3WXGA

Crystal structure of cyld usp domain (c596a) in complex with lys63-linked diubiquitin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
300
Chain Sequence
MGLEVMVGKKKGIQGHYNSAYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQELLRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDLLDQQMELFAVLCIETSHYVAFVKYGSADSAWLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYMCMYQSPTMSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity
doi rcsb
source organism Danio rerio
molecule tags Hydrolase/protein binding
total genus 83
structure length 300
sequence length 309
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3wxgA00
4MSXA 6PADA 3WXGA 1PXVA 2Y6EA 4AXLA 4X6HA 1M6DA 2DC6A 1S4VA 1F2AA 3K24A 2BDZA 4I05A 1U9WA 3AI8A 3USVA 4CDEB 1GMYA 3CH3X 1PCIA 2PBHA 4QRVA 2OZ2A 1MS6A 2NQGA 1Y08A 4AXMA 2AUZA 3V6EA 1X9YA 2NQIA 1QDQA 3NHEA 4BS6A 2XU5A 2AIMA 4OEMA 1U9VA 3MHHA 5CVOB 5J94A 1PIPA 1AYWA 4YYRA 1EWPA 2P0RA 1TLOA 1CTEA 2F7DA 2VHFA 2XU1A 5PADA 2FTDA 3IHPA 1XKGA 3IMAA 3PW3A 2AU1A 3ERVA 1PE6A 1SP4B 2WBFX 4X6JA 3KFQA 3LFYA 2DJFB 3IUTA 1NL6A 1EWMA 1FH0A 1YK7A 2E02A 3KWBX 2DC8A 4WA6A 3B79A 2R9MA 3RVXA 3O1GA 2ATOA 1AECA 1IWDA 5K16A 1YK8A 3H7DA 3P5WA 1BGOA 2NQAA 3N3KA 1GLOA 1TU6A 4CDFB 4FJCA 3OF9A 3OISA 3DF0A 3BC3A 3IOQA 1KFXL 1KXRA 1MIRA 4YYQA 1NPZA 2GFOA 4YYVA 3PNRA 3HHAA 2AYOA 1MDWA 1JQPA 1CQDA 3RVVA 4PP1A 3V6CA 1HUCB 1PPOA 5CHVA 4RY2A 3P5VA 1F2CA 1F29A 3BPMA 3GCBA 4Q8GA 2F1GA 3WXEA 2G8EA 3HHIA 2OP3A 3TNXA 3F5VA 4XR7A 3CH2X 2AVWA 3N4CA 4P6EA 2FO5A 1THEA 1STFE 1CVZA 1U9QX 1K3BB 4FIPA 2DCAA 4ZUXU 1POPA 3KKUA 2YJ2A 4KLBA 4HWYA 1ZCMA 4YVAA 1Q6KA 5CVMA 1A6RA 2VHSA 3I3TA 2DJGB 1ME4A 3K9MA 4G54A 4K7CA 3P5XA 3QSDA 1ME3A 2B1NA 1PADA 1AU2A 2DC9A 2DCCA 1BQIA 3CBKA 3H89A 2PADA 5F02A 4Q8HA 1EWOA 3QJ3A 1ZIVA 3H6SA 1Y4HA 4BS5A 3KX1A 3QT4A 2P7UA 2B1MA 2R9FA 1CV8A 1MHWA 4CZWA 1F2BA 2YJCA 2YJBA 3MHSA 3HD3A 2JQFR 1PPPA 2IBIA 