3WXGA

Crystal structure of cyld usp domain (c596a) in complex with lys63-linked diubiquitin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
300
Chain Sequence
MGLEVMVGKKKGIQGHYNSAYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
molecule keywords Uncharacterized protein
total genus 83
structure length 300
sequence length 309
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxgA00
2AUZA 1QMYA 1KFXL 1ZCMA 1PADA 2P86A 3OVZA 4X6IA 1AU3A 3KKUA 2H7JA 3N4CA 1CSBB 3V6CA 3F5VA 2ARYA 3WXFA 4G54A 2BDLA 1FH0A 3BOWA 1PE6A 2R9MA 3MHHA 1AU0A 4PP1A 1GCBA 2YJ2A 3WXEA 2NQAA 1YALA 2G6DA 2PREA 3ZUAA 2VHFA 4CDDB 3MORA 4W5BA 1NLJA 1AYWA 2B1MA 3CH2X 5CVMA 1S4VA 4YVAA 2B1NA 2ACTA 1EWOA 4P6GA 1BQIA 4BPVA 2WBFX 4KLBA 4YYWA 3H8CA 1U9VA 3H89A 1CS8A 3E1ZB 5JA7A 4CDCB 3KX1A 5EGWA 2OP3A 2AYOA 1NQCA 5CHTA 1A6RA 1F2AA 2AIMA 1HUCB 2R9FA 2DC6A 4CDFB 2GHUA 5FPWA 2DC9A 1QXPA 2AYNA 1ICFA 1F29A 5F02A 6PADA 1CVZA 4QRXA 4W5CA 1PIPA 3O0UA 3CBKA 1BGOA 3I06A 2F1GA 3BC3A 4YYUA 1AECA 2P7UA 1MEMA 2NQDB 2YJBA 9PAPA 1NL6A 3IEJA 1ME3A 3H8BA 3CBJA 5A24A 1ZIVA 3DF0A 4WA6A 5CVOB 4N4ZA 1U9XA 2NQGA 1KHPA 2BDZA 1YK8A 3PDFA 4MSXA 2F7DA 3LXSA 3OF9A 2FT2A 1EF7A 3PW3A 4MZOA 1PPDA 1TL9A 4AXLA 2R6NA 1EWPA 2HH5A 4YYVA 1PPNA 3BPMA 3I3TA 4YYQA 2FTDA 2G8JA 3KWBX 2E02A 2Y5BA 3USVA 2P0RA 2HD5A 3IHPA 1POPA 3HD3A 1F2BA 3BWKA 3NHEA 4YYSA 1TLOA 3IMAA 1YK7A 4FK5A 3MHSA 2DCAA 1F2CA 2E03A 3KSEA 4I05A 4HWYA 2O6XA 5J94A 3P5WA 2FYEA 1IWDA 1PPOA 3KW9A 4PADA 2G7YA 2PNSA 4DMXA 1VJVA 2PBHA 1PXVA 4YV8A 1CPJA 3K24A 3KFQA 2AUXA 2DZYA 1KFUL 1XKGA 4BQVA 1GMYA 1NB5A 2FQ9A 2E01A 1NPZA 8PCHA 2R9OA 1CQDA 3P5VA 2OULA 2FRAA 1M6DA 3V6EA 2ATOA 2Y6EA 4OEMA 5JH3A 4W4UA 1GLOA 3F75A 1CTEA 2IBIA 1AYVA 1CV8A 1TU6A 2XU4A 2R9CA 4P6EA 2JQGR 2AU1A 3M99A 4YYRA 1DF0A 2HXZA 1MHWA 3TNXA 4MZSA 3CH3X 4I07A 1MDWA 2AVWA 3LFYA 4QBBA 4ZUXU 4FJCA 3N3GA 2DJGB 4FIPA 1SP4B 3U8EA 1Q6KA 3ERVA 2CIOA 3RVVA 2DCCA 1JQPA 4N8WA 3WXGA 4X6HA 3QSDA 4QRGA 1GECE 5EF4A 3C9EA 4QH6A 1U9QX 2PADA 7PCKA 1YT7A 3PNRA 2DZZA 1VSNA 3KWZA 1O0EA 2FO5A 2R9NA 3HHIA 1PPPA 1Y4HA 4OELA 2XU1A 2CB5A 3OF8A 3IUTA 1X9YA 3B79A 4N79A 3H6SA 2JQFR 2HHNA 2C0YA 3H7DA 3QJ3A 1NB3A 3IOQA 2G8EA 3OVXA 4XUIA 1KHQA 1STFE 1QOLA 2XU5A 3K8UA 2YJ9A 3IV2A 2YJ8A 5K16A 3HWNA 1AIMA 4DMYA 3BPFA 3HHAA 5CVNB 1EWMA 3RVXA 1KXRA 1PCIA 1ITOA 3S3RA 1THEA 1Y08A 3K9MA 1U9WA 1ME4A 1BP4A 1AU2A 1DEUA 2NQIA 1SNKA 3S3QA 4X6JA 4BS5A 1MS6A 3D6SA 2OZ2A 1K3BB 4Q8GA 4CDEB 3AI8A 3P5XA 1AYUA 4AXMA 2FUDA 4Q8HA 2AS8A 1BY8A 3MTNA 1ATKA 1CB5A 5PADA 4XR7A 3O1GA 3GCBA 4BSQA 3PBHA 2DC8A 3BCNA 4K7CA 4RY2A 2XU3A 1MEGA 2E00A 2DC7A 2DCBA 3N3KA 1U5IA 4PI3A 3QT4A 3RVWA 4CZWA 1EWLA 1MIRA 2YJCA 1QDQA 4QRVA 3P5UA 1PBHA 2DCDA 1AU4A 1YVBA 2IPPB 4I04A 4BS6A 2GFOA 2VHSA 4PP2E 2FRQA 3OISA 2DJFB 5CHVA 1CJLA
