3WXGA

Crystal structure of cyld usp domain (c596a) in complex with lys63-linked diubiquitin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
300
Chain Sequence
b'MGLEVMVGKKKGIQGHYNSAYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
total genus 83
structure length 300
sequence length 309
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxgA00
1ICFA 4YYQA 4MSXA 3KSEA 3H6SA 3P5UA 4X6HA 4FK5A 1EWLA 1ITOA 2PREA 1AU4A 2WBFX 4QH6A 3MTNA 4Q8HA 1AIMA 2FRQA 3CBKA 2HHNA 3USVA 1ME4A 1CQDA 1SNKA 2GHUA 2VHFA 4OEMA 4BPVA 3C9EA 3N3GA 3WXFA 1YK8A 2AS8A 4YYUA 3F75A 1TU6A 4PP1A 3KWBX 2DZYA 3OVZA 1O0EA 4YYWA 3HWNA 5CVNB 2GFOA 3LXSA 3KWZA 4HWYA 3RVXA 4CZWA 4I04A 1CV8A 1AU3A 2HD5A 5FPWA 3M99A 2F7DA 4XUIA 1FH0A 1Y08A 3D6SA 1BQIA 1Q6KA 1EF7A 2R9OA 5CVMA 4N8WA 3BPMA 4W5BA 2G6DA 2ATOA 1SP4B 3OISA 2CB5A 1TL9A 3F5VA 1KXRA 2XU1A 3PNRA 2DC7A 3MHSA 3BC3A 1TLOA 2DZZA 2DJFB 3K9MA 1DEUA 9PAPA 1ZCMA 1GCBA 3BOWA 1PPOA 2FQ9A 4YYVA 2DCBA 1PPDA 3O0UA 1PPNA 1ZIVA 2H7JA 2R9FA 2YJ9A 4W4UA 1ME3A 2AVWA 4YYRA 1KHPA 3MORA 4BQVA 2R9NA 2YJCA 8PCHA 2XU5A 1MIRA 2E02A 4QRGA 3QJ3A 1NL6A 2DC9A 2AYNA 2HH5A 4PP2E 2FTDA 3K24A 2FO5A 3ZUAA 2E00A 4X6IA 1GECE 2E03A 2FRAA 4YVAA 3IMAA 3DF0A 3I06A 2NQGA 2XU4A 1AECA 2NQDB 1MEGA 1QMYA 5CVOB 2DCDA 3CBJA 5F02A 2DC6A 1AYUA 1NB3A 2PNSA 1U9QX 1F2BA 5EGWA 2Y5BA 4AXMA 1MEMA 1EWOA 2XU3A 3HHAA 2AUZA 4QRVA 2YJ8A 3S3RA 4P6EA 4N4ZA 3IUTA 1YALA 1PADA 1PPPA 5CHVA 3QSDA 1F2CA 1YK7A 1THEA 2P0RA 2IPPB 2G7YA 3BWKA 3B79A 2BDZA 1BGOA 3U8EA 4ZUXU 2ARYA 4XR7A 1NLJA 2NQIA 1U9XA 1PIPA 3K8UA 2DJGB 3P5VA 3PDFA 1NB5A 1EWMA 3S3QA 2YJ2A 2R9MA 3BCNA 1MHWA 4YYSA 4QRXA 2CIOA 1VJVA 2AU1A 3N4CA 1KFXL 3I3TA 3PBHA 7PCKA 3H8BA 3QT4A 3LFYA 1U5IA 2B1MA 1NPZA 4PI3A 4K7CA 1MS6A 1NQCA 6PADA 3OVXA 1GLOA 1IWDA 1X9YA 5JA7A 2FYEA 4QBBA 4DMXA 2C0YA 1BY8A 3MHHA 3IHPA 3N3KA 4CDEB 4MZOA 1QDQA 4I07A 3H8CA 4FJCA 2AYOA 1VSNA 4BSQA 2G8EA 5PADA 3E1ZB 1BP4A 2NQAA 2OULA 2ACTA 2YJBA 1YVBA 3ERVA 1AU2A 3H7DA 1DF0A 2O6XA 4PADA 4Q8GA 2BDLA 1QXPA 2AIMA 1POPA 2OP3A 4OELA 1PE6A 2HXZA 1CTEA 3TNXA 3KW9A 3V6EA 2Y6EA 4WA6A 2R9CA 2VHSA 4FIPA 2P7UA 4G54A 1PCIA 3P5WA 3HD3A 3RVWA 2DCCA 1F29A 3V6CA 1HUCB 3PW3A 2G8JA 1K3BB 4DMYA 1GMYA 5EF4A 4YV8A 1AYVA 3AI8A 2IBIA 1QOLA 1CB5A 3IOQA 4AXLA 1YT7A 1Y4HA 2FT2A 2E01A 2DC8A 4BS5A 2OZ2A 1CJLA 2P86A 2DCAA 4RY2A 3WXGA 3KKUA 4W5CA 4I05A 3BPFA 1KFUL 3OF9A 1AYWA 3P5XA 1EWPA 5A24A 2R6NA 1STFE 2PADA 3OF8A 2PBHA 2JQFR 3CH2X 2B1NA 3KFQA 1F2AA 3O1GA 2AUXA 1U9WA 4CDCB 3H89A 1MDWA 1CVZA 5JH3A 1S4VA 3WXEA 3NHEA 1CPJA 3RVVA 1KHQA 3GCBA 5CHTA 4MZSA 4BS6A 1AU0A 1PBHA 1M6DA 5K16A 4N79A 1ATKA 4CDFB 2JQGR 4CDDB 1XKGA 3CH3X 3KX1A 2FUDA 4KLBA 5J94A 4X6JA 2F1GA 1PXVA 1CSBB 1CS8A 3IV2A 4P6GA 3IEJA 1U9VA 1A6RA 3HHIA 1JQPA