3BPFA 2HD5A 4N4ZA 4W5BA 1CB5A 3I06A 2R9OA 5CVNB 4QRXA 4BPVA 1NQCA 5EF4A 3IEJA 2XU3A 4QH6A 4YYSA 3WXFA 2DZZA 3ZUAA 8PCHA 9PAPA 5JA7A 7PCKA 2E00A 1MEGA 4I07A 2BDLA 1VSNA 2OULA 2G7YA 1NB3A 3RVWA 1NB5A 2E03A 3IV2A 1ITOA 3KSEA 2FT2A 3CBJA 2FRAA 1AYUA 1EWLA 2P86A 4W4UA 2H7JA 2FYEA 1AU0A 3N3GA 1CS8A 1EF7A 3OVZA 2HHNA 3PDFA 4BQVA 1O0EA 1BY8A 1PPNA 3LXSA 1DF0A 2FQ9A 1KHQA 3D6SA 2DCDA 2NQDB 3U8EA 4YYWA 4N79A 3PBHA 2PNSA 2ACTA 1ATKA 3P5UA 1SNKA 2CB5A 2CIOA 3S3QA 4OELA 1NLJA 3KW9A 2O6XA 4BSQA 2YJ8A 2R9CA 3E1ZB 2GHUA 1MEMA 4X6IA 2YJ9A 3C9EA 2G6DA 3O0UA 5A24A 2AS8A 2R9NA 4P6GA 4FK5A 5FPWA 4YYUA 2XU4A 4QRGA 5JH3A 1QXPA 5CHTA 4PADA 3OF8A 1YALA 1AIMA 2ARYA 2JQGR 4CDCB 2C0YA 1CPJA 1TL9A 1PPDA 4I04A 2DC7A 3M99A 3BWKA 1KHPA 3F75A 1AU4A 1ICFA 1YVBA 1QMYA 1AU3A 2R6NA 1GCBA 2FRQA 1CSBB 2E01A 3S3RA 1BP4A 2Y5BA 2AYNA 2DZYA 3K8UA 3H8CA 1AYVA 1DEUA 4PI3A 4MZOA 3BCNA 3H8BA 4XUIA 1KFUL 1QOLA 3MTNA 1PBHA 2DCBA 4PP2E 4W5CA 2G8JA 1VJVA 4CDDB 2AUXA 2IPPB 4DMXA 4QBBA 2HXZA 1U5IA 2PREA 3KWZA 3BOWA 3OVXA 1YT7A 1CJLA 4N8WA 4DMYA 2HH5A 4YV8A 2FUDA 1GECE 1U9XA 5EGWA 3HWNA 3MORA 4MZSA
chains in the Genus database with same CATH superfamily
4MSXA 6PADA 3WXGA 1PXVA 2Y6EA 2BTWB 4AXLA 4X6HA 1M6DA 2DC6A 4BOZA 1S4VA 1F2AA 3K24A 2BDZA 4I05A 1U9WA 3AI8A 3USVA 4CDEB 1GMYA 3CH3X 1PCIA 2PBHA 4QRVA 2OZ2A 1MS6A 2NQGA 1Y08A 4AXMA 2AUZA 3V6EA 2HWKA 1X9YA 2NQIA 4IUMA 1QDQA 3NHEA 4BS6A 2XU5A 2AIMA 4OEMA 1U9VA 4R3DA 3MHHA 5CVOB 5J94A 3BBAA 1PIPA 4BOUA 1AYWA 4YYRA 1EWPA 2P0RA 1TLOA 4RKXA 1CTEA 4OVZA 2F7DA 2VHFA 2XU1A 5PADA 2FTDA 3B21A 3IHPA 1XKGA 3IMAA 2BTWA 3PW3A 2AU1A 3ERVA 1PE6A 1SP4B 2WBFX 3PHXA 4M0WA 5EZSA 4X6JA 3KFQA 3LFYA 2DJFB 3IUTA 3TMPA 1NL6A 1EWMA 1FH0A 1YK7A 2E02A 3KWBX 2DC8A 4WA6A 3B79A 2R9MA 3RVXA 3O1GA 2ATOA 1AECA 1IWDA 5K16A 4ZTBA 4BOSA 1YK8A 3C0RA 5E6JA 3H7DA 3P5WA 1BGOA 2NQAA 4P16A 3N3KA 1GLOA 1TU6A 4CDFB 4FJCA 3OF9A 3OISA 3DF0A 3BC3A 3IOQA 1KFXL 