chains in the Genus database with same CATH superfamily
2J7QA 2AUZA 1QMYA 3MJ5A 1KFXL 1ZCMA 1PADA 2P86A 3OVZA 4X6IA 1AU3A 3KKUA 2H7JA 3N4CA 1CSBB 3V6CA 3F5VA 2ARYA 3WXFA 4G54A 2BDLA 1FH0A 2JRIA 3BOWA 1PE6A 2R9MA 3MHHA 1AU0A 4PP1A 1GCBA 2YJ2A 3WXEA 2NQAA 1YALA 2G6DA 4RNAA 2PREA 3ZUAA 2VHFA 4CDDB 3MORA 3TRKA 4W5BA 4PT5A 1NLJA 1AYWA 2B1MA 3CH2X 5CVMA 1S4VA 4YVAA 4BOZA 3PHXA 2B1NA 2ACTA 1EWOA 4P6GA 1BQIA 4BPVA 2WBFX 4KLBA 4BOQA 1YZBA 3H8CA 4YYWA 1U9VA 2BTWA 3H89A 4BOSA 4D8IA 1CS8A 3BB7A 3E1ZB 5JA7A 4CDCB 3KX1A 3PRMA 5EGWA 2OP3A 3BY4A 2AYOA 1NQCA 5CHTA 1A6RA 1F2AA 3PRPA 2AIMA 1HUCB 2R9FA 2DC6A 2UZJA 2GHUA 5FPWA 4CDFB 2DC9A 1QXPA 2AYNA 1ICFA 1F29A 5F02A 6PADA 1CVZA 4QRXA 4REZA 4W5CA 1PIPA 3O0UA 3CBKA 1BGOA 1UKFA 3I06A 2F1GA 3BC3A 4YYUA 1AECA 2P7UA 3BBAA 1MEMA 1PVJA 2NQDB 2YJBA 4MI7A 9PAPA 1NL6A 3IEJA 1ME3A 3H8BA 3CBJA 5A24A 1ZIVA 3DF0A 3ZNHA 4WA6A 5CVOB 4HXDB 1DKIA 4N4ZA 1U9XA 2NQGA 4IP3A 1KHPA 2BDZA 1YK8A 3PDFA 4MSXA 2F7DA 3LXSA 3OF9A 2FT2A 1EF7A 3PW3A 4MZOA 5EZSA 1PPDA 1TL9A 4AXLA 2R6NA 4OW0A 1EWPA 2HH5A 4YYVA 1PPNA 3BPMA 3I3TA 4YYQA 2FTDA 2G8JA 3KWBX 2E02A 2Y5BA 3USVA 2P0RA 2HD5A 3IHPA 1POPA 3HD3A 3PHWA 4ZTBA 1F2BA 3BWKA 3NHEA 4BOPA 4YYSA 1TLOA 3IMAA 1YK7A 4FK5A 3MHSA 2DCAA 1F2CA 2E03A 3KSEA 4I05A 4HWYA 2O6XA 5J94A 3P5WA 2FYEA 1IWDA 1PPOA 3KW9A 4PADA 2G7YA 2PNSA 4DMXA 1VJVA 2PBHA 1PXVA 4YV8A 2FE8A 1CPJA 3K24A 3KFQA 2AUXA 2DZYA 1KFUL 4R3DA 1XKGA 4BQVA 1GMYA 1NB5A 2FQ9A 4RKXA 2E01A 1NPZA 8PCHA 2BU3A 2R9OA 1CQDA 3TMPA 3P5VA 2OULA 2FRAA 1M6DA 3V6EA 2ATOA 2Y6EA 5EZQA 4OEMA 3W30A 5JH3A 4W4UA 1GLOA 3F75A 3PHUA 1CTEA 2IBIA 1AYVA 4GUAA 2HWKA 4PP2E 3B21A 1CV8A 1TU6A 2JTCA 3MTVA 2XU4A 2R9CA 4P6EA 2JQGR 2J7QC 4XZXA 2AU1A 3M99A 4YYRA 1DF0A 2HXZA 1MHWA 3TNXA 4MZSA 3CH3X 4I07A 1MDWA 2AVWA 3LFYA 4QBBA 4ZUXU 4FJCA 3N3GA 2DJGB 4FIPA 1SP4B 3U8EA 1Q6KA 3ERVA 2AGAA 2CIOA 3RVVA 2DCCA 4RF0A 1JQPA 4N8WA 3WXGA 4X6HA 3QSDA 4QRGA 1GECE 2Z84A 5EF4A 3C9EA 4QH6A 4MM3B 1U9QX 4D8BA 2PADA 7PCKA 1YT7A 3PNRA 4WURA 1VSNA 3KWZA 1O0EA 2FO5A 2R9NA 3HHIA 1PPPA 1Y4HA 4OELA 2XU1A 2CB5A 3OF8A 3IUTA 1X9YA 4D8EA 5E6JA 3B79A 4N79A 3H6SA 2JQFR 2HHNA 2C0YA 3H7DA 3QJ3A 1NB3A 3IOQA 2BTWB 2G8EA 3OVXA 4XUIA 1KHQA 1STFE 