chains in the Genus database with same CATH superfamily
1ICFA 4YYQA 4MSXA 3PHXA 3KSEA 3H6SA 3P5UA 4X6HA 4FK5A 3B21A 1EWLA 1ITOA 4IUMA 2PREA 1AU4A 2WBFX 4QH6A 3MTNA 4Q8HA 1AIMA 2FRQA 2DOSA 3CBKA 2BTWB 2HHNA 1YZBA 3USVA 1ME4A 4OVZA 1CQDA 1SNKA 2GHUA 2VHFA 4OEMA 4BPVA 3C9EA 3N3GA 3WXFA 1YK8A 2AS8A 5E6JA 3F75A 4YYUA 1TU6A 4D8BA 4MM3B 3KWBX 4PP1A 2DZYA 3OVZA 1O0EA 4YYWA 3HWNA 5CVNB 2GFOA 3LXSA 3KWZA 4D8EA 1DKIA 4HWYA 3RVXA 4CZWA 4I04A 1CV8A 1AU3A 2HD5A 5FPWA 4BOQA 3M99A 2F7DA 4XUIA 1FH0A 1Y08A 3D6SA 1BQIA 1Q6KA 1EF7A 2R9OA 4IP3A 5CVMA 3PRMA 4N8WA 3BPMA 4RNAA 4W5BA 2G6DA 2ATOA 1SP4B 3OISA 2CB5A 1TL9A 3F5VA 1KXRA 2XU1A 3PNRA 2DC7A 3MHSA 3BC3A 1TLOA 2DZZA 4RF1A 3W31A 2DJFB 3K9MA 1DEUA 3IFUA 9PAPA 1ZCMA 1GCBA 3BOWA 5EZSA 1PPOA 2FQ9A 4YYVA 2DCBA 1PPDA 3O0UA 1PPNA 1ZIVA 2H7JA 3W30A 2R9FA 2YJ9A 4W4UA 3MTVA 1ME3A 3PT2A 2AVWA 4YYRA 5KO3A 3RNVA 1KHPA 3MORA 4BQVA 2R9NA 2YJCA 8PCHA 2XU5A 1MIRA 2E02A 4QRGA 3QJ3A 1NL6A 2DC9A 2AYNA 2HH5A 4PP2E 2FTDA 3K24A 2FO5A 2UZJA 3ZUAA 1UKFA 2E00A 4X6IA 1GECE 4XZXA 2E03A 2FRAA 4YVAA 3IMAA 3BB7A 3DF0A 4ZTBA 4A5UA 3I06A 2NQGA 2XU4A 1AECA 5JZEA 2NQDB 1MEGA 1QMYA 4OW0A 2DCDA 5CVOB 3CBJA 5F02A 2DC6A 1AYUA 1NB3A 2PNSA 4RF0A 1U9QX 1F2BA 5EGWA 2Y5BA 4AXMA 1MEMA 1EWOA 2XU3A 3HHAA 2AUZA 4QRVA 2YJ8A 3S3RA 4P6EA 4N4ZA 3IUTA 1YALA 2AGAA 2FE8A 1PADA 1PPPA 5CHVA 3QSDA 1F2CA 4OVZB 3O65A 2J7QA 1YK7A 1THEA 3BY4A 2P0RA 2BU3A 2IPPB 4M0WA 2G7YA 3BWKA 3B79A 2BDZA 1BGOA 3U8EA 4ZUXU 2ARYA 3TRKA 4XR7A 1NLJA 2NQIA 1U9XA 1PIPA 3K8UA 2DJGB 3P5VA 3PDFA 1NB5A 1EWMA 3S3QA 2YJ2A 2R9MA 3BCNA 4WURA 1MHWA 4YYSA 4QRXA 2CIOA 1VJVA 3OQCA 2AU1A 3N4CA 1KFXL 3I3TA 3PBHA 7PCKA 3H8BA 3QT4A 3LFYA 1U5IA 2B1MA 1NPZA 4PI3A 4K7CA 1MS6A 1NQCA 6PADA 3OVXA 1GLOA 1IWDA 1X9YA 5JA7A 2FYEA 4QBBA 4DMXA 2C0YA 1BY8A 3MHHA 3IHPA 2JTCA 3N3KA 4CDEB 4MZOA 1QDQA 4I07A 3H8CA 4FJCA 2AYOA 2J7QC 4D8IA 1VSNA 4BSQA 3MJ5A 4GUAA 2G8EA 4BOZA 5PADA 3E1ZB 1BP4A 4PT5A 2NQAA 2OULA 2HWKA 2ACTA 2YJBA 1YVBA 3ERVA 1AU2A 3H7DA 1DF0A 2O6XA 4PADA 3PHWA 4Q8GA 2BDLA 1QXPA 2AIMA 1POPA 2OP3A 1PE6A 2HXZA 4OELA 1CTEA 3TNXA 4P16A 3MP2A 3KW9A 3TMPA 3V6EA 2Y6EA 4WA6A 2R9CA 2VHSA 4FIPA 2P7UA 4G54A 1PCIA 3P5WA 3HD3A 3RVWA 2DCCA 1F29A 3V6CA 1HUCB 2BTWA 2G8JA 3PW3A 1K3BB 