1KXRA 1MIRA 4YYQA 4GUAA 1NPZA 2GFOA 3E9SA 4YYVA 3PNRA 1DKIA 3HHAA 2AYOA 1YZBA 1MDWA 3MP2A 1JQPA 1CQDA 3RVVA 4PP1A 3V6CA 1HUCB 1PPOA 5CHVA 4RY2A 3P5VA 1F2CA 3PRMA 1F29A 3BPMA 3GCBA 4RF1A 4Q8GA 4D8IA 2F1GA 4PT5A 3WXEA 2G8EA 3HHIA 2OP3A 3TNXA 3F5VA 4XR7A 3CH2X 2AVWA 3N4CA 2JTCA 4P6EA 2FO5A 1THEA 1STFE 1CVZA 1U9QX 1K3BB 4FIPA 2DCAA 4ZUXU 4RNAA 1POPA 3KKUA 2YJ2A 4KLBA 4HWYA 1ZCMA 4YVAA 1Q6KA 5CVMA 5EZQA 1A6RA 2VHSA 3I3TA 2DJGB 1ME4A 3K9MA 3MJ5A 4G54A 4K7CA 3P5XA 3QSDA 1ME3A 2B1NA 3PHUA 1PADA 1AU2A 2DC9A 2DCCA 4MI7A 1BQIA 3CBKA 3H89A 2PADA 3O65A 3OQCA 5F02A 4Q8HA 1EWOA 3QJ3A 1ZIVA 3H6SA 3PHWA 1Y4HA 4BS5A 3KX1A 4HXDB 3QT4A 2P7UA 2B1MA 4XZXA 2R9FA 1CV8A 1MHWA 4CZWA 1F2BA 2YJCA 2YJBA 3MHSA 3HD3A 4D8EA 2JQFR 4RF0A 1PPPA 2IBIA 3BPFA 2HD5A 4N4ZA 4W5BA 1CB5A 3I06A 2R9OA 5CVNB 4QRXA 4BPVA 1NQCA 5EF4A 3IEJA 2XU3A 1UKFA 4QH6A 4YYSA 3WXFA 2DZZA 3ZUAA 8PCHA 9PAPA 5JA7A 7PCKA 2E00A 1MEGA 4I07A 3ZNHA 2BDLA 1VSNA 2OULA 2G7YA 1NB3A 3RVWA 1NB5A 2E03A 4BOPA 2JRIA 3IV2A 1ITOA 3KSEA 3TRKA 4IP3A 2FT2A 3CBJA 2FRAA 4REZA 1AYUA 1EWLA 4OW0A 2P86A 4BOQA 4W4UA 2H7JA 2FYEA 1AU0A 3N3GA 1CS8A 3W31A 1EF7A 3OVZA 2HHNA 3PDFA 4BQVA 1O0EA 1BY8A 1PPNA 3LXSA 1DF0A 4A5UA 2FQ9A 3RNVA 1KHQA 3D6SA 2DCDA 2NQDB 3U8EA 4YYWA 4N79A 3PBHA 2PNSA 2ACTA 1ATKA 3P5UA 1SNKA 4MM3B 2CB5A 2CIOA 3S3QA 4OELA 1NLJA 3KW9A 2O6XA 2FE8A 2DOSA 4BSQA 3PSEA 1PVJA 2YJ8A 2R9CA 3E1ZB 2GHUA 2J7QC 1MEMA 4X6IA 2YJ9A 3C9EA 2G6DA 3O0UA 5A24A 2AS8A 2R9NA 4P6GA 2UZJA 4FK5A 4WURA 5FPWA 4YYUA 2XU4A 4QRGA 5JH3A 1QXPA 5CHTA 4PADA 3W30A 3OF8A 3BB7A 5JZEA 1YALA 1AIMA 2ARYA 2JQGR 4CDCB 2C0YA 5KO3A 3IFUA 1CPJA 1TL9A 1PPDA 4I04A 2DC7A 3M99A 3BWKA 1KHPA 3F75A 1AU4A 1ICFA 1YVBA 3BY4A 1QMYA 1AU3A 2R6NA 1GCBA 2FRQA 1CSBB 3PRPA 2E01A 2Z84A 3S3RA 1BP4A 2Y5BA 2AYNA 2DZYA 3K8UA 3H8CA 1AYVA 1DEUA 4PI3A 4MZOA 3BCNA 3PT2A 3H8BA 4XUIA 1KFUL 1QOLA 3MTNA 1PBHA 2DCBA 4PP2E 4W5CA 2G8JA 1VJVA 4CDDB 2AUXA 2IPPB 4DMXA 4QBBA 2HXZA 4D8BA 3MTVA 1U5IA 2AGAA 2PREA 3KWZA 3BOWA 3OVXA 1YT7A 1CJLA 2J7QA 4N8WA 4DMYA 2HH5A 4YV8A 2FUDA 4OVZB 1GECE 1U9XA 5EGWA 3HWNA 2BU3A 3MORA 4MZSA