1QOLA 2XU5A 3K8UA 2YJ9A 3IV2A 5KO3A 4BOUA 2YJ8A 5K16A 3HWNA 1AIMA 4DMYA 3BPFA 3HHAA 5CVNB 1EWMA 3E9SA 3RVXA 1KXRA 3C0RA 4M0WA 1PCIA 4RF1A 1ITOA 3O65A 3S3RA 1THEA 1Y08A 3K9MA 1U9WA 1ME4A 1BP4A 1AU2A 1DEUA 2NQIA 1SNKA 3OQCA 3S3QA 4X6JA 4BS5A 1MS6A 3D6SA 2OZ2A 1K3BB 4Q8GA 4CDEB 3AI8A 3P5XA 1AYUA 4AXMA 2FUDA 4Q8HA 2AS8A 1BY8A 4A5UA 3MTNA 1ATKA 1CB5A 5PADA 4XR7A 3O1GA 3GCBA 4BSQA 4OVZB 2DOSA 3PBHA 2DC8A 3BCNA 4K7CA 4RY2A 2XU3A 1MEGA 2E00A 3RNVA 4OVZA 2DC7A 2DCBA 3N3KA 1U5IA 4PI3A 3QT4A 3RVWA 4CZWA 1EWLA 1MIRA 2YJCA 1QDQA 4QRVA 3P5UA 1PBHA 3PSEA 2DCDA 1AU4A 3PT2A 4IUMA 3W31A 3MP2A 4P16A 1YVBA 3IFUA 2IPPB 4I04A 4BS6A 2GFOA 5JZEA 2VHSA 2DZZA 2FRQA 3OISA 2DJFB 5CHVA 1CJLA
chains in the Genus database with same CATH topology
2AUZA 1QMYA 1KFXL 1ZCMA 1PADA 2P86A 3D9WA 3OVZA 4X6IA 1AU3A 1W6FA 3KKUA 2H7JA 3N4CA 1CSBB 3V6CA 3F5VA 2ARYA 3WXFA 4G54A 2BDLA 1FH0A 3BOWA 1PE6A 2R9MA 3MHHA 1AU0A 4PP1A 1GCBA 2YJ2A 3WXEA 2NQAA 1YALA 2G6DA 2PREA 3ZUAA 2VHFA 4CDDB 3MORA 4W5BA 4B55A 1NLJA 1AYWA 2B1MA 3CH2X 5CVMA 1S4VA 4YVAA 1W4TA 2B1NA 2ACTA 1EWOA 4P6GA 1BQIA 4BPVA 2WBFX 4KLBA 4YYWA 3H8CA 1U9VA 3H89A 1CS8A 3E1ZB 5JA7A 4CDCB 3KX1A 5EGWA 2OP3A 2AYOA 1NQCA 5CHTA 1A6RA 1F2AA 2AIMA 1HUCB 2R9FA 2DC6A 4CDFB 2GHUA 5FPWA 2DC9A 1QXPA 2AYNA 1ICFA 1F29A 5F02A 6PADA 1CVZA 4QRXA 4W5CA 1PIPA 3O0UA 3CBKA 1BGOA 3I06A 2F1GA 3BC3A 4YYUA 1AECA 2P7UA 1MEMA 2NQDB 2YJBA 9PAPA 1NL6A 3IEJA 1ME3A 3H8BA 3CBJA 5A24A 1ZIVA 3DF0A 4WA6A 5CVOB 4N4ZA 1U9XA 2NQGA 4BGFA 1KHPA 2BDZA 1YK8A 3PDFA 4NV7A 4MSXA 2F7DA 3LXSA 3OF9A 2FT2A 1EF7A 3PW3A 4MZOA 1PPDA 1TL9A 4AXLA 2R6NA 1EWPA 2HH5A 4YYVA 1PPNA 3BPMA 3I3TA 4YYQA 2FTDA 2G8JA 3KWBX 2E02A 2Y5BA 3USVA 2P0RA 2HD5A 3IHPA 1POPA 3HD3A 1F2BA 3BWKA 3NHEA 4GUZA 4C5PA 1TLOA 4YYSA 3IMAA 1YK7A 4FK5A 3MHSA 2DCAA 1F2CA 2E03A 3KSEA 4I05A 4HWYA 2O6XA 5J94A 3P5WA 2FYEA 1IWDA 1PPOA 3KW9A 4PADA 2G7YA 2VFCA 2PNSA 4DMXA 1VJVA 2PBHA 1PXVA 4YV8A 1CPJA 3K24A 3KFQA 2AUXA 2DZYA 1KFUL 1XKGA 4BQVA 1GMYA 1NB5A 2FQ9A 2E01A 1NPZA 8PCHA 2R9OA 1CQDA 3P5VA 2OULA 2FRAA 1M6DA 3V6EA 2ATOA 2Y6EA 4OEMA 5JH3A 4W4UA 1GLOA 3F75A 1CTEA 2IBIA 1AYVA 1CV8A 1TU6A 2XU4A 2R9CA 4P6EA 4NV8A 2JQGR 2AU1A 3M99A 4YYRA 1DF0A 2HXZA 1MHWA 3TNXA 4MZSA 3CH3X 4I07A 1MDWA 2AVWA 3LFYA 4QBBA 4ZUXU 4FJCA 3N3GA 2DJGB 4FIPA 1SP4B 3U8EA 1GX3A 1Q6KA 3ERVA 2CIOA 3RVVA 2DCCA 1JQPA 4N8WA 3WXGA 3LTWA 4X6HA 3QSDA 4QRGA 1GECE 5EF4A 3C9EA 4QH6A 1U9QX 2PADA 7PCKA 1YT7A 3PNRA 2DZZA 1VSNA 3KWZA 1O0EA 2FO5A 2R9NA 3HHIA 1PPPA 1Y4HA 