3WXGA

Crystal structure of cyld usp domain (c596a) in complex with lys63-linked diubiquitin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
300
Chain Sequence
MGLEVMVGKKKGIQGHYNSAYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
total genus 83
structure length 300
sequence length 309
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxgA00
3KKUA 1XKGA 3I06A 2NQIA 2PBHA 3KWBX 5F02A 2FO5A 4W5CA 2P0RA 4X6IA 3P5UA 1AYVA 4BSQA 3N3KA 3RVWA 2DZYA 3IHPA 2DCDA 3CH2X 1CJLA 3OF9A 3KSEA 1NQCA 1PBHA 2B1NA 3MHSA 1ATKA 4OEMA 5EGWA 1ICFA 4RY2A 1HUCB 1EF7A 2JQFR 1SNKA 2P7UA 4X6HA 4YYRA 4P6EA 2AU1A 2GHUA 5EF4A 1NB3A 1PXVA 1KFUL 1U5IA 4W4UA 1AECA 5CVMA 1CQDA 3MORA 3O1GA 4BS6A 2HD5A 3CBKA 1NPZA 2ACTA 3BPFA 3D6SA 1PADA 1Y08A 2DCAA 2DJGB 3LXSA 3P5XA 1K3BB 1YALA 1YK8A 2DC8A 2FRQA 4OELA 1AYUA 4CDFB 3M99A 2PNSA 4BPVA 2JQGR 1JQPA 3BWKA 2F7DA 2DCBA 2R9CA 2R6NA 2VHSA 2G7YA 1YT7A 8PCHA 2DC6A 2FRAA 4CDCB 3OISA 4P6GA 3C9EA 3HHAA 3WXGA 4CDDB 5A24A 2FTDA 1Q6KA 2OZ2A 2VHFA 1CSBB 3KWZA 9PAPA 1NB5A 1EWMA 2Y6EA 3O0UA 4W5BA 4DMYA 4CDEB 1AU2A 3PNRA 4FK5A 2H7JA 2NQAA 2ATOA 3IUTA 1SP4B 2DC7A 4MSXA 1VSNA 5CHVA 1EWOA 3HHIA 1ZIVA 3TNXA 4K7CA 6PADA 1Y4HA 3IMAA 1CS8A 3KX1A 1MEGA 1MEMA 1X9YA 4MZSA 4XR7A 2NQGA 3PDFA 1VJVA 2YJ9A 1U9VA 4YYVA 3PBHA 1IWDA 3MHHA 1PIPA 4N4ZA 2YJ2A 3ERVA 1PPOA 1U9WA 3ZUAA 3OVZA 4PP1A 3P5WA 2XU1A 3CH3X 3DF0A 2AVWA 4YYSA 2XU4A 1F2CA 4YVAA 5J94A 1EWPA 4BS5A 2PADA 1CV8A 1CB5A 4QRGA 2R9OA 1DEUA 1QXPA 3IV2A 4PI3A 3BOWA 2NQDB 4FIPA 1EWLA 1FH0A 3PW3A 1F29A 4XUIA 3H6SA 2R9MA 3P5VA 3NHEA 2B1MA 3K8UA 3USVA 1KHPA 1NLJA 3QT4A 1MS6A 2IBIA 1ZCMA 2DCCA 2CB5A 2G6DA 2FT2A 5CHTA 4MZOA 4PADA 4Q8HA 4AXLA 1AYWA 2GFOA 2HXZA 1U9XA 2AS8A 1S4VA 2IPPB 1M6DA 2WBFX 2AUZA 3F75A 3QJ3A 5CVOB 3HWNA 3AI8A 1ITOA 1CTEA 3F5VA 1AU4A 3RVVA 3OF8A 1QDQA 1TL9A 1KFXL 1THEA 5FPWA 2FQ9A 2E02A 1MDWA 2ARYA 3H8BA 3B79A 5CVNB 2G8JA 3H89A 2HHNA 2P86A 2F1GA 4I04A 3HD3A 2AYNA 3WXEA 2C0YA 4Q8GA 4WA6A 4QBBA 2E00A 1CVZA 4YV8A 4G54A 4HWYA 2E01A 3IEJA 2OP3A 2Y5BA 3KFQA 1MIRA 2HH5A 2DZZA 4YYQA 1PPPA 1TU6A 1GECE 3S3QA 1O0EA 3GCBA 3BC3A 2E03A 2AYOA 1PPNA 4FJCA 3H8CA 4N8WA 1GLOA 3U8EA 3LFYA 1BQIA 4ZUXU 2DC9A 2FYEA 5PADA 1NL6A 3WXFA 4CZWA 3RVXA 7PCKA 3S3RA 3V6CA 4KLBA 1PCIA 3IOQA 4I05A 2FUDA 2BDLA 2R9NA 1ME3A 1PPDA 3OVXA 4I07A 2G8EA 4YYWA 1F2BA 1DF0A 4BQVA 1CPJA 1A6RA 2AIMA 1PE6A 1U9QX 1BP4A 1QOLA 1KXRA 1F2AA 2CIOA 1BY8A 3I3TA 3BCNA 1AU3A 2XU3A 4X6JA 3E1ZB 4YYUA 4QRVA 1GCBA 1KHQA 1QMYA 3V6EA 4AXMA 1GMYA 1AIMA 2BDZA 1STFE 2DJFB 2YJCA 2R9FA 3H7DA 1POPA 4PP2E 5JH3A 3CBJA 3KW9A 3QSDA 3N3GA 2O6XA 1ME4A 2YJBA 2XU5A 3BPMA 5K16A 1YVBA 5JA7A 1AU0A 1BGOA 1TLOA 2OULA 3K24A 2AUXA 1YK7A 4QH6A 3K9MA 3MTNA 1MHWA 3N4CA 4QRXA 2PREA 4N79A 4DMXA 2YJ8A
