 A;  2AIM A;  1DEU A;  3OF9 A;  3HWN A;  2HXZ A;  1PPD A;  1VJV A;  3NHE A;  2PBH A;  2GHU A;  3DF0 A;  1PIP A;  4N8W A;  4XUI A;  1EF7 A;  5J94 A;  4BS6 A;  1Y08 A;  4BQV A;  3V6C A;  4YVA A;  2XU5 A;  2PAD A;  3O1G A;  4MSX A;  4X6J A;  1ATK A;  3BPM A;  3MOR A;  5JH3 A;  2P86 A;  3P5W A;  2GFO A;  2IPP B;  2AYO A;  1CJL A;  1CTE A;  3MHS A;  2DCB A;  4Q8H A;  5JA7 A;  1AYW A;  1EWO A;  1AYV A;  2AU1 A;  3PW3 A;  1F2C A;  3H8C A;  1KHP A;  2CB5 A;  3KWB X;  3CBJ A;  1KFU L;  3IV2 A;  1TU6 A;  4W5C A;  1CV8 A; 
#chains in the Genus database with same CATH topology
 1ZIV A;  4I04 A;  1QXP A;  3KWZ A;  5CHT A;  6PAD A;  3HHA A;  2E02 A;  2O6X A;  4N79 A;  1NB3 A;  3N3K A;  2FT2 A;  2G8J A;  1VSN A;  5K16 A;  4W4U A;  3K24 A;  3TNX A;  3E1Z B;  3B21 A;  2B1M A;  4MZS A;  1S4V A;  3H7D A;  4YV8 A;  2BTW A;  2F1G A;  2FYE A;  1U9X A;  1F2B A;  3KKU A;  4MM3 B;  4WA6 A;  3CBK A;  1NLJ A;  1YK8 A;  4YYU A;  1IWD A;  3B79 A;  4PP2 E;  3S3Q A;  5F02 A;  1QOL A;  4HXD B;  2DC9 A;  2AGA A;  1MEM A;  2YJ2 A;  2PRE A;  3QSD A;  1UKF A;  1U9Q X;  1O0E A;  1MS6 A;  2AS8 A;  2DZZ A;  4PI3 A;  4GUA A;  3OVX A;  3IOQ A;  4I05 A;  1GEC E;  1THE A;  5CHV A;  3K8U A;  1ME4 A;  4ZTB A;  2FQ9 A;  1AU4 A;  3PRP A;  1POP A;  5CVM A;  1PCI A;  1KXR A;  1NQC A;  1PVJ A;  4D8B A;  4BOU A;  5EZS A;  3O65 A;  3USV A;  5CVN B;  2Y6E A;  1PPP A;  3LXS A;  1GMY A;  3PT2 A;  3GCB A;  1PAD A;  1BGO A;  1PXV A;  1EWM A;  2E00 A;  3N3G A;  3P5U A;  4FJC A;  2NQA A;  2XU1 A;  1MEG A;  4YYQ A;  1NB5 A;  1DKI A;  3C9E A;  2DOS A;  4KLB A;  1DF0 A;  1AYU A;  4D8E A;  3W30 A;  1HUC B;  2Z84 A;  3BOW A;  3OQC A;  5A24 A;  1PE6 A;  4YYV A;  3F5V A;  4P6E A;  4AXL A;  1U5I A;  2G8E A;  2R9N A;  2CIO A;  4M0W A;  1YT7 A;  4MI7 A;  3ZNH A;  4PP1 A;  3U8E A;  3KX1 A;  7PCK A;  3MTN A;  3RNV A;  2B1N A;  3F75 A;  1CVZ A;  1ZCM A;  3BB7 A;  4CDE B;  2DZY A;  1BP4 A;  4BPV A;  4R3D A;  4X6H A;  2HWK A;  3WXG A;  4QRV A;  1AU3 A;  4DMY A;  1A6R A;  2ARY A;  4BOQ A;  2Y5B A;  3P5X A;  4YYS A;  1F29 A;  2FO5 A;  1GLO A;  4CDD B;  3I06 A;  3H89 A;  3MTV A;  1PBH A;  3CH3 X;  3LFY A;  3IHP