4OELA 2XU1A 2CB5A 3OF8A 3IUTA 1X9YA 3B79A 4N79A 3H6SA 2JQFR 2HHNA 2C0YA 3H7DA 3QJ3A 1NB3A 3IOQA 2G8EA 3OVXA 4XUIA 1KHQA 1STFE 1QOLA 2XU5A 3K8UA 2YJ9A 3IV2A 2YJ8A 5K16A 3HWNA 1AIMA 4DMYA 2BSZA 3BPFA 3HHAA 5CVNB 1EWMA 3RVXA 1KXRA 1E2TA 1PCIA 1ITOA 3S3RA 1THEA 1Y08A 3K9MA 1U9WA 1ME4A 1BP4A 1AU2A 1DEUA 2NQIA 1SNKA 3S3QA 4X6JA 4BS5A 1MS6A 3D6SA 2OZ2A 1K3BB 4Q8GA 4CDEB 3AI8A 3P5XA 1AYUA 4AXMA 2FUDA 4Q8HA 2AS8A 1BY8A 3MTNA 1ATKA 1CB5A 5PADA 4XR7A 3O1GA 3GCBA 4BSQA 3PBHA 2DC8A 3BCNA 4RY2A 4K7CA 2XU3A 1MEGA 2E00A 2VFBA 2DC7A 2DCBA 3N3KA 1U5IA 4PI3A 3QT4A 3RVWA 4CZWA 1EWLA 1MIRA 2YJCA 1QDQA 4QRVA 1W5RA 3P5UA 1PBHA 2DCDA 1AU4A 1YVBA 2IPPB 4I04A 4BS6A 2GFOA 2VHSA 4PP2E 2FRQA 3OISA 2DJFB 5CHVA 1CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUZ A;  1QMY A;  1KFX L;  1ZCM A;  1PAD A;  2P86 A;  3OVZ A;  4X6I A;  1AU3 A;  3KKU A;  2H7J A;  3N4C A;  1CSB B;  3V6C A;  3F5V A;  2ARY A;  3WXF A;  4G54 A;  2BDL A;  1FH0 A;  3BOW A;  1PE6 A;  2R9M A;  3MHH A;  1AU0 A;  4PP1 A;  1GCB A;  2YJ2 A;  3WXE A;  2NQA A;  1YAL A;  2G6D A;  2PRE A;  3ZUA A;  2VHF A;  4CDD B;  3MOR A;  4W5B A;  1NLJ A;  1AYW A;  2B1M A;  3CH2 X;  5CVM A;  1S4V A;  4YVA A;  2B1N A;  2ACT A;  1EWO A;  4P6G A;  1BQI A;  4BPV A;  2WBF X;  4KLB A;  4YYW A;  3H8C A;  1U9V A;  3H89 A;  1CS8 A;  3E1Z B;  5JA7 A;  4CDC B;  3KX1 A;  5EGW A;  2OP3 A;  2AYO A;  1NQC A;  5CHT A;  1A6R A;  1F2A A;  2AIM A;  1HUC B;  2R9F A;  2DC6 A;  4CDF B;  2GHU A;  5FPW A;  2DC9 A;  1QXP A;  2AYN A;  1ICF A;  1F29 A;  5F02 A;  6PAD A;  1CVZ A;  4QRX A;  4W5C A;  1PIP A;  3O0U A;  3CBK A;  1BGO A;  3I06 A;  2F1G A;  3BC3 A;  4YYU A;  1AEC A;  2P7U A;  1MEM A;  2NQD B;  2YJB A;  9PAP A;  1NL6 A;  3IEJ A;  1ME3 A;  3H8B A;  3CBJ A;  5A24 A;  1ZIV A;  3DF0 A;  4WA6 A;  5CVO B;  4N4Z A;  1U9X A;  2NQG A;  1KHP A;  2BDZ A;  1YK8 A;  3PDF A;  4MSX A;  2F7D A;  3LXS A;  3OF9 A;  2FT2 A;  1EF7 A;  3PW3 A;  4MZO A;  1PPD A;  1TL9 A;  4AXL A;  2R6N A;  1EWP A;  2HH5 A;  4YYV A;  1PPN A;  3BPM A;  3I3T A;  4YYQ A;  2FTD A;  2G8J A;  3KWB X;  2E02 A;  2Y5B A;  3USV A;  2P0R A;  2HD5 A;  3IHP A;  1POP A;  3HD3 A;  1F2B A;  3BWK A;  3NHE A;  4YYS A;  1TLO A;  3IMA A;  1YK7 A;  4FK5 A;  3MHS A;  2DCA A;  1F2C A;  2E03 A;  3KSE A;  4I05 A;  4HWY A;  2O6X A;  5J94 A;  3P5W A;  2FYE A;  1IWD A;  1PPO A;  3KW9 A;  4PAD A;  2G7Y A;  2PNS A;  4DMX A;  1VJV A;  2PBH A;  1PXV A;  4YV8 A;  1CPJ A;  3K24 A;  3KFQ A;  2AUX A;  2DZY A;  1KFU L;  1XKG A;  4BQV A;  1GMY A;  1NB5 A;  2FQ9 A;  2E01 A;  1NPZ A;  8PCH A;  2R9O A;  1CQD A;  3P5V A;  2OUL A;  2FRA A;  1M6D A;  3V6E A;  2ATO A;  2Y6E A;  4OEM A;  5JH3 A;  4W4U A;  1GLO A;  3F75 A;  1CTE A;  2IBI A;  1AYV A;  1CV8 A;  1TU6 A;  2XU4 A;  2R9C A;  4P6E A;  2JQG R;  2AU1 A;  3M99 A;  4YYR A;  1DF0 A;  2HXZ A;  1MHW A;  3TNX A;  4MZS A;  3CH3 X;  4I07 A;  1MDW A;  2AVW A;  3LFY A;  4QBB A;  4ZUX U;  4FJC A;  3N3G A;  2DJG B;  4FIP A;  1SP4 B;  3U8E A;  1Q6K A;  3ERV A;  2CIO A;  3RVV A;  2DCC A;  1JQP A;  4N8W A;  3WXG A;  4X6H A;  3QSD A;  4QRG A;  1GEC E;  5EF4 A;  3C9E A;  4QH6 A;  1U9Q X;  2PAD A;  7PCK A;  1YT7 A;  3PNR A;  2DZZ A;  1VSN A;  3KWZ A;  1O0E A;  2FO5 A;  2R9N A;  3HHI A;  1PPP A;  1Y4H A;  4OEL A;  2XU1 A;  2CB5 A;  3OF8 A;  3IUT A;  1X9Y A;  3B79 A;  4N79 A;  3H6S A;  2JQF R;  2HHN A;  2C0Y A;  3H7D A;  3QJ3 A;  1NB3 A;  3IOQ A;  2G8E A;  3OVX A;  4XUI A;  1KHQ A;  1STF E;  1QOL A;  2XU5 A;  3K8U A;  2YJ9 A;  3IV2 A;  2YJ8 A;  5K16 A;  3HWN A;  1AIM A;  4DMY A;  3BPF A;  3HHA A;  5CVN B;  1EWM A;  3RVX A;  1KXR A;  1PCI A;  1ITO A;  3S3R A;  1THE A;  1Y08 A;  3K9M A;  1U9W A;  1ME4 A;  1BP4 A;  1AU2 A;  1DEU A;  2NQI A;  1SNK A;  3S3Q A;  4X6J A;  4BS5 A;  1MS6 A;  3D6S A;  2OZ2 A;  1K3B B;  4Q8G A;  4CDE B;  3AI8 A;  3P5X A;  1AYU A;  4AXM A;  2FUD A;  4Q8H A;  2AS8 A;  1BY8 A;  3MTN A;  1ATK A;  1CB5 A;  5PAD A;  4XR7 A;  3O1G A;  3GCB A;  4BSQ A;  3PBH A;  2DC8 A;  3BCN A;  4K7C A;  4RY2 A;  2XU3 A;  1MEG A;  2E00 A;  2DC7 A;  2DCB A;  3N3K A;  1U5I A;  4PI3 A;  3QT4 A;  3RVW A;  4CZW A;  1EWL A;  1MIR A;  2YJC A;  1QDQ A;  4QRV A;  3P5U A;  1PBH A;  2DCD A;  1AU4 A;  1YVB A;  2IPP B;  4I04 A;  4BS6 A;  2GFO A;  2VHS A;  4PP2 E;  2FRQ A;  3OIS A;  2DJF B;  5CHV A;  1CJL A; 
#chains in the Genus database with same CATH topology
 2J7Q A;  2AUZ A;  1QMY A;  3MJ5 A;  1KFX L;  1ZCM A;  1PAD A;  2P86 A;  3OVZ A;  4X6I A;  1AU3 A;  3KKU A;  2H7J A;  3N4C A;  1CSB B;  3V6C A;  3F5V A;  2ARY A;  3WXF A;  4G54 A;  2BDL A;  1FH0 A;  2JRI A;  3BOW A;  1PE6 A;  2R9M A;  3MHH A;  1AU0 A;  4PP1 A;  1GCB A;  2YJ2 A;  3WXE A;  2NQA A;  1YAL A;  2G6D A;  4RNA A;  2PRE A;  3ZUA A;  2VHF A;  4CDD B;  3MOR A;  3TRK A;  4W5B A;  4PT5 A;  1NLJ A;  1AYW A;  2B1M A;  3CH2 X;  5CVM A;  1S4V A;  4YVA A;  4BOZ A;  3PHX A;  2B1N A;  2ACT A;  1EWO A;  4P6G A;  1BQI A;  4BPV A;  2WBF X;  4KLB A;  4BOQ A;  1YZB A;  3H8C