chains in the Genus database with same CATH superfamily
3KKUA 1XKGA 3I06A 2NQIA 2PBHA 3KWBX 3PRMA 5F02A 2FO5A 4W5CA 2P0RA 4X6IA 4OVZB 3P5UA 1AYVA 4BSQA 3TMPA 3N3KA 4GUAA 3RVWA 2DZYA 3IHPA 2DCDA 3CH2X 1CJLA 3OF9A 3KSEA 1NQCA 1PBHA 4PT5A 2B1NA 3MHSA 1ATKA 4OEMA 5EGWA 3BY4A 1ICFA 4RY2A 1HUCB 1EF7A 2JQFR 1SNKA 2P7UA 4X6HA 4YYRA 1UKFA 4P6EA 2AU1A 2GHUA 5EF4A 4BOSA 1NB3A 1PXVA 1KFUL 1U5IA 4W4UA 1AECA 5CVMA 1CQDA 3MORA 3O1GA 3TRKA 4BS6A 2HD5A 3CBKA 1NPZA 2ACTA 3BPFA 3D6SA 1PADA 1Y08A 2DCAA 2DJGB 2UZJA 3LXSA 3P5XA 1K3BB 1YALA 1YK8A 2DC8A 2FRQA 4OELA 1AYUA 4CDFB 3M99A 2PNSA 3MJ5A 4BPVA 4M0WA 4RNAA 2JQGR 1JQPA 3BWKA 2F7DA 2DCBA 2R9CA 2R6NA 2VHSA 2G7YA 2Z84A 1YT7A 8PCHA 2DC6A 2FRAA 4P16A 4CDCB 3OISA 4P6GA 3C9EA 3HHAA 3WXGA 4CDDB 3PHWA 5A24A 2FTDA 1Q6KA 2OZ2A 2VHFA 1CSBB 3KWZA 5EZSA 9PAPA 1NB5A 1EWMA 2Y6EA 3O0UA 4W5BA 4DMYA 4MI7A 4CDEB 1AU2A 3PNRA 4FK5A 2DOSA 2H7JA 2NQAA 4BOPA 2ATOA 3IUTA 1SP4B 2DC7A 4MSXA 1VSNA 5CHVA 1EWOA 3HHIA 1ZIVA 4K7CA 3TNXA 6PADA 1Y4HA 3IMAA 3KX1A 1CS8A 1MEGA 3MTVA 1MEMA 1X9YA 3BB7A 4MZSA 4XR7A 2NQGA 3PDFA 1VJVA 1PVJA 2YJ9A 1U9VA 4YYVA 3PBHA 4A5UA 1IWDA 3W30A 3MHHA 1PIPA 4N4ZA 2YJ2A 3ERVA 1PPOA 1U9WA 3ZUAA 3OVZA 4PP1A 3P5WA 2XU1A 3CH3X 3DF0A 2AVWA 4YYSA 2XU4A 1F2CA 4YVAA 5J94A 1EWPA 4BS5A 4IP3A 2PADA 4OVZA 1CV8A 1CB5A 4QRGA 2R9OA 1DEUA 1QXPA 3IV2A 4BOZA 4PI3A 3BOWA 2NQDB 4IUMA 4FIPA 1EWLA 1FH0A 3PHXA 3PW3A 1F29A 4XUIA 3H6SA 2R9MA 3P5VA 3NHEA 2B1MA 3K8UA 3USVA 1KHPA 1NLJA 3QT4A 1MS6A 2IBIA 4R3DA 3PSEA 1ZCMA 2DCCA 2CB5A 2G6DA 2FT2A 5CHTA 4MZOA 4PADA 4D8IA 3B21A 4Q8HA 4AXLA 1AYWA 3W31A 4REZA 2GFOA 2HXZA 1U9XA 2AS8A 1S4VA 2IPPB 1M6DA 2WBFX 2AUZA 3F75A 2BTWB 3QJ3A 5CVOB 3HWNA 4RF1A 3AI8A 4OW0A 1ITOA 1CTEA 3F5VA 1AU4A 3RVVA 3OF8A 1QDQA 1TL9A 1KFXL 1THEA 5FPWA 2AGAA 2FQ9A 4BOQA 2E02A 1MDWA 2ARYA 3H8BA 3B79A 5JZEA 5CVNB 2G8JA 3H89A 2HHNA 2P86A 2F1GA 4I04A 3HD3A 2AYNA 3WXEA 2C0YA 4Q8GA 4RF0A 3RNVA 4WA6A 4QBBA 2E00A 1CVZA 4YV8A 4D8BA 3OQCA 4G54A 4HWYA 2E01A 3PT2A 3IEJA 2OP3A 2Y5BA 3KFQA 1MIRA 2HH5A 2HWKA 2DZZA 4XZXA 4YYQA 1PPPA 1TU6A 1GECE 3IFUA 3S3QA 3PHUA 1O0EA 3GCBA 3BC3A 2E03A 4WURA 4RKXA 2AYOA 1PPNA 4FJCA 3ZNHA 3H8CA 3E9SA 4N8WA 1GLOA 3U8EA 3LFYA 1BQIA 4ZUXU 3O65A 2DC9A 2FYEA 5PADA 1NL6A 3WXFA 