4DMYA 1GMYA 5EF4A 4YV8A 1AYVA 3AI8A 1PVJA 2IBIA 1QOLA 1CB5A 3IOQA 4AXLA 1YT7A 1Y4HA 2FT2A 2E01A 2DC8A 4BS5A 2OZ2A 1CJLA 2P86A 4HXDB 2DCAA 4RY2A 3WXGA 3KKUA 4W5CA 4REZA 4I05A 3BPFA 1KFUL 3OF9A 1AYWA 3P5XA 1EWPA 5A24A 2R6NA 1STFE 2PADA 3OF8A 2PBHA 5EZQA 2JQFR 3CH2X 2B1NA 3KFQA 1F2AA 3BBAA 4RKXA 2JRIA 3O1GA 2AUXA 3ZNHA 4BOSA 1U9WA 4CDCB 3H89A 3E9SA 1MDWA 1CVZA 3PHUA 3PRPA 5JH3A 1S4VA 3WXEA 3NHEA 1CPJA 3RVVA 1KHQA 3GCBA 5CHTA 4MZSA 4BS6A 1AU0A 1PBHA 1M6DA 5K16A 4BOPA 4N79A 1ATKA 4CDFB 3C0RA 2JQGR 4MI7A 2Z84A 4CDDB 1XKGA 3CH3X 3KX1A 4BOUA 2FUDA 4KLBA 4R3DA 5J94A 4X6JA 2F1GA 1PXVA 1CSBB 1CS8A 3IV2A 4P6GA 3PSEA 3IEJA 1U9VA 1A6RA 3HHIA 1JQPA
chains in the Genus database with same CATH topology
1ICFA 4YYQA 4MSXA 3KSEA 3H6SA 3P5UA 4X6HA 4FK5A 1EWLA 1ITOA 4BGFA 2PREA 1AU4A 2WBFX 4QH6A 3MTNA 4Q8HA 1AIMA 2FRQA 3CBKA 2HHNA 3USVA 1ME4A 1CQDA 1SNKA 2GHUA 2VHFA 4OEMA 4BPVA 4B55A 3C9EA 3N3GA 3WXFA 1YK8A 2AS8A 4YYUA 3F75A 1TU6A 4PP1A 3KWBX 2DZYA 3OVZA 1O0EA 4YYWA 3HWNA 5CVNB 2GFOA 3LXSA 3KWZA 4HWYA 3RVXA 4CZWA 4I04A 1CV8A 1AU3A 2HD5A 5FPWA 3M99A 2F7DA 4XUIA 1FH0A 1Y08A 3D6SA 1BQIA 1Q6KA 1EF7A 2R9OA 5CVMA 1E2TA 4N8WA 3BPMA 4W5BA 2G6DA 2ATOA 1SP4B 3OISA 2CB5A 1TL9A 3F5VA 1KXRA 2XU1A 3PNRA 2DC7A 3MHSA 3BC3A 1TLOA 2DZZA 2DJFB 3K9MA 1DEUA 3LTWA 9PAPA 1ZCMA 1GCBA 3BOWA 1PPOA 2FQ9A 4YYVA 2DCBA 1PPDA 3O0UA 1PPNA 1ZIVA 2H7JA 2R9FA 2YJ9A 4W4UA 1ME3A 2AVWA 4YYRA 3D9WA 1KHPA 3MORA 4BQVA 2R9NA 2YJCA 8PCHA 2XU5A 1MIRA 2E02A 4QRGA 3QJ3A 1NL6A 2DC9A 2AYNA 2HH5A 4PP2E 2FTDA 3K24A 2FO5A 3ZUAA 2E00A 4X6IA 1GECE 2E03A 2FRAA 4YVAA 3IMAA 3DF0A 3I06A 2NQGA 2XU4A 1AECA 2NQDB 1MEGA 1QMYA 5CVOB 2DCDA 3CBJA 5F02A 2DC6A 1AYUA 1NB3A 2PNSA 1U9QX 1F2BA 5EGWA 2Y5BA 4AXMA 1MEMA 1EWOA 2XU3A 3HHAA 2AUZA 4QRVA 2YJ8A 3S3RA 4P6EA 4N4ZA 3IUTA 1YALA 1W5RA 1PADA 1PPPA 5CHVA 3QSDA 1F2CA 4NV7A 1YK7A 1THEA 2P0RA 2IPPB 2G7YA 3BWKA 3B79A 2BDZA 1BGOA 3U8EA 4ZUXU 2ARYA 4XR7A 1NLJA 2NQIA 1U9XA 1PIPA 3K8UA 2DJGB 3P5VA 3PDFA 1NB5A 1EWMA 3S3QA 2YJ2A 2R9MA 3BCNA 1MHWA 4YYSA 4QRXA 2CIOA 1GX3A 1VJVA 2AU1A 3N4CA 1KFXL 3I3TA 3PBHA 7PCKA 3H8BA 3QT4A 3LFYA 1U5IA 2B1MA 1NPZA 4PI3A 4K7CA 1MS6A 1NQCA 6PADA 3OVXA 1GLOA 1IWDA 1X9YA 5JA7A 2FYEA 4QBBA 4DMXA 2C0YA 1BY8A 3MHHA 3IHPA 3N3KA 4CDEB 2VFCA 4MZOA 1QDQA 4I07A 3H8CA 4FJCA 2AYOA 1VSNA 4BSQA 2G8EA 5PADA 3E1ZB 1BP4A 2NQAA 2OULA 2ACTA 2YJBA 1YVBA 3ERVA 1AU2A 3H7DA 1DF0A 2O6XA 4PADA 4Q8GA 2BDLA 4GUZA 4C5PA 1QXPA 2AIMA 1POPA 2OP3A 1PE6A 2HXZA 4OELA 1CTEA 3TNXA 3KW9A 