chains in the Genus database with same CATH topology
4MSXA 6PADA 3WXGA 1PXVA 2Y6EA 4AXLA 4X6HA 1M6DA 2DC6A 1S4VA 1F2AA 3K24A 1E2TA 2BDZA 4I05A 1U9WA 3AI8A 3USVA 4CDEB 1GMYA 3CH3X 1PCIA 2PBHA 4QRVA 2OZ2A 1MS6A 2NQGA 1Y08A 4AXMA 2AUZA 3V6EA 1X9YA 2NQIA 1QDQA 3NHEA 4BS6A 2XU5A 2AIMA 4OEMA 1U9VA 3MHHA 5CVOB 5J94A 1PIPA 1AYWA 1GX3A 4YYRA 1EWPA 2P0RA 1TLOA 1CTEA 2F7DA 2VHFA 2XU1A 5PADA 2FTDA 3IHPA 1XKGA 3IMAA 3PW3A 2AU1A 3ERVA 1PE6A 1SP4B 2WBFX 4X6JA 3KFQA 3LFYA 2DJFB 3IUTA 1NL6A 1EWMA 1FH0A 1YK7A 2E02A 3KWBX 2DC8A 4WA6A 3B79A 2R9MA 3RVXA 3O1GA 2ATOA 1AECA 1IWDA 5K16A 1YK8A 3H7DA 3P5WA 1BGOA 2NQAA 3N3KA 1GLOA 1TU6A 4CDFB 4FJCA 3OF9A 3OISA 2VFBA 3DF0A 4B55A 3BC3A 3IOQA 1KFXL 1KXRA 1MIRA 4YYQA 1NPZA 2BSZA 2GFOA 4YYVA 3PNRA 3HHAA 2AYOA 1MDWA 1JQPA 1CQDA 3RVVA 4PP1A 3V6CA 1HUCB 1PPOA 5CHVA 4RY2A 3P5VA 1F2CA 1F29A 3BPMA 3GCBA 4Q8GA 2F1GA 3WXEA 2G8EA 3HHIA 2OP3A 3TNXA 3F5VA 4XR7A 3CH2X 2AVWA 3N4CA 4P6EA 2FO5A 1THEA 1STFE 1CVZA 1U9QX 1K3BB 4FIPA 2DCAA 4ZUXU 4BGFA 1POPA 3KKUA 2YJ2A 4KLBA 4HWYA 1ZCMA 4YVAA 1Q6KA 5CVMA 2VHSA 1A6RA 3I3TA 2DJGB 1ME4A 3K9MA 1W6FA 4G54A 4K7CA 3P5XA 3QSDA 1ME3A 2B1NA 1PADA 1AU2A 2DC9A 2DCCA 1BQIA 3CBKA 3H89A 2PADA 5F02A 4Q8HA 1EWOA 3QJ3A 1ZIVA 3H6SA 2VFCA 1Y4HA 4BS5A 3KX1A 3QT4A 2P7UA 3LTWA 2B1MA 3D9WA 2R9FA 1CV8A 1MHWA 4CZWA 1F2BA 2YJCA 2YJBA 3MHSA 3HD3A 2JQFR 1PPPA 2IBIA 3BPFA 2HD5A 4N4ZA 4W5BA 1CB5A 3I06A 2R9OA 4NV8A 5CVNB 4QRXA 4BPVA 1NQCA 5EF4A 3IEJA 2XU3A 4QH6A 4YYSA 3WXFA 2DZZA 3ZUAA 8PCHA 9PAPA 5JA7A 7PCKA 2E00A 1MEGA 4I07A 2BDLA 1VSNA 2OULA 2G7YA 1NB3A 4GUZA 3RVWA 1NB5A 2E03A 3IV2A 1ITOA 3KSEA 2FT2A 3CBJA 2FRAA 1AYUA 1EWLA 2P86A 4W4UA 2H7JA 2FYEA 1AU0A 3N3GA 1CS8A 1EF7A 3OVZA 2HHNA 3PDFA 4BQVA 1O0EA 1BY8A 1PPNA 3LXSA 1DF0A 2FQ9A 1KHQA 