4CZWA 3RVXA 7PCKA 3S3RA 3V6CA 2BTWA 4KLBA 1PCIA 3IOQA 4I05A 2FUDA 2BDLA 2R9NA 1ME3A 1PPDA 3OVXA 4I07A 2G8EA 4YYWA 1F2BA 1DF0A 4BQVA 1CPJA 1A6RA 2AIMA 1PE6A 2J7QC 1U9QX 5E6JA 1BP4A 1QOLA 1KXRA 1F2AA 2CIOA 1BY8A 3I3TA 3BCNA 5KO3A 2JRIA 1YZBA 1AU3A 2XU3A 2FE8A 4X6JA 3E1ZB 2BU3A 4YYUA 4QRVA 1DKIA 1GCBA 1KHQA 1QMYA 3V6EA 4AXMA 1GMYA 1AIMA 2BDZA 1STFE 2DJFB 2YJCA 2R9FA 5EZQA 3H7DA 2J7QA 3BBAA 4HXDB 4D8EA 1POPA 4PP2E 5JH3A 3CBJA 4MM3B 3KW9A 3PRPA 3QSDA 3MP2A 4ZTBA 3N3GA 2O6XA 1ME4A 2YJBA 2XU5A 3BPMA 5K16A 1YVBA 3C0RA 5JA7A 1AU0A 1BGOA 1TLOA 2OULA 3K24A 2AUXA 1YK7A 4BOUA 4QH6A 3K9MA 3MTNA 1MHWA 3N4CA 4QRXA 2PREA 2JTCA 4N79A 4DMXA 2YJ8A
chains in the Genus database with same CATH topology
3KKUA 1XKGA 3I06A 2NQIA 2PBHA 3KWBX 5F02A 2FO5A 4W5CA 2P0RA 4X6IA 3P5UA 1AYVA 4BSQA 3N3KA 3RVWA 2DZYA 3IHPA 4BGFA 2DCDA 3CH2X 1CJLA 3OF9A 3KSEA 1NQCA 3LTWA 1PBHA 2B1NA 3MHSA 1ATKA 4OEMA 5EGWA 1ICFA 4RY2A 1HUCB 1EF7A 2JQFR 1SNKA 2P7UA 4X6HA 4YYRA 4P6EA 2AU1A 2GHUA 5EF4A 1NB3A 1PXVA 1KFUL 1U5IA 1GX3A 4W4UA 1AECA 5CVMA 1CQDA 3MORA 3O1GA 4BS6A 2HD5A 3CBKA 1NPZA 2ACTA 3BPFA 3D6SA 1PADA 1W5RA 1Y08A 2DCAA 2DJGB 3LXSA 3P5XA 1K3BB 1YALA 1YK8A 2DC8A 2FRQA 4OELA 1AYUA 4CDFB 3M99A 2PNSA 4BPVA 2JQGR 1JQPA 3BWKA 2F7DA 2DCBA 2R9CA 2R6NA 2VHSA 2G7YA 1YT7A 8PCHA 2DC6A 2FRAA 4CDCB 3OISA 4P6GA 3C9EA 3HHAA 3WXGA 4CDDB 5A24A 2FTDA 1Q6KA 2OZ2A 2VHFA 1CSBB 3KWZA 9PAPA 1NB5A 1EWMA 2Y6EA 3O0UA 4W5BA 4DMYA 4CDEB 1AU2A 3PNRA 1W6FA 4FK5A 2H7JA 4B55A 2NQAA 4GUZA 2ATOA 3IUTA 1SP4B 2DC7A 4MSXA 1VSNA 5CHVA 1EWOA 3HHIA 1ZIVA 4K7CA 3TNXA 6PADA 1Y4HA 3IMAA 1CS8A 3KX1A 1MEGA 1MEMA 1X9YA 4MZSA 4XR7A 2NQGA 3PDFA 1VJVA 2YJ9A 1U9VA 4YYVA 3PBHA 1IWDA 3MHHA 1PIPA 4N4ZA 2YJ2A 3ERVA 1PPOA 1U9WA 3ZUAA 3OVZA 4PP1A 3P5WA 2XU1A 3CH3X 3DF0A 2AVWA 4YYSA 2XU4A 1F2CA 4YVAA 4NV8A 5J94A 1EWPA 4BS5A 2PADA 1CV8A 1CB5A 4QRGA 2R9OA 1DEUA 1QXPA 3IV2A 4PI3A 3BOWA 2NQDB 4FIPA 1EWLA 1FH0A 3PW3A 1F29A 4XUIA 3H6SA 2R9MA 3P5VA 3NHEA 2B1MA 3K8UA 3USVA 1KHPA 1NLJA 4C5PA 3QT4A 1MS6A 2IBIA 1ZCMA 2DCCA 2CB5A 2G6DA 2FT2A 5CHTA 4MZOA 4PADA 4Q8HA 4AXLA 1AYWA 2GFOA 2HXZA 1U9XA 2AS8A 1S4VA 2IPPB 1M6DA 2WBFX 2AUZA 3F75A 3QJ3A 5CVOB 3HWNA 3AI8A 1ITOA 1E2TA 1CTEA 3F5VA 1AU4A 3RVVA 3OF8A 1QDQA 1TL9A 1KFXL 1THEA 5FPWA 2FQ9A 2E02A 1MDWA 2ARYA 3H8BA 3B79A 5CVNB 2G8JA 3H89A 2HHNA 2P86A 2F1GA 4I04A 3D9WA 3HD3A 2AYNA 3WXEA 2C0YA 4Q8GA 4WA6A 4QBBA 2E00A 1CVZA 4YV8A 1W4TA 4G54A 4HWYA 2E01A 3IEJA 2OP3A 2Y5BA 3KFQA 1MIRA 2HH5A 2DZZA 4YYQA 