3V6EA 2Y6EA 4WA6A 2R9CA 2VHSA 4FIPA 2P7UA 4G54A 1PCIA 3P5WA 3HD3A 3RVWA 2DCCA 1F29A 3V6CA 1HUCB 3PW3A 2G8JA 1K3BB 1W6FA 4DMYA 1GMYA 5EF4A 4YV8A 1AYVA 3AI8A 2IBIA 1QOLA 1CB5A 3IOQA 4AXLA 1YT7A 1Y4HA 2FT2A 2E01A 2DC8A 4BS5A 2OZ2A 1CJLA 2P86A 4NV8A 2DCAA 4RY2A 3WXGA 3KKUA 4W5CA 4I05A 2BSZA 3BPFA 1KFUL 3OF9A 1AYWA 3P5XA 1EWPA 5A24A 2R6NA 1STFE 2PADA 3OF8A 2PBHA 2JQFR 3CH2X 2B1NA 3KFQA 1F2AA 3O1GA 2AUXA 1U9WA 2VFBA 4CDCB 3H89A 1MDWA 1CVZA 5JH3A 1S4VA 3WXEA 1W4TA 3NHEA 1CPJA 3RVVA 1KHQA 3GCBA 5CHTA 4MZSA 4BS6A 1AU0A 1PBHA 1M6DA 5K16A 4N79A 1ATKA 4CDFB 2JQGR 4CDDB 1XKGA 3CH3X 3KX1A 2FUDA 4KLBA 5J94A 4X6JA 2F1GA 1PXVA 1CSBB 1CS8A 3IV2A 4P6GA 3IEJA 1U9VA 1A6RA 3HHIA 1JQPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICF A;  4YYQ A;  4MSX A;  3KSE A;  3H6S A;  3P5U A;  4X6H A;  4FK5 A;  1EWL A;  1ITO A;  2PRE A;  1AU4 A;  2WBF X;  4QH6 A;  3MTN A;  4Q8H A;  1AIM A;  2FRQ A;  3CBK A;  2HHN A;  3USV A;  1ME4 A;  1CQD A;  1SNK A;  2GHU A;  2VHF A;  4OEM A;  4BPV A;  3C9E A;  3N3G A;  3WXF A;  1YK8 A;  2AS8 A;  4YYU A;  3F75 A;  1TU6 A;  4PP1 A;  3KWB X;  2DZY A;  3OVZ A;  1O0E A;  4YYW A;  3HWN A;  5CVN B;  2GFO A;  3LXS A;  3KWZ A;  4HWY A;  3RVX A;  4CZW A;  4I04 A;  1CV8 A;  1AU3 A;  2HD5 A;  5FPW A;  3M99 A;  2F7D A;  4XUI A;  1FH0 A;  1Y08 A;  3D6S A;  1BQI A;  1Q6K A;  1EF7 A;  2R9O A;  5CVM A;  4N8W A;  3BPM A;  4W5B A;  2G6D A;  2ATO A;  1SP4 B;  3OIS A;  2CB5 A;  1TL9 A;  3F5V A;  1KXR A;  2XU1 A;  3PNR A;  2DC7 A;  3MHS A;  3BC3 A;  1TLO A;  2DZZ A;  2DJF B;  3K9M A;  1DEU A;  9PAP A;  1ZCM A;  1GCB A;  3BOW A;  1PPO A;  2FQ9 A;  4YYV A;  2DCB A;  1PPD A;  3O0U A;  1PPN A;  1ZIV A;  2H7J A;  2R9F A;  2YJ9 A;  4W4U A;  1ME3 A;  2AVW A;  4YYR A;  1KHP A;  3MOR A;  4BQV A;  2R9N A;  2YJC A;  8PCH A;  2XU5 A;  1MIR A;  2E02 A;  4QRG A;  3QJ3 A;  1NL6 A;  2DC9 A;  2AYN A;  2HH5 A;  4PP2 E;  2FTD A;  3K24 A;  2FO5 A;  3ZUA A;  2E00 A;  4X6I A;  1GEC E;  2E03 A;  2FRA A;  4YVA A;  3IMA A;  3DF0 A;  3I06 A;  2NQG A;  2XU4 A;  1AEC A;  2NQD B;  1MEG A;  1QMY A;  5CVO B;  2DCD A;  3CBJ A;  5F02 A;  2DC6 A;  1AYU A;  1NB3 A;  2PNS A;  1U9Q X;  1F2B A;  5EGW A;  2Y5B A;  4AXM A;  1MEM A;  1EWO A;  2XU3 A;  3HHA A;  2AUZ A;  4QRV A;  2YJ8 A;  3S3R A;  4P6E A;  4N4Z A;  3IUT A;  1YAL A;  1PAD A;  1PPP A;  5CHV A;  3QSD A;  1F2C A;  1YK7 A;  1THE A;  2P0R A;  2IPP B;  2G7Y A;  3BWK A;  3B79 A;  2BDZ A;  1BGO A;  3U8E A;  4ZUX U;  2ARY A;  4XR7 