3D6SA 2DCDA 2NQDB 3U8EA 4YYWA 4N79A 3PBHA 2PNSA 2ACTA 1ATKA 3P5UA 1SNKA 2CB5A 2CIOA 3S3QA 4OELA 1NLJA 3KW9A 2O6XA 4BSQA 2YJ8A 2R9CA 3E1ZB 2GHUA 1MEMA 4X6IA 2YJ9A 3C9EA 2G6DA 3O0UA 5A24A 2AS8A 2R9NA 4P6GA 4FK5A 5FPWA 4YYUA 2XU4A 4QRGA 5JH3A 1QXPA 5CHTA 4PADA 3OF8A 4NV7A 1YALA 1AIMA 2ARYA 2JQGR 4CDCB 2C0YA 1CPJA 1TL9A 1PPDA 4I04A 2DC7A 3M99A 3BWKA 1KHPA 3F75A 1AU4A 1ICFA 1YVBA 1QMYA 1AU3A 2R6NA 1GCBA 2FRQA 1CSBB 2E01A 3S3RA 1BP4A 2Y5BA 3K8UA 2AYNA 2DZYA 1W5RA 3H8CA 1AYVA 1DEUA 4PI3A 4MZOA 3BCNA 1W4TA 3H8BA 4XUIA 1KFUL 1QOLA 3MTNA 1PBHA 2DCBA 4PP2E 4W5CA 2G8JA 1VJVA 4CDDB 2AUXA 2IPPB 4DMXA 4QBBA 2HXZA 1U5IA 2PREA 3KWZA 3BOWA 3OVXA 1YT7A 1CJLA 4N8WA 4DMYA 2HH5A 4YV8A 2FUDA 1GECE 1U9XA 5EGWA 3HWNA 3MORA 4C5PA 4MZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  6PAD A;  3WXG A;  1PXV A;  2Y6E A;  4AXL A;  4X6H A;  1M6D A;  2DC6 A;  1S4V A;  1F2A A;  3K24 A;  2BDZ A;  4I05 A;  1U9W A;  3AI8 A;  3USV A;  4CDE B;  1GMY A;  3CH3 X;  1PCI A;  2PBH A;  4QRV A;  2OZ2 A;  1MS6 A;  2NQG A;  1Y08 A;  4AXM A;  2AUZ A;  3V6E A;  1X9Y A;  2NQI A;  1QDQ A;  3NHE A;  4BS6 A;  2XU5 A;  2AIM A;  4OEM A;  1U9V A;  3MHH A;  5CVO B;  5J94 A;  1PIP A;  1AYW A;  4YYR A;  1EWP A;  2P0R A;  1TLO A;  1CTE A;  2F7D A;  2VHF A;  2XU1 A;  5PAD A;  2FTD A;  3IHP A;  1XKG A;  3IMA A;  3PW3 A;  2AU1 A;  3ERV A;  1PE6 A;  1SP4 B;  2WBF X;  4X6J A;  3KFQ A;  3LFY A;  2DJF B;  3IUT A;  1NL6 A;  1EWM A;  1FH0 A;  1YK7 A;  2E02 A;  3KWB X;  2DC8 A;  4WA6 A;  3B79 A;  2R9M A;  3RVX A;  3O1G A;  2ATO A;  1AEC A;  1IWD A;  5K16 A;  1YK8 A;  3H7D A;  3P5W A;  1BGO A;  2NQA A;  3N3K A;  1GLO A;  1TU6 A;  4CDF B;  4FJC A;  3OF9 A;  3OIS A;  3DF0 A;  3BC3 A;  3IOQ A;  1KFX L;  1KXR A;  1MIR A;  4YYQ A;  1NPZ A;  2GFO A;  4YYV A;  3PNR A;  3HHA A;  2AYO A;  1MDW A;  1JQP A;  1CQD A;  3RVV A;  4PP1 A;  3V6C A;  1HUC B;  1PPO A;  5CHV A;  4RY2 A;  3P5V