1PPPA 1TU6A 1GECE 3S3QA 1O0EA 3GCBA 3BC3A 2E03A 2AYOA 1PPNA 2VFCA 4FJCA 3H8CA 4N8WA 1GLOA 3U8EA 3LFYA 1BQIA 4ZUXU 2DC9A 2FYEA 5PADA 1NL6A 3WXFA 4CZWA 3RVXA 7PCKA 3S3RA 3V6CA 4KLBA 1PCIA 4NV7A 3IOQA 4I05A 2FUDA 2BDLA 2R9NA 1ME3A 1PPDA 3OVXA 4I07A 2G8EA 4YYWA 1F2BA 1DF0A 4BQVA 1CPJA 1A6RA 2AIMA 1PE6A 1U9QX 1BP4A 1QOLA 1KXRA 1F2AA 2CIOA 1BY8A 3I3TA 3BCNA 1AU3A 2XU3A 4X6JA 3E1ZB 2VFBA 4YYUA 4QRVA 1GCBA 1KHQA 1QMYA 3V6EA 4AXMA 1GMYA 1AIMA 2BSZA 2BDZA 1STFE 2DJFB 2YJCA 2R9FA 3H7DA 1POPA 4PP2E 5JH3A 3CBJA 3KW9A 3QSDA 3N3GA 2O6XA 1ME4A 2YJBA 2XU5A 3BPMA 5K16A 1YVBA 5JA7A 1AU0A 1BGOA 1TLOA 2OULA 3K24A 2AUXA 1YK7A 4QH6A 3K9MA 3MTNA 1MHWA 3N4CA 4QRXA 2PREA 4N79A 4DMXA 2YJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKU A;  1XKG A;  3I06 A;  2NQI A;  2PBH A;  3KWB X;  5F02 A;  2FO5 A;  4W5C A;  2P0R A;  4X6I A;  3P5U A;  1AYV A;  4BSQ A;  3N3K A;  3RVW A;  2DZY A;  3IHP A;  2DCD A;  3CH2 X;  1CJL A;  3OF9 A;  3KSE A;  1NQC A;  1PBH A;  2B1N A;  3MHS A;  1ATK A;  4OEM A;  5EGW A;  1ICF A;  4RY2 A;  1HUC B;  1EF7 A;  2JQF R;  1SNK A;  2P7U A;  4X6H A;  4YYR A;  4P6E A;  2AU1 A;  2GHU A;  5EF4 A;  1NB3 A;  1PXV A;  1KFU L;  1U5I A;  4W4U A;  1AEC A;  5CVM A;  1CQD A;  3MOR A;  3O1G A;  4BS6 A;  2HD5 A;  3CBK A;  1NPZ A;  2ACT A;  3BPF A;  3D6S A;  1PAD A;  1Y08 A;  2DCA A;  2DJG B;  3LXS A;  3P5X A;  1K3B B;  1YAL A;  1YK8 A;  2DC8 A;  2FRQ A;  4OEL A;  1AYU A;  4CDF B;  3M99 A;  2PNS A;  4BPV A;  2JQG R;  1JQP A;  3BWK A;  2F7D A;  2DCB A;  2R9C A;  2R6N A;  2VHS A;  2G7Y A;  1YT7 A;  8PCH A;  2DC6 A;  2FRA A;  4CDC B;  3OIS A;  4P6G A;  3C9E A;  3HHA A;  3WXG A;  4CDD B;  5A24 A;  2FTD A;  1Q6K A;  2OZ2 A;  2VHF A;  1CSB B;  3KWZ A;  9PAP A;  1NB5 A;  1EWM A;  2Y6E A;  3O0U A;  4W5B A;  4DMY A;  4CDE B;  1AU2 A;  3PNR A;  4FK5 A;  2H7J A;  2NQA A;  2ATO A;  3IUT A;  1SP4 B;  2DC7 A;  4MSX A;  1VSN A;  5CHV A;  1EWO A;  3HHI A;  1ZIV A;  3TNX A;  4K7C A;  6PAD A;  1Y4H A;  3IMA A;  1CS8 A;  3KX1 A;  1MEG A;  1MEM A;  1X9Y A;  4MZS A;  4XR7 A;  2NQG A;  3PDF A;  1VJV A;  2YJ9 A;  1U9V A;  4YYV A;  3PBH A;  1IWD A;  3MHH A;  1PIP A;  4N4Z A;  2YJ2 A;  3ERV A;  1PPO A;  1U9W A;  3ZUA A;  3OVZ A;  4PP1 A;  3P5W A;  2XU1 A;  3CH3 X;  3DF0 A;  2AVW A;  4YYS A;  2XU4 A;  1F2C A;  4YVA A;  5J94 A;  1EWP A;  4BS5 A;  2PAD A;  1CV8 A;  1CB5 A;  4QRG A;  2R9O A;  1DEU A;  1QXP A;  3IV2 A;  4PI3 A;  3BOW A;  2NQD B;  4FIP A;  1EWL A;  1FH0 A;  3PW3 A;  