A;  4Q8G A;  3MP2 A;  1SP4 B;  5CVO B;  3BCN A;  4W5B A;  4G54 A;  3O0U A;  3E9S A;  3K9M A;  3PDF A;  3BC3 A;  2DC7 A;  3CH2 X;  2FTD A;  4BS5 A;  2HHN A;  3ZUA A;  1MDW A;  2DCC A;  3P5V A;  4K7C A;  1KFX L;  4BOZ A;  1MHW A;  1BQI A;  4A5U A;  2E03 A;  2FRQ A;  3QJ3 A;  2XU4 A;  2F7D A;  3PNR A;  1TL9 A;  2J7Q C;  2BDZ A;  1FH0 A;  2WBF X;  4BOP A;  2DCA A;  3ERV A;  3KFQ A;  1CB5 A;  3PHU A;  2FRA A;  3HD3 A;  4RY2 A;  3HHI A;  2OZ2 A;  3WXE A;  2H7J A;  2R9F A;  3H6S A;  4CDC B;  1YVB A;  4IP3 A;  4FK5 A;  2ACT A;  4AXM A;  1CS8 A;  2P7U A;  3PHW A;  1M6D A;  2AVW A;  5PAD A;  3KSE A;  2DCD A;  4CDF B;  3MJ5 A;  3QT4 A;  3V6E A;  3BBA A;  2JRI A;  4CZW A;  2VHF A;  4P6G A;  1AU0 A;  1MIR A;  3M99 A;  2YJB A;  2C0Y A;  2FUD A;  1EWP A;  4QRX A;  2AUX A;  2PNS A;  1U9W A;  2IBI A;  2DJF B;  5EGW A;  2NQI A;  4WUR A;  2P0R A;  4OVZ A;  3TMP A;  4HWY A;  1PPO A;  5JZE A;  1AU2 A;  1KHQ A;  2HH5 A;  4OVZ B;  1F2A A;  3RVW A;  1CPJ A;  3IUT A;  3OF8 A;  3RVV A;  1YAL A;  4P16 A;  3OIS A;  2BTW B;  3KW9 A;  2JQF R;  3BY4 A;  3S3R A;  3IMA A;  2AUZ A;  5EZQ A;  4RF0 A;  4FIP A;  2DC8 A;  3PBH A;  1EWL A;  2BU3 A;  4BSQ A;  1JQP A;  3OVZ A;  1QMY A;  2JTC A;  2YJ9 A;  1U9V A;  4I07 A;  1K3B B;  2DC6 A;  4MZO A;  3AI8 A;  2DJG B;  2UZJ A;  4QRG A;  4X6I A;  3IEJ A;  1ICF A;  3BPF A;  2R6N A;  2YJC A;  3IFU A;  4OEL A;  5FPW A;  2VHS A;  1CQD A;  2NQG A;  3H8B A;  1SNK A;  1CSB B;  2YJ8 A;  4ZUX U;  1PPN A;  2R9M A;  4QH6 A;  2ATO A;  2OP3 A;  2JQG R;  3N4C A;  2G6D A;  2E01 A;  2NQD B;  4PAD A;  1Q6K A;  2OUL A;  1BY8 A;  1GCB A;  4D8I A;  4N4Z A;  3PSE A;  1ME3 A;  4RNA A;  3BWK A;  2R9C A;  1AIM A;  4QBB A;  3WXF A;  1STF E;  4DMX A;  1AEC A;  4XR7 A;  9PAP A;  1X9Y A;  2BDL A;  2HD5 A;  1TLO A;  4YYR A;  3MHH A;  2R9O A;  4OEM A;  3RVX A;  4REZ A;  2AYN A;  1ITO A;  3W31 A;  1NPZ A;  1QDQ A;  3D6S A;  1NL6 A;  1XKG A;  4PT5 A;  2G7Y A;  2XU3 A;  3I3T A;  8PCH A;  4YYW A;  4RF1 A;  1YK7 A;  1Y4H A;  5EF4 A;  2AIM A;  1DEU A;  3OF9 A;  3HWN A;  5E6J A;  2HXZ A;  1PPD A;  1VJV A;  3NHE A;  2PBH A;  2GHU A;  3DF0 A;  4OW0 A;  1PIP A;  4N8W