A;  1NLJ A;  2NQI A;  1U9X A;  1PIP A;  3K8U A;  2DJG B;  3P5V A;  3PDF A;  1NB5 A;  1EWM A;  3S3Q A;  2YJ2 A;  2R9M A;  3BCN A;  1MHW A;  4YYS A;  4QRX A;  2CIO A;  1VJV A;  2AU1 A;  3N4C A;  1KFX L;  3I3T A;  3PBH A;  7PCK A;  3H8B A;  3QT4 A;  3LFY A;  1U5I A;  2B1M A;  1NPZ A;  4PI3 A;  4K7C A;  1MS6 A;  1NQC A;  6PAD A;  3OVX A;  1GLO A;  1IWD A;  1X9Y A;  5JA7 A;  2FYE A;  4QBB A;  4DMX A;  2C0Y A;  1BY8 A;  3MHH A;  3IHP A;  3N3K A;  4CDE B;  4MZO A;  1QDQ A;  4I07 A;  3H8C A;  4FJC A;  2AYO A;  1VSN A;  4BSQ A;  2G8E A;  5PAD A;  3E1Z B;  1BP4 A;  2NQA A;  2OUL A;  2ACT A;  2YJB A;  1YVB A;  3ERV A;  1AU2 A;  3H7D A;  1DF0 A;  2O6X A;  4PAD A;  4Q8G A;  2BDL A;  1QXP A;  2AIM A;  1POP A;  2OP3 A;  4OEL A;  1PE6 A;  2HXZ A;  1CTE A;  3TNX A;  3KW9 A;  3V6E A;  2Y6E A;  4WA6 A;  2R9C A;  2VHS A;  4FIP A;  2P7U A;  4G54 A;  1PCI A;  3P5W A;  3HD3 A;  3RVW A;  2DCC A;  1F29 A;  3V6C A;  1HUC B;  3PW3 A;  2G8J A;  1K3B B;  4DMY A;  1GMY A;  5EF4 A;  4YV8 A;  1AYV A;  3AI8 A;  2IBI A;  1QOL A;  1CB5 A;  3IOQ A;  4AXL A;  1YT7 A;  1Y4H A;  2FT2 A;  2E01 A;  2DC8 A;  4BS5 A;  2OZ2 A;  1CJL A;  2P86 A;  2DCA A;  4RY2 A;  3WXG A;  3KKU A;  4W5C A;  4I05 A;  3BPF A;  1KFU L;  3OF9 A;  1AYW A;  3P5X A;  1EWP A;  5A24 A;  2R6N A;  1STF E;  2PAD A;  3OF8 A;  2PBH A;  2JQF R;  3CH2 X;  2B1N A;  3KFQ A;  1F2A A;  3O1G A;  2AUX A;  1U9W A;  4CDC B;  3H89 A;  1MDW A;  1CVZ A;  5JH3 A;  1S4V A;  3WXE A;  3NHE A;  1CPJ A;  3RVV A;  1KHQ A;  3GCB A;  5CHT A;  4MZS A;  4BS6 A;  1AU0 A;  1PBH A;  1M6D A;  5K16 A;  4N79 A;  1ATK A;  4CDF B;  2JQG R;  4CDD B;  1XKG A;  3CH3 X;  3KX1 A;  2FUD A;  4KLB A;  5J94 A;  4X6J A;  2F1G A;  1PXV A;  1CSB B;  1CS8 A;  3IV2 A;  4P6G A;  3IEJ A;  1U9V A;  1A6R A;  3HHI A;  1JQP A; 
#chains in the Genus database with same CATH topology
 1ICF A;  4YYQ A;  4MSX A;  3PHX A;  3KSE A;  3H6S A;  3P5U A;  4X6H A;  4FK5 A;  3B21 A;  1EWL A;  1ITO A;  4IUM A;  2PRE A;  1AU4 A;  2WBF X;  4QH6 A;  3MTN A;  4Q8H A;  1AIM A;  2FRQ A;  2DOS A;  3CBK A;  2BTW B;  2HHN A;  1YZB A;  3USV A;  1ME4 A;  4OVZ A;  1CQD A;  1SNK A;  2GHU A;  2VHF A;  4OEM A;  4BPV A;  3C9E A;  3N3G A;  3WXF A;  1YK8 A;  2AS8 A;  5E6J A;  3F75 A;  4YYU A;  1TU6 A;  4D8B A;  4MM3 B;  3KWB X;  4PP1 A;  2DZY A;  3OVZ A;  1O0E A;  4YYW A;  3HWN A;  5CVN B;  2GFO A;  3LXS A;  3KWZ A;  4D8E A;  1DKI A;  4HWY A;  3RVX A;  4CZW A;  4I04 A;  1CV8 A;  1AU3 A;  2HD5 