1F29 A;  4XUI A;  3H6S A;  2R9M A;  3P5V A;  3NHE A;  2B1M A;  3K8U A;  3USV A;  1KHP A;  1NLJ A;  3QT4 A;  1MS6 A;  2IBI A;  1ZCM A;  2DCC A;  2CB5 A;  2G6D A;  2FT2 A;  5CHT A;  4MZO A;  4PAD A;  4Q8H A;  4AXL A;  1AYW A;  2GFO A;  2HXZ A;  1U9X A;  2AS8 A;  1S4V A;  2IPP B;  1M6D A;  2WBF X;  2AUZ A;  3F75 A;  3QJ3 A;  5CVO B;  3HWN A;  3AI8 A;  1ITO A;  1CTE A;  3F5V A;  1AU4 A;  3RVV A;  3OF8 A;  1QDQ A;  1TL9 A;  1KFX L;  1THE A;  5FPW A;  2FQ9 A;  2E02 A;  1MDW A;  2ARY A;  3H8B A;  3B79 A;  5CVN B;  2G8J A;  3H89 A;  2HHN A;  2P86 A;  2F1G A;  4I04 A;  3HD3 A;  2AYN A;  3WXE A;  2C0Y A;  4Q8G A;  4WA6 A;  4QBB A;  2E00 A;  1CVZ A;  4YV8 A;  4G54 A;  4HWY A;  2E01 A;  3IEJ A;  2OP3 A;  2Y5B A;  3KFQ A;  1MIR A;  2HH5 A;  2DZZ A;  4YYQ A;  1PPP A;  1TU6 A;  1GEC E;  3S3Q A;  1O0E A;  3GCB A;  3BC3 A;  2E03 A;  2AYO A;  1PPN A;  4FJC A;  3H8C A;  4N8W A;  1GLO A;  3U8E A;  3LFY A;  1BQI A;  4ZUX U;  2DC9 A;  2FYE A;  5PAD A;  1NL6 A;  3WXF A;  4CZW A;  3RVX A;  7PCK A;  3S3R A;  3V6C A;  4KLB A;  1PCI A;  3IOQ A;  4I05 A;  2FUD A;  2BDL A;  2R9N A;  1ME3 A;  1PPD A;  3OVX A;  4I07 A;  2G8E A;  4YYW A;  1F2B A;  1DF0 A;  4BQV A;  1CPJ A;  1A6R A;  2AIM A;  1PE6 A;  1U9Q X;  1BP4 A;  1QOL A;  1KXR A;  1F2A A;  2CIO A;  1BY8 A;  3I3T A;  3BCN A;  1AU3 A;  2XU3 A;  4X6J A;  3E1Z B;  4YYU A;  4QRV A;  1GCB A;  1KHQ A;  1QMY A;  3V6E A;  4AXM A;  1GMY A;  1AIM A;  2BDZ A;  1STF E;  2DJF B;  2YJC A;  2R9F A;  3H7D A;  1POP A;  4PP2 E;  5JH3 A;  3CBJ A;  3KW9 A;  3QSD A;  3N3G A;  2O6X A;  1ME4 A;  2YJB A;  2XU5 A;  3BPM A;  5K16 A;  1YVB A;  5JA7 A;  1AU0 A;  1BGO A;  1TLO A;  2OUL A;  3K24 A;  2AUX A;  1YK7 A;  4QH6 A;  3K9M A;  3MTN A;  1MHW A;  3N4C A;  4QRX A;  2PRE A;  4N79 A;  4DMX A;  2YJ8 A; 
#chains in the Genus database with same CATH topology
 3KKU A;  1XKG A;  3I06 A;  2NQI A;  2PBH A;  3KWB X;  3PRM A;  5F02 A;  2FO5 A;  4W5C A;  2P0R A;  4X6I A;  4OVZ B;  3P5U A;  1AYV A;  4BSQ A;  3TMP A;  3N3K A;  4GUA A;  3RVW A;  2DZY A;  3IHP A;  2DCD A;  3CH2 X;  1CJL A;  3OF9 A;  3KSE A;  1NQC A;  1PBH A;  4PT5 A;  2B1N A;  3MHS A;  1ATK A;  4OEM A;  5EGW A;  3BY4 A;  1ICF A;  4RY2 A;  1HUC B;  1EF7 A;  2JQF R;  1SNK A;  2P7U A;  4X6H A;  4YYR A;  1UKF A;  4P6E A;  2AU1 A;  2GHU A;  5EF4 A;  4BOS A;  1NB3 A;  1PXV A;  1KFU L;  1U5I A;  4W4U A;  1AEC A;  5CVM A;  1CQD A;  3MOR A;  3O1G A;  3TRK A;  4BS6 A;  2HD5 A;  3CBK A;  1NPZ A;  2ACT A;  3BPF A;  3D6S A;  1PAD A;  1Y08 A;  2DCA A;  2DJG B;  2UZJ A;  3LXS A;  3P5X A;  1K3B B;  1YAL A;  1YK8 A;  2DC8 A;  2FRQ A;  4OEL A;  1AYU A;  4CDF B;  3M99 A;  2PNS A;  3MJ5 A;  4BPV A;  4M0W A;  4RNA A;  2JQG R;  1JQP A;  3BWK A;  2F7D A;  2DCB A;  2R9C A;  2R6N A;  2VHS A;  2G7Y A;  2Z84 A;  1YT7 A;  8PCH A;  2DC6 A;  2FRA A;  4P16 A;  4CDC B;  3OIS A;  4P6G A;  3C9E A;  3HHA A;  3WXG A;  4CDD B;  3PHW A;  5A24 A;  2FTD A;  1Q6K A;  2OZ2 A;  2VHF A;  1CSB B;  3KWZ A;  5EZS A;  9PAP A;  1NB5 A;  1EWM A;  2Y6E A;  3O0U A;  4W5B A;  4DMY A;  4MI7 A;  4CDE B;  1AU2 A;  3PNR A;  4FK5 A;  2DOS A;  2H7J A;  2NQA A;  4BOP A;  2ATO A;  3IUT A;  1SP4 B;  2DC7 A;  4MSX A;  1VSN A;  5CHV A;  1EWO A;  3HHI A;  1ZIV A;  4K7C A;  3TNX A;  6PAD A;  1Y4H A;  3IMA A;  3KX1 A;  1CS8 A;  1MEG A;  3MTV A;  1MEM A;  1X9Y A;  3BB7 A;  4MZS A;  4XR7 A;  2NQG A;  3PDF A;  1VJV A;  1PVJ A;  2YJ9 A;  1U9V A;  4YYV A;  3PBH A;  4A5U A;  1IWD A;  3W30 A;  3MHH A;  1PIP A;  4N4Z A;  2YJ2 A;  3ERV A;  1PPO A;  1U9W A;  3ZUA A;  3OVZ A;  4PP1 A;  3P5W A;  2XU1 A;  3CH3 X;  3DF0 A;  2AVW A;  4YYS A;  2XU4 A;  1F2C A;  4YVA A;  5J94 A;  1EWP A;  4BS5 A;  4IP3 A;  2PAD A;  4OVZ A;  1CV8 A;  1CB5 A;  4QRG A;  2R9O A;  1DEU A;  1QXP A;  3IV2 A;  4BOZ A;  4PI3 A;  3BOW A;  2NQD B;  4IUM A;  4FIP A;  1EWL A;  1FH0 A;  3PHX A;  3PW3 A;  1F29 A;  4XUI A;  3H6S A;  2R9M A;  3P5V A;  3NHE A;  2B1M A;  3K8U A;  3USV A;  1KHP A;  1NLJ A;  3QT4 A;  1MS6 A;  2IBI A;  4R3D A;  3PSE A;  1ZCM A;  2DCC A;  2CB5 A;  2G6D A;  2FT2 A;  5CHT A;  4MZO A;  4PAD A;  4D8I A;  3B21 A;  4Q8H A;  4AXL A;  1AYW A;  3W31 A;  4REZ A;  2GFO A;  2HXZ A;  1U9X A;  2AS8 A;  1S4V A;  2IPP B;  1M6D A;  2WBF X;  2AUZ A;  3F75 A;  2BTW B;  3QJ3 A;  5CVO B;  3HWN A;  4RF1 A;  3AI8 A;  4OW0 A;  1ITO A;  1CTE A;  3F5V A;  1AU4 A;  3RVV A;  3OF8 A;  1QDQ A;  1TL9 A;  1KFX L;  1THE A;  5FPW A;  2AGA A;  2FQ9 A;  4BOQ A;  2E02 A;  1MDW A;  2ARY A;  3H8B A;  3B79 A;  5JZE A;  5CVN B;  2G8J A;  3H89 A;  2HHN A;  2P86 A;  2F1G A;  4I04 A;  3HD3 A;  2AYN A;  3WXE A;  2C0Y A;  4Q8G A;  4RF0 A;  3RNV A;  4WA6 A;  4QBB A;  2E00 A;  1CVZ A;  4YV8 A;  4D8B A;  3OQC A;  4G54 A;  4HWY A;  2E01 A;  3PT2 A;  3IEJ A;  2OP3 A;  2Y5B A;  3KFQ A;  1MIR A;  2HH5 A;  2HWK A;  2DZZ A;  4XZX A;  4YYQ A;  1PPP A;  1TU6 A;  1GEC E;  3IFU A;  3S3Q A;  3PHU A;  1O0E A;  3GCB A;  3BC3 A;  2E03 A;  4WUR A;  4RKX A;  