A;  4XUI A;  1EF7 A;  5J94 A;  4BS6 A;  1Y08 A;  3C0R A;  4BQV A;  3V6C A;  3PHX A;  2XU5 A;  4YVA A;  2PAD A;  3O1G A;  4MSX A;  4X6J A;  1ATK A;  3BPM A;  3MOR A;  2FE8 A;  1YZB A;  3TRK A;  5JH3 A;  2P86 A;  3P5W A;  2J7Q A;  2GFO A;  2IPP B;  2AYO A;  1CJL A;  1CTE A;  3MHS A;  2DCB A;  4IUM A;  4XZX A;  4Q8H A;  1AYW A;  5JA7 A;  1EWO A;  1AYV A;  2AU1 A;  4BOS A;  3PW3 A;  4RKX A;  1F2C A;  3H8C A;  1KHP A;  2CB5 A;  5KO3 A;  3KWB X;  3CBJ A;  1KFU L;  3IV2 A;  1TU6 A;  3PRM A;  4W5C A;  1CV8 A; 
#chains in the Genus database with same CATH homology
 1ZIV A;  4I04 A;  1QXP A;  3KWZ A;  5CHT A;  6PAD A;  3HHA A;  2E02 A;  2O6X A;  4N79 A;  1NB3 A;  3N3K A;  2FT2 A;  2G8J A;  1VSN A;  5K16 A;  4W4U A;  3K24 A;  3TNX A;  3E1Z B;  2B1M A;  4B55 A;  4MZS A;  1S4V A;  3H7D A;  4YV8 A;  2F1G A;  2FYE A;  1W4T A;  1U9X A;  1F2B A;  3KKU A;  4WA6 A;  3CBK A;  1NLJ A;  1YK8 A;  4YYU A;  1IWD A;  3B79 A;  4PP2 E;  3S3Q A;  5F02 A;  1QOL A;  2DC9 A;  1MEM A;  2YJ2 A;  2PRE A;  3QSD A;  1U9Q X;  1O0E A;  1MS6 A;  3D9W A;  2AS8 A;  2DZZ A;  4PI3 A;  3OVX A;  3IOQ A;  4I05 A;  1GEC E;  1THE A;  5CHV A;  3K8U A;  1ME4 A;  2FQ9 A;  1AU4 A;  1POP A;  5CVM A;  1PCI A;  1KXR A;  1NQC A;  1E2T A;  3USV A;  5CVN B;  2Y6E A;  1PPP A;  3LXS A;  1GMY A;  3GCB A;  1PAD A;  1BGO A;  1PXV A;  1EWM A;  2E00 A;  3N3G A;  3P5U A;  4FJC A;  2BSZ A;  2NQA A;  2XU1 A;  1MEG A;  4YYQ A;  1NB5 A;  1GX3 A;  3C9E A;  4KLB A;  1DF0 A;  1AYU A;  1HUC B;  3BOW A;  5A24 A;  1PE6 A;  4YYV A;  3F5V A;  4BGF A;  4P6E A;  4AXL A;  1U5I A;  2G8E A;  2R9N A;  2CIO A;  1W5R A;  1YT7 A;  4PP1 A;  3U8E A;  3KX1 A;  7PCK A;  3MTN A;  2B1N A;  3F75 A;  1CVZ A;  1ZCM A;  4CDE B;  2DZY A;  1BP4 A;  4BPV A;  4X6H A;  3WXG A;  4QRV A;  1AU3 A;  4DMY A;  1A6R A;  2ARY A;  2Y5B A;  3P5X A;  4YYS A;  1F29 A;  2FO5 A;  1GLO A;  4CDD B;  3I06 A;  3H89 A;  1PBH A;  3CH3 X;  3LFY A;  3IHP A;  4Q8G A;  1SP4 B;  5CVO B;  3BCN A;  4W5B A;  4G54 A;  3O0U A;  4NV8 A;  3K9M A;  3PDF A;  3BC3 A;  2DC7 A;  3CH2 X;  2FTD A;  4BS5 A;  2HHN A;  3ZUA A;  1MDW A;  2DCC A;  3P5V A;  4K7C A;  1KFX L;  1MHW