A;  5FPW A;  4BOQ A;  3M99 A;  2F7D A;  4XUI A;  1FH0 A;  1Y08 A;  3D6S A;  1BQI A;  1Q6K A;  1EF7 A;  2R9O A;  4IP3 A;  5CVM A;  3PRM A;  4N8W A;  3BPM A;  4RNA A;  4W5B A;  2G6D A;  2ATO A;  1SP4 B;  3OIS A;  2CB5 A;  1TL9 A;  3F5V A;  1KXR A;  2XU1 A;  3PNR A;  2DC7 A;  3MHS A;  3BC3 A;  1TLO A;  2DZZ A;  4RF1 A;  3W31 A;  2DJF B;  3K9M A;  1DEU A;  3IFU A;  9PAP A;  1ZCM A;  1GCB A;  3BOW A;  5EZS A;  1PPO A;  2FQ9 A;  4YYV A;  2DCB A;  1PPD A;  3O0U A;  1PPN A;  1ZIV A;  2H7J A;  3W30 A;  2R9F A;  2YJ9 A;  4W4U A;  3MTV A;  1ME3 A;  3PT2 A;  2AVW A;  4YYR A;  5KO3 A;  3RNV A;  1KHP A;  3MOR A;  4BQV A;  2R9N A;  2YJC A;  8PCH A;  2XU5 A;  1MIR A;  2E02 A;  4QRG A;  3QJ3 A;  1NL6 A;  2DC9 A;  2AYN A;  2HH5 A;  4PP2 E;  2FTD A;  3K24 A;  2FO5 A;  2UZJ A;  3ZUA A;  1UKF A;  2E00 A;  4X6I A;  1GEC E;  4XZX A;  2E03 A;  2FRA A;  4YVA A;  3IMA A;  3BB7 A;  3DF0 A;  4ZTB A;  4A5U A;  3I06 A;  2NQG A;  2XU4 A;  1AEC A;  5JZE A;  2NQD B;  1MEG A;  1QMY A;  4OW0 A;  2DCD A;  5CVO B;  3CBJ A;  5F02 A;  2DC6 A;  1AYU A;  1NB3 A;  2PNS A;  4RF0 A;  1U9Q X;  1F2B A;  5EGW A;  2Y5B A;  4AXM A;  1MEM A;  1EWO A;  2XU3 A;  3HHA A;  2AUZ A;  4QRV A;  2YJ8 A;  3S3R A;  4P6E A;  4N4Z A;  3IUT A;  1YAL A;  2AGA A;  2FE8 A;  1PAD A;  1PPP A;  5CHV A;  3QSD A;  1F2C A;  4OVZ B;  3O65 A;  2J7Q A;  1YK7 A;  1THE A;  3BY4 A;  2P0R A;  2BU3 A;  2IPP B;  4M0W A;  2G7Y A;  3BWK A;  3B79 A;  2BDZ A;  1BGO A;  3U8E A;  4ZUX U;  2ARY A;  3TRK A;  4XR7 A;  1NLJ A;  2NQI A;  1U9X A;  1PIP A;  3K8U A;  2DJG B;  3P5V A;  3PDF A;  1NB5 A;  1EWM A;  3S3Q A;  2YJ2 A;  2R9M A;  3BCN A;  4WUR A;  1MHW A;  4YYS A;  4QRX A;  2CIO A;  1VJV A;  3OQC A;  2AU1 A;  3N4C A;  1KFX L;  3I3T A;  3PBH A;  7PCK A;  3H8B A;  3QT4 A;  3LFY A;  1U5I A;  2B1M A;  1NPZ A;  4PI3 A;  4K7C A;  1MS6 A;  1NQC A;  6PAD A;  3OVX A;  1GLO A;  1IWD A;  1X9Y A;  5JA7 A;  2FYE A;  4QBB A;  4DMX A;  2C0Y A;  1BY8 A;  3MHH A;  3IHP A;  2JTC A;  3N3K A;  4CDE B;  4MZO A;  1QDQ A;  4I07 A;  3H8C A;  4FJC A;  2AYO A;  2J7Q C;  4D8I A;  1VSN A;  4BSQ A;  3MJ5 A;  4GUA A;  2G8E A;  4BOZ A;  5PAD A;  3E1Z B;  1BP4 A;  4PT5 A;  2NQA A;  2OUL A;  2HWK A;  2ACT A;  2YJB A;  1YVB A;  3ERV A;  1AU2 A;  3H7D A;  1DF0 A;  2O6X A;  4PAD A;  3PHW A;  4Q8G A;  2BDL A;  1QXP A;  2AIM A;  1POP A;  2OP3 A;  1PE6 A;  2HXZ A;  4OEL A;  1CTE A;  3TNX A;  4P16 A;  3MP2 A;  3KW9 A;  3TMP A;  3V6E A;  2Y6E A;  4WA6 A;  