2AYO A;  1PPN A;  4FJC A;  3ZNH A;  3H8C A;  3E9S A;  4N8W A;  1GLO A;  3U8E A;  3LFY A;  1BQI A;  4ZUX U;  3O65 A;  2DC9 A;  2FYE A;  5PAD A;  1NL6 A;  3WXF A;  4CZW A;  3RVX A;  7PCK A;  3S3R A;  3V6C A;  2BTW A;  4KLB A;  1PCI A;  3IOQ A;  4I05 A;  2FUD A;  2BDL A;  2R9N A;  1ME3 A;  1PPD A;  3OVX A;  4I07 A;  2G8E A;  4YYW A;  1F2B A;  1DF0 A;  4BQV A;  1CPJ A;  1A6R A;  2AIM A;  1PE6 A;  2J7Q C;  1U9Q X;  5E6J A;  1BP4 A;  1QOL A;  1KXR A;  1F2A A;  2CIO A;  1BY8 A;  3I3T A;  3BCN A;  5KO3 A;  2JRI A;  1YZB A;  1AU3 A;  2XU3 A;  2FE8 A;  4X6J A;  3E1Z B;  2BU3 A;  4YYU A;  4QRV A;  1DKI A;  1GCB A;  1KHQ A;  1QMY A;  3V6E A;  4AXM A;  1GMY A;  1AIM A;  2BDZ A;  1STF E;  2DJF B;  2YJC A;  2R9F A;  5EZQ A;  3H7D A;  2J7Q A;  3BBA A;  4HXD B;  4D8E A;  1POP A;  4PP2 E;  5JH3 A;  3CBJ A;  4MM3 B;  3KW9 A;  3PRP A;  3QSD A;  3MP2 A;  4ZTB A;  3N3G A;  2O6X A;  1ME4 A;  2YJB A;  2XU5 A;  3BPM A;  5K16 A;  1YVB A;  3C0R A;  5JA7 A;  1AU0 A;  1BGO A;  1TLO A;  2OUL A;  3K24 A;  2AUX A;  1YK7 A;  4BOU A;  4QH6 A;  3K9M A;  3MTN A;  1MHW A;  3N4C A;  4QRX A;  2PRE A;  2JTC A;  4N79 A;  4DMX A;  2YJ8 A; 
#chains in the Genus database with same CATH homology
 3KKU A;  1XKG A;  3I06 A;  2NQI A;  2PBH A;  3KWB X;  5F02 A;  2FO5 A;  4W5C A;  2P0R A;  4X6I A;  3P5U A;  1AYV A;  4BSQ A;  3N3K A;  3RVW A;  2DZY A;  3IHP A;  4BGF A;  2DCD A;  3CH2 X;  1CJL A;  3OF9 A;  3KSE A;  1NQC A;  3LTW A;  1PBH A;  2B1N A;  3MHS A;  1ATK A;  4OEM A;  5EGW A;  1ICF A;  4RY2 A;  1HUC B;  1EF7 A;  2JQF R;  1SNK A;  2P7U A;  4X6H A;  4YYR A;  4P6E A;  2AU1 A;  2GHU A;  5EF4 A;  1NB3 A;  1PXV A;  1KFU L;  1U5I A;  1GX3 A;  4W4U A;  1AEC A;  5CVM A;  1CQD A;  3MOR A;  3O1G A;  4BS6 A;  2HD5 A;  3CBK A;  1NPZ A;  2ACT A;  3BPF A;  3D6S A;  1PAD A;  1W5R A;  1Y08 A;  2DCA A;  2DJG B;  3LXS A;  3P5X A;  1K3B B;  1YAL A;  1YK8 A;  2DC8 A;  2FRQ A;  4OEL A;  1AYU A;  4CDF B;  3M99 A;  2PNS A;  4BPV A;  2JQG R;  1JQP A;  3BWK A;  2F7D A;  2DCB A;  2R9C A;  2R6N A;  2VHS A;  2G7Y A;  1YT7 A;  8PCH A;  2DC6 A;  2FRA A;  4CDC B;  3OIS A;  4P6G A;  3C9E A;  3HHA A;  3WXG A;  4CDD B;  5A24 A;  2FTD A;  1Q6K A;  2OZ2 A;  2VHF A;  1CSB B;  3KWZ A;  9PAP A;  1NB5 A;  1EWM A;  2Y6E A;  3O0U A;  4W5B A;  4DMY A;  4CDE B;  1AU2 A;  3PNR A;  1W6F A;  4FK5 A;  2H7J A;  4B55 A;  2NQA A;  4GUZ A;  2ATO A;  3IUT A;  1SP4 B;  2DC7 A;  4MSX A;  1VSN A;  5CHV A;  1EWO A;  3HHI A;  1ZIV A;  