A;  4YYW A;  1U9V A;  2BTW A;  3H89 A;  4BOS A;  4D8I A;  1CS8 A;  3BB7 A;  3E1Z B;  5JA7 A;  4CDC B;  3KX1 A;  3PRM A;  5EGW A;  2OP3 A;  3BY4 A;  2AYO A;  1NQC A;  5CHT A;  1A6R A;  1F2A A;  3PRP A;  2AIM A;  1HUC B;  2R9F A;  2DC6 A;  2UZJ A;  2GHU A;  5FPW A;  4CDF B;  2DC9 A;  1QXP A;  2AYN A;  1ICF A;  1F29 A;  5F02 A;  6PAD A;  1CVZ A;  4QRX A;  4REZ A;  4W5C A;  1PIP A;  3O0U A;  3CBK A;  1BGO A;  1UKF A;  3I06 A;  2F1G A;  3BC3 A;  4YYU A;  1AEC A;  2P7U A;  3BBA A;  1MEM A;  1PVJ A;  2NQD B;  2YJB A;  4MI7 A;  9PAP A;  1NL6 A;  3IEJ A;  1ME3 A;  3H8B A;  3CBJ A;  5A24 A;  1ZIV A;  3DF0 A;  3ZNH A;  4WA6 A;  5CVO B;  4HXD B;  1DKI A;  4N4Z A;  1U9X A;  2NQG A;  4IP3 A;  1KHP A;  2BDZ A;  1YK8 A;  3PDF A;  4MSX A;  2F7D A;  3LXS A;  3OF9 A;  2FT2 A;  1EF7 A;  3PW3 A;  4MZO A;  5EZS A;  1PPD A;  1TL9 A;  4AXL A;  2R6N A;  4OW0 A;  1EWP A;  2HH5 A;  4YYV A;  1PPN A;  3BPM A;  3I3T A;  4YYQ A;  2FTD A;  2G8J A;  3KWB X;  2E02 A;  2Y5B A;  3USV A;  2P0R A;  2HD5 A;  3IHP A;  1POP A;  3HD3 A;  3PHW A;  4ZTB A;  1F2B A;  3BWK A;  3NHE A;  4BOP A;  4YYS A;  1TLO A;  3IMA A;  1YK7 A;  4FK5 A;  3MHS A;  2DCA A;  1F2C A;  2E03 A;  3KSE A;  4I05 A;  4HWY A;  2O6X A;  5J94 A;  3P5W A;  2FYE A;  1IWD A;  1PPO A;  3KW9 A;  4PAD A;  2G7Y A;  2PNS A;  4DMX A;  1VJV A;  2PBH A;  1PXV A;  4YV8 A;  2FE8 A;  1CPJ A;  3K24 A;  3KFQ A;  2AUX A;  2DZY A;  1KFU L;  4R3D A;  1XKG A;  4BQV A;  1GMY A;  1NB5 A;  2FQ9 A;  4RKX A;  2E01 A;  1NPZ A;  8PCH A;  2BU3 A;  2R9O A;  1CQD A;  3TMP A;  3P5V A;  2OUL A;  2FRA A;  1M6D A;  3V6E A;  2ATO A;  2Y6E A;  5EZQ A;  4OEM A;  3W30 A;  5JH3 A;  4W4U A;  1GLO A;  3F75 A;  3PHU A;  1CTE A;  2IBI A;  1AYV A;  4GUA A;  2HWK A;  4PP2 E;  3B21 A;  1CV8 A;  1TU6 A;  2JTC A;  3MTV A;  2XU4 A;  2R9C A;  4P6E A;  2JQG R;  2J7Q C;  4XZX A;  2AU1 A;  3M99 A;  4YYR A;  1DF0 A;  2HXZ A;  1MHW A;  3TNX A;  4MZS A;  3CH3 X;  4I07 A;  1MDW A;  2AVW A;  3LFY A;  4QBB A;  4ZUX U;  4FJC A;  3N3G A;  2DJG B;  4FIP A;  1SP4 B;  3U8E A;  1Q6K A;  3ERV A;  2AGA A;  2CIO A;  3RVV A;  2DCC A;  4RF0 A;  1JQP A;  4N8W A;  3WXG A;  4X6H A;  3QSD A;  4QRG A;  1GEC E;  2Z84 A;  5EF4 A;  3C9E A;  4QH6 A;  4MM3 B;  1U9Q X;  4D8B A;  2PAD A;  7PCK A;  1YT7 A;  3PNR A;  4WUR A;  1VSN A;  3KWZ A;  1O0E A;  2FO5 A;  2R9N A;  3HHI A;  1PPP A;  1Y4H A;  4OEL A;  2XU1 A;  2CB5 A;  3OF8 A;  3IUT A;  1X9Y A;  4D8E A;  5E6J A;  3B79 A;  4N79 A;  3H6S A;  