2R9C A;  2VHS A;  4FIP A;  2P7U A;  4G54 A;  1PCI A;  3P5W A;  3HD3 A;  3RVW A;  2DCC A;  1F29 A;  3V6C A;  1HUC B;  2BTW A;  2G8J A;  3PW3 A;  1K3B B;  4DMY A;  1GMY A;  5EF4 A;  4YV8 A;  1AYV A;  3AI8 A;  1PVJ A;  2IBI A;  1QOL A;  1CB5 A;  3IOQ A;  4AXL A;  1YT7 A;  1Y4H A;  2FT2 A;  2E01 A;  2DC8 A;  4BS5 A;  2OZ2 A;  1CJL A;  2P86 A;  4HXD B;  2DCA A;  4RY2 A;  3WXG A;  3KKU A;  4W5C A;  4REZ A;  4I05 A;  3BPF A;  1KFU L;  3OF9 A;  1AYW A;  3P5X A;  1EWP A;  5A24 A;  2R6N A;  1STF E;  2PAD A;  3OF8 A;  2PBH A;  5EZQ A;  2JQF R;  3CH2 X;  2B1N A;  3KFQ A;  1F2A A;  3BBA A;  4RKX A;  2JRI A;  3O1G A;  2AUX A;  3ZNH A;  4BOS A;  1U9W A;  4CDC B;  3H89 A;  3E9S A;  1MDW A;  1CVZ A;  3PHU A;  3PRP A;  5JH3 A;  1S4V A;  3WXE A;  3NHE A;  1CPJ A;  3RVV A;  1KHQ A;  3GCB A;  5CHT A;  4MZS A;  4BS6 A;  1AU0 A;  1PBH A;  1M6D A;  5K16 A;  4BOP A;  4N79 A;  1ATK A;  4CDF B;  3C0R A;  2JQG R;  4MI7 A;  2Z84 A;  4CDD B;  1XKG A;  3CH3 X;  3KX1 A;  4BOU A;  2FUD A;  4KLB A;  4R3D A;  5J94 A;  4X6J A;  2F1G A;  1PXV A;  1CSB B;  1CS8 A;  3IV2 A;  4P6G A;  3PSE A;  3IEJ A;  1U9V A;  1A6R A;  3HHI A;  1JQP A; 
#chains in the Genus database with same CATH homology
 1ICF A;  4YYQ A;  4MSX A;  3KSE A;  3H6S A;  3P5U A;  4X6H A;  4FK5 A;  1EWL A;  1ITO A;  4BGF A;  2PRE A;  1AU4 A;  2WBF X;  4QH6 A;  3MTN A;  4Q8H A;  1AIM A;  2FRQ A;  3CBK A;  2HHN A;  3USV A;  1ME4 A;  1CQD A;  1SNK A;  2GHU A;  2VHF A;  4OEM A;  4BPV A;  4B55 A;  3C9E A;  3N3G A;  3WXF A;  1YK8 A;  2AS8 A;  4YYU A;  3F75 A;  1TU6 A;  4PP1 A;  3KWB X;  2DZY A;  3OVZ A;  1O0E A;  4YYW A;  3HWN A;  5CVN B;  2GFO A;  3LXS A;  3KWZ A;  4HWY A;  3RVX A;  4CZW A;  4I04 A;  1CV8 A;  1AU3 A;  2HD5 A;  5FPW A;  3M99 A;  2F7D A;  4XUI A;  1FH0 A;  1Y08 A;  3D6S A;  1BQI A;  1Q6K A;  1EF7 A;  2R9O A;  5CVM A;  1E2T A;  4N8W A;  3BPM A;  4W5B A;  2G6D A;  2ATO A;  1SP4 B;  3OIS A;  2CB5 A;  1TL9 A;  3F5V A;  1KXR A;  2XU1 A;  3PNR A;  2DC7 A;  3MHS A;  3BC3 A;  1TLO A;  2DZZ A;  2DJF B;  3K9M A;  1DEU A;  3LTW A;  9PAP A;  1ZCM A;  1GCB A;  3BOW A;  1PPO A;  2FQ9 A;  4YYV A;  2DCB A;  1PPD A;  3O0U A;  1PPN A;  1ZIV A;  2H7J A;  2R9F A;  2YJ9 A;  4W4U A;  1ME3 A;  2AVW A;  4YYR A;  3D9W A;  1KHP A;  3MOR A;  4BQV A;  2R9N A;  2YJC A;  8PCH A;  2XU5 A;  1MIR A;  2E02 A;  4QRG A;  3QJ3 A;  1NL6 A;  2DC9 A;  2AYN A;  2HH5 A;  4PP2 E;  2FTD A;  3K24 A;  2FO5 A;  3ZUA A;  2E00 A;  4X6I A;  1GEC E;  