4K7C A;  3TNX A;  6PAD A;  1Y4H A;  3IMA A;  1CS8 A;  3KX1 A;  1MEG A;  1MEM A;  1X9Y A;  4MZS A;  4XR7 A;  2NQG A;  3PDF A;  1VJV A;  2YJ9 A;  1U9V A;  4YYV A;  3PBH A;  1IWD A;  3MHH A;  1PIP A;  4N4Z A;  2YJ2 A;  3ERV A;  1PPO A;  1U9W A;  3ZUA A;  3OVZ A;  4PP1 A;  3P5W A;  2XU1 A;  3CH3 X;  3DF0 A;  2AVW A;  4YYS A;  2XU4 A;  1F2C A;  4YVA A;  4NV8 A;  5J94 A;  1EWP A;  4BS5 A;  2PAD A;  1CV8 A;  1CB5 A;  4QRG A;  2R9O A;  1DEU A;  1QXP A;  3IV2 A;  4PI3 A;  3BOW A;  2NQD B;  4FIP A;  1EWL A;  1FH0 A;  3PW3 A;  1F29 A;  4XUI A;  3H6S A;  2R9M A;  3P5V A;  3NHE A;  2B1M A;  3K8U A;  3USV A;  1KHP A;  1NLJ A;  4C5P A;  3QT4 A;  1MS6 A;  2IBI A;  1ZCM A;  2DCC A;  2CB5 A;  2G6D A;  2FT2 A;  5CHT A;  4MZO A;  4PAD A;  4Q8H A;  4AXL A;  1AYW A;  2GFO A;  2HXZ A;  1U9X A;  2AS8 A;  1S4V A;  2IPP B;  1M6D A;  2WBF X;  2AUZ A;  3F75 A;  3QJ3 A;  5CVO B;  3HWN A;  3AI8 A;  1ITO A;  1E2T A;  1CTE A;  3F5V A;  1AU4 A;  3RVV A;  3OF8 A;  1QDQ A;  1TL9 A;  1KFX L;  1THE A;  5FPW A;  2FQ9 A;  2E02 A;  1MDW A;  2ARY A;  3H8B A;  3B79 A;  5CVN B;  2G8J A;  3H89 A;  2HHN A;  2P86 A;  2F1G A;  4I04 A;  3D9W A;  3HD3 A;  2AYN A;  3WXE A;  2C0Y A;  4Q8G A;  4WA6 A;  4QBB A;  2E00 A;  1CVZ A;  4YV8 A;  1W4T A;  4G54 A;  4HWY A;  2E01 A;  3IEJ A;  2OP3 A;  2Y5B A;  3KFQ A;  1MIR A;  2HH5 A;  2DZZ A;  4YYQ A;  1PPP A;  1TU6 A;  1GEC E;  3S3Q A;  1O0E A;  3GCB A;  3BC3 A;  2E03 A;  2AYO A;  1PPN A;  2VFC A;  4FJC A;  3H8C A;  4N8W A;  1GLO A;  3U8E A;  3LFY A;  1BQI A;  4ZUX U;  2DC9 A;  2FYE A;  5PAD A;  1NL6 A;  3WXF A;  4CZW A;  3RVX A;  7PCK A;  3S3R A;  3V6C A;  4KLB A;  1PCI A;  4NV7 A;  3IOQ A;  4I05 A;  2FUD A;  2BDL A;  2R9N A;  1ME3 A;  1PPD A;  3OVX A;  4I07 A;  2G8E A;  4YYW A;  1F2B A;  1DF0 A;  4BQV A;  1CPJ A;  1A6R A;  2AIM A;  1PE6 A;  1U9Q X;  1BP4 A;  1QOL A;  1KXR A;  1F2A A;  2CIO A;  1BY8 A;  3I3T A;  3BCN A;  1AU3 A;  2XU3 A;  4X6J A;  3E1Z B;  2VFB A;  4YYU A;  4QRV A;  1GCB A;  1KHQ A;  1QMY A;  3V6E A;  4AXM A;  1GMY A;  1AIM A;  2BSZ A;  2BDZ A;  1STF E;  2DJF B;  2YJC A;  2R9F A;  3H7D A;  1POP A;  4PP2 E;  5JH3 A;  3CBJ A;  3KW9 A;  3QSD A;  3N3G A;  2O6X A;  1ME4 A;  2YJB A;  2XU5 A;  3BPM A;  5K16 A;  1YVB A;  5JA7 A;  1AU0 A;  1BGO A;  1TLO A;  2OUL A;  3K24 A;  2AUX A;  1YK7 A;  4QH6 A;  3K9M A;  3MTN A;  1MHW A;  3N4C A;  4QRX A;  2PRE A;  4N79 A;  4DMX A;  2YJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...