2JQF R;  2HHN A;  2C0Y A;  3H7D A;  3QJ3 A;  1NB3 A;  3IOQ A;  2BTW B;  2G8E A;  3OVX A;  4XUI A;  1KHQ A;  1STF E;  1QOL A;  2XU5 A;  3K8U A;  2YJ9 A;  3IV2 A;  5KO3 A;  4BOU A;  2YJ8 A;  5K16 A;  3HWN A;  1AIM A;  4DMY A;  3BPF A;  3HHA A;  5CVN B;  1EWM A;  3E9S A;  3RVX A;  1KXR A;  3C0R A;  4M0W A;  1PCI A;  4RF1 A;  1ITO A;  3O65 A;  3S3R A;  1THE A;  1Y08 A;  3K9M A;  1U9W A;  1ME4 A;  1BP4 A;  1AU2 A;  1DEU A;  2NQI A;  1SNK A;  3OQC A;  3S3Q A;  4X6J A;  4BS5 A;  1MS6 A;  3D6S A;  2OZ2 A;  1K3B B;  4Q8G A;  4CDE B;  3AI8 A;  3P5X A;  1AYU A;  4AXM A;  2FUD A;  4Q8H A;  2AS8 A;  1BY8 A;  4A5U A;  3MTN A;  1ATK A;  1CB5 A;  5PAD A;  4XR7 A;  3O1G A;  3GCB A;  4BSQ A;  4OVZ B;  2DOS A;  3PBH A;  2DC8 A;  3BCN A;  4K7C A;  4RY2 A;  2XU3 A;  1MEG A;  2E00 A;  3RNV A;  4OVZ A;  2DC7 A;  2DCB A;  3N3K A;  1U5I A;  4PI3 A;  3QT4 A;  3RVW A;  4CZW A;  1EWL A;  1MIR A;  2YJC A;  1QDQ A;  4QRV A;  3P5U A;  1PBH A;  3PSE A;  2DCD A;  1AU4 A;  3PT2 A;  4IUM A;  3W31 A;  3MP2 A;  4P16 A;  1YVB A;  3IFU A;  2IPP B;  4I04 A;  4BS6 A;  2GFO A;  5JZE A;  2VHS A;  2DZZ A;  2FRQ A;  3OIS A;  2DJF B;  5CHV A;  1CJL A; 
#chains in the Genus database with same CATH homology
 2AUZ A;  1QMY A;  1KFX L;  1ZCM A;  1PAD A;  2P86 A;  3D9W A;  3OVZ A;  4X6I A;  1AU3 A;  1W6F A;  3KKU A;  2H7J A;  3N4C A;  1CSB B;  3V6C A;  3F5V A;  2ARY A;  3WXF A;  4G54 A;  2BDL A;  1FH0 A;  3BOW A;  1PE6 A;  2R9M A;  3MHH A;  1AU0 A;  4PP1 A;  1GCB A;  2YJ2 A;  3WXE A;  2NQA A;  1YAL A;  2G6D A;  2PRE A;  3ZUA A;  2VHF A;  4CDD B;  3MOR A;  4W5B A;  4B55 A;  1NLJ A;  1AYW A;  2B1M A;  3CH2 X;  5CVM A;  1S4V A;  4YVA A;  1W4T A;  2B1N A;  2ACT A;  1EWO A;  4P6G A;  1BQI A;  4BPV A;  2WBF X;  4KLB A;  4YYW A;  3H8C A;  1U9V A;  3H89 A;  1CS8 A;  3E1Z B;  5JA7 A;  4CDC B;  3KX1 A;  5EGW A;  2OP3 A;  2AYO A;  1NQC A;  5CHT A;  1A6R A;  1F2A A;  2AIM A;  1HUC B;  2R9F A;  2DC6 A;  4CDF B;  2GHU A;  5FPW A;  2DC9 A;  1QXP A;  2AYN A;  1ICF A;  1F29 A;  5F02 A;  6PAD A;  1CVZ A;  4QRX A;  4W5C A;  1PIP A;  3O0U A;  3CBK A;  1BGO A;  3I06 A;  2F1G A;  3BC3 A;  4YYU A;  1AEC A;  2P7U A;  1MEM A;  2NQD B;  2YJB A;  9PAP A;  1NL6 A;  3IEJ A;  1ME3 A;  3H8B A;  3CBJ A;  5A24 A;  1ZIV A;  3DF0 A;  4WA6 A;  5CVO B;  4N4Z A;  1U9X A;  2NQG A;  4BGF A;  1KHP A;  2BDZ A;  1YK8 A;  3PDF A;  4NV7 A;  4MSX A;  2F7D A;  3LXS A;  3OF9 A;  2FT2 A;  1EF7 A;  3PW3 A;  4MZO A;  1PPD A;  1TL9 A;  