2E03 A;  2FRA A;  4YVA A;  3IMA A;  3DF0 A;  3I06 A;  2NQG A;  2XU4 A;  1AEC A;  2NQD B;  1MEG A;  1QMY A;  5CVO B;  2DCD A;  3CBJ A;  5F02 A;  2DC6 A;  1AYU A;  1NB3 A;  2PNS A;  1U9Q X;  1F2B A;  5EGW A;  2Y5B A;  4AXM A;  1MEM A;  1EWO A;  2XU3 A;  3HHA A;  2AUZ A;  4QRV A;  2YJ8 A;  3S3R A;  4P6E A;  4N4Z A;  3IUT A;  1YAL A;  1W5R A;  1PAD A;  1PPP A;  5CHV A;  3QSD A;  1F2C A;  4NV7 A;  1YK7 A;  1THE A;  2P0R A;  2IPP B;  2G7Y A;  3BWK A;  3B79 A;  2BDZ A;  1BGO A;  3U8E A;  4ZUX U;  2ARY A;  4XR7 A;  1NLJ A;  2NQI A;  1U9X A;  1PIP A;  3K8U A;  2DJG B;  3P5V A;  3PDF A;  1NB5 A;  1EWM A;  3S3Q A;  2YJ2 A;  2R9M A;  3BCN A;  1MHW A;  4YYS A;  4QRX A;  2CIO A;  1GX3 A;  1VJV A;  2AU1 A;  3N4C A;  1KFX L;  3I3T A;  3PBH A;  7PCK A;  3H8B A;  3QT4 A;  3LFY A;  1U5I A;  2B1M A;  1NPZ A;  4PI3 A;  4K7C A;  1MS6 A;  1NQC A;  6PAD A;  3OVX A;  1GLO A;  1IWD A;  1X9Y A;  5JA7 A;  2FYE A;  4QBB A;  4DMX A;  2C0Y A;  1BY8 A;  3MHH A;  3IHP A;  3N3K A;  4CDE B;  2VFC A;  4MZO A;  1QDQ A;  4I07 A;  3H8C A;  4FJC A;  2AYO A;  1VSN A;  4BSQ A;  2G8E A;  5PAD A;  3E1Z B;  1BP4 A;  2NQA A;  2OUL A;  2ACT A;  2YJB A;  1YVB A;  3ERV A;  1AU2 A;  3H7D A;  1DF0 A;  2O6X A;  4PAD A;  4Q8G A;  2BDL A;  4GUZ A;  4C5P A;  1QXP A;  2AIM A;  1POP A;  2OP3 A;  1PE6 A;  2HXZ A;  4OEL A;  1CTE A;  3TNX A;  3KW9 A;  3V6E A;  2Y6E A;  4WA6 A;  2R9C A;  2VHS A;  4FIP A;  2P7U A;  4G54 A;  1PCI A;  3P5W A;  3HD3 A;  3RVW A;  2DCC A;  1F29 A;  3V6C A;  1HUC B;  3PW3 A;  2G8J A;  1K3B B;  1W6F A;  4DMY A;  1GMY A;  5EF4 A;  4YV8 A;  1AYV A;  3AI8 A;  2IBI A;  1QOL A;  1CB5 A;  3IOQ A;  4AXL A;  1YT7 A;  1Y4H A;  2FT2 A;  2E01 A;  2DC8 A;  4BS5 A;  2OZ2 A;  1CJL A;  2P86 A;  4NV8 A;  2DCA A;  4RY2 A;  3WXG A;  3KKU A;  4W5C A;  4I05 A;  2BSZ A;  3BPF A;  1KFU L;  3OF9 A;  1AYW A;  3P5X A;  1EWP A;  5A24 A;  2R6N A;  1STF E;  2PAD A;  3OF8 A;  2PBH A;  2JQF R;  3CH2 X;  2B1N A;  3KFQ A;  1F2A A;  3O1G A;  2AUX A;  1U9W A;  2VFB A;  4CDC B;  3H89 A;  1MDW A;  1CVZ A;  5JH3 A;  1S4V A;  3WXE A;  1W4T A;  3NHE A;  1CPJ A;  3RVV A;  1KHQ A;  3GCB A;  5CHT A;  4MZS A;  4BS6 A;  1AU0 A;  1PBH A;  1M6D A;  5K16 A;  4N79 A;  1ATK A;  4CDF B;  2JQG R;  4CDD B;  1XKG A;  3CH3 X;  3KX1 A;  2FUD A;  4KLB A;  5J94 A;  4X6J A;  2F1G A;  1PXV A;  1CSB B;  1CS8 A;  3IV2 A;  4P6G A;  3IEJ A;  1U9V A;  1A6R A;  3HHI A;  1JQP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...