A;  1BQI A;  2E03 A;  2FRQ A;  3QJ3 A;  2XU4 A;  2F7D A;  3PNR A;  1TL9 A;  2BDZ A;  1FH0 A;  2WBF X;  4C5P A;  2DCA A;  3ERV A;  3KFQ A;  1CB5 A;  2FRA A;  3HD3 A;  4RY2 A;  3HHI A;  2OZ2 A;  3WXE A;  2H7J A;  2R9F A;  3H6S A;  4CDC B;  1YVB A;  4FK5 A;  2ACT A;  4AXM A;  1CS8 A;  2P7U A;  1M6D A;  2AVW A;  5PAD A;  3KSE A;  2DCD A;  4CDF B;  3QT4 A;  3V6E A;  4CZW A;  2VHF A;  4P6G A;  1AU0 A;  1MIR A;  3M99 A;  2YJB A;  2C0Y A;  2FUD A;  1EWP A;  4QRX A;  2AUX A;  2PNS A;  1U9W A;  2IBI A;  2DJF B;  5EGW A;  4GUZ A;  2NQI A;  2P0R A;  4HWY A;  1PPO A;  1AU2 A;  1KHQ A;  2HH5 A;  1F2A A;  3RVW A;  1CPJ A;  3IUT A;  3OF8 A;  3RVV A;  1YAL A;  3OIS A;  3KW9 A;  2JQF R;  3S3R A;  3IMA A;  2AUZ A;  4FIP A;  2DC8 A;  3PBH A;  1EWL A;  3LTW A;  4BSQ A;  1JQP A;  3OVZ A;  1QMY A;  2YJ9 A;  1U9V A;  4I07 A;  1K3B B;  2DC6 A;  4MZO A;  3AI8 A;  2DJG B;  4QRG A;  4X6I A;  3IEJ A;  1ICF A;  3BPF A;  2R6N A;  2YJC A;  4OEL A;  5FPW A;  2VHS A;  1CQD A;  2NQG A;  3H8B A;  1SNK A;  1CSB B;  2YJ8 A;  4ZUX U;  1PPN A;  2R9M A;  2VFC A;  4QH6 A;  2ATO A;  2OP3 A;  4PAD A;  3N4C A;  2G6D A;  2JQG R;  2E01 A;  2NQD B;  1Q6K A;  2OUL A;  1BY8 A;  1GCB A;  4N4Z A;  1ME3 A;  3BWK A;  2R9C A;  1AIM A;  4QBB A;  3WXF A;  1STF E;  4DMX A;  1AEC A;  4XR7 A;  9PAP A;  1X9Y A;  2BDL A;  2HD5 A;  1TLO A;  4YYR A;  3MHH A;  2R9O A;  4OEM A;  3RVX A;  2AYN A;  1ITO A;  1NPZ A;  1QDQ A;  3D6S A;  1NL6 A;  1XKG A;  2G7Y A;  2XU3 A;  3I3T A;  8PCH A;  4YYW A;  1YK7 A;  1Y4H A;  5EF4 A;  3OF9 A;  2AIM A;  1DEU A;  3HWN A;  2HXZ A;  1PPD A;  1VJV A;  3NHE A;  2PBH A;  2GHU A;  1W6F A;  3DF0 A;  1PIP A;  4N8W A;  4XUI A;  1EF7 A;  5J94 A;  4BS6 A;  1Y08 A;  4BQV A;  3V6C A;  4YVA A;  2XU5 A;  2PAD A;  3O1G A;  4MSX A;  4X6J A;  1ATK A;  3BPM A;  3MOR A;  2VFB A;  5JH3 A;  2P86 A;  3P5W A;  2GFO A;  2IPP B;  2AYO A;  1CJL A;  1CTE A;  3MHS A;  2DCB A;  4Q8H A;  5JA7 A;  1AYW A;  1EWO A;  1AYV A;  2AU1 A;  3PW3 A;  1F2C A;  4NV7 A;  3H8C A;  1KHP A;  2CB5 A;  3KWB X;  3CBJ A;  1KFU L;  3IV2 A;  1TU6 A;  4W5C A;  1CV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...