4AXL A;  2R6N A;  1EWP A;  2HH5 A;  4YYV A;  1PPN A;  3BPM A;  3I3T A;  4YYQ A;  2FTD A;  2G8J A;  3KWB X;  2E02 A;  2Y5B A;  3USV A;  2P0R A;  2HD5 A;  3IHP A;  1POP A;  3HD3 A;  1F2B A;  3BWK A;  3NHE A;  4GUZ A;  4C5P A;  1TLO A;  4YYS A;  3IMA A;  1YK7 A;  4FK5 A;  3MHS A;  2DCA A;  1F2C A;  2E03 A;  3KSE A;  4I05 A;  4HWY A;  2O6X A;  5J94 A;  3P5W A;  2FYE A;  1IWD A;  1PPO A;  3KW9 A;  4PAD A;  2G7Y A;  2VFC A;  2PNS A;  4DMX A;  1VJV A;  2PBH A;  1PXV A;  4YV8 A;  1CPJ A;  3K24 A;  3KFQ A;  2AUX A;  2DZY A;  1KFU L;  1XKG A;  4BQV A;  1GMY A;  1NB5 A;  2FQ9 A;  2E01 A;  1NPZ A;  8PCH A;  2R9O A;  1CQD A;  3P5V A;  2OUL A;  2FRA A;  1M6D A;  3V6E A;  2ATO A;  2Y6E A;  4OEM A;  5JH3 A;  4W4U A;  1GLO A;  3F75 A;  1CTE A;  2IBI A;  1AYV A;  1CV8 A;  1TU6 A;  2XU4 A;  2R9C A;  4P6E A;  4NV8 A;  2JQG R;  2AU1 A;  3M99 A;  4YYR A;  1DF0 A;  2HXZ A;  1MHW A;  3TNX A;  4MZS A;  3CH3 X;  4I07 A;  1MDW A;  2AVW A;  3LFY A;  4QBB A;  4ZUX U;  4FJC A;  3N3G A;  2DJG B;  4FIP A;  1SP4 B;  3U8E A;  1GX3 A;  1Q6K A;  3ERV A;  2CIO A;  3RVV A;  2DCC A;  1JQP A;  4N8W A;  3WXG A;  3LTW A;  4X6H A;  3QSD A;  4QRG A;  1GEC E;  5EF4 A;  3C9E A;  4QH6 A;  1U9Q X;  2PAD A;  7PCK A;  1YT7 A;  3PNR A;  2DZZ A;  1VSN A;  3KWZ A;  1O0E A;  2FO5 A;  2R9N A;  3HHI A;  1PPP A;  1Y4H A;  4OEL A;  2XU1 A;  2CB5 A;  3OF8 A;  3IUT A;  1X9Y A;  3B79 A;  4N79 A;  3H6S A;  2JQF R;  2HHN A;  2C0Y A;  3H7D A;  3QJ3 A;  1NB3 A;  3IOQ A;  2G8E A;  3OVX A;  4XUI A;  1KHQ A;  1STF E;  1QOL A;  2XU5 A;  3K8U A;  2YJ9 A;  3IV2 A;  2YJ8 A;  5K16 A;  3HWN A;  1AIM A;  4DMY A;  2BSZ A;  3BPF A;  3HHA A;  5CVN B;  1EWM A;  3RVX A;  1KXR A;  1E2T A;  1PCI A;  1ITO A;  3S3R A;  1THE A;  1Y08 A;  3K9M A;  1U9W A;  1ME4 A;  1BP4 A;  1AU2 A;  1DEU A;  2NQI A;  1SNK A;  3S3Q A;  4X6J A;  4BS5 A;  1MS6 A;  3D6S A;  2OZ2 A;  1K3B B;  4Q8G A;  4CDE B;  3AI8 A;  3P5X A;  1AYU A;  4AXM A;  2FUD A;  4Q8H A;  2AS8 A;  1BY8 A;  3MTN A;  1ATK A;  1CB5 A;  5PAD A;  4XR7 A;  3O1G A;  3GCB A;  4BSQ A;  3PBH A;  2DC8 A;  3BCN A;  4RY2 A;  4K7C A;  2XU3 A;  1MEG A;  2E00 A;  2VFB A;  2DC7 A;  2DCB A;  3N3K A;  1U5I A;  4PI3 A;  3QT4 A;  3RVW A;  4CZW A;  1EWL A;  1MIR A;  2YJC A;  1QDQ A;  4QRV A;  1W5R A;  3P5U A;  1PBH A;  2DCD A;  1AU4 A;  1YVB A;  2IPP B;  4I04 A;  4BS6 A;  2GFO A;  2VHS A;  4PP2 E;  2FRQ A;  3OIS A;  2DJF B;  5CHV A;  1CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...