A;  1F2C A;  1F29 A;  3BPM A;  3GCB A;  4Q8G A;  2F1G A;  3WXE A;  2G8E A;  3HHI A;  2OP3 A;  3TNX A;  3F5V A;  4XR7 A;  3CH2 X;  2AVW A;  3N4C A;  4P6E A;  2FO5 A;  1THE A;  1STF E;  1CVZ A;  1U9Q X;  1K3B B;  4FIP A;  2DCA A;  4ZUX U;  1POP A;  3KKU A;  2YJ2 A;  4KLB A;  4HWY A;  1ZCM A;  4YVA A;  1Q6K A;  5CVM A;  1A6R A;  2VHS A;  3I3T A;  2DJG B;  1ME4 A;  3K9M A;  4G54 A;  4K7C A;  3P5X A;  3QSD A;  1ME3 A;  2B1N A;  1PAD A;  1AU2 A;  2DC9 A;  2DCC A;  1BQI A;  3CBK A;  3H89 A;  2PAD A;  5F02 A;  4Q8H A;  1EWO A;  3QJ3 A;  1ZIV A;  3H6S A;  1Y4H A;  4BS5 A;  3KX1 A;  3QT4 A;  2P7U A;  2B1M A;  2R9F A;  1CV8 A;  1MHW A;  4CZW A;  1F2B A;  2YJC A;  2YJB A;  3MHS A;  3HD3 A;  2JQF R;  1PPP A;  2IBI A;  3BPF A;  2HD5 A;  4N4Z A;  4W5B A;  1CB5 A;  3I06 A;  2R9O A;  5CVN B;  4QRX A;  4BPV A;  1NQC A;  5EF4 A;  3IEJ A;  2XU3 A;  4QH6 A;  4YYS A;  3WXF A;  2DZZ A;  3ZUA A;  8PCH A;  9PAP A;  5JA7 A;  7PCK A;  2E00 A;  1MEG A;  4I07 A;  2BDL A;  1VSN A;  2OUL A;  2G7Y A;  1NB3 A;  3RVW A;  1NB5 A;  2E03 A;  3IV2 A;  1ITO A;  3KSE A;  2FT2 A;  3CBJ A;  2FRA A;  1AYU A;  1EWL A;  2P86 A;  4W4U A;  2H7J A;  2FYE A;  1AU0 A;  3N3G A;  1CS8 A;  1EF7 A;  3OVZ A;  2HHN A;  3PDF A;  4BQV A;  1O0E A;  1BY8 A;  1PPN A;  3LXS A;  1DF0 A;  2FQ9 A;  1KHQ A;  3D6S A;  2DCD A;  2NQD B;  3U8E A;  4YYW A;  4N79 A;  3PBH A;  2PNS A;  2ACT A;  1ATK A;  3P5U A;  1SNK A;  2CB5 A;  2CIO A;  3S3Q A;  4OEL A;  1NLJ A;  3KW9 A;  2O6X A;  4BSQ A;  2YJ8 A;  2R9C A;  3E1Z B;  2GHU A;  1MEM A;  4X6I A;  2YJ9 A;  3C9E A;  2G6D A;  3O0U A;  5A24 A;  2AS8 A;  2R9N A;  4P6G A;  4FK5 A;  5FPW A;  4YYU A;  2XU4 A;  4QRG A;  5JH3 A;  1QXP A;  5CHT A;  4PAD A;  3OF8 A;  1YAL A;  1AIM A;  2ARY A;  2JQG R;  4CDC B;  2C0Y A;  1CPJ A;  1TL9 A;  1PPD A;  4I04 A;  2DC7 A;  3M99 A;  3BWK A;  1KHP A;  3F75 A;  1AU4 A;  1ICF A;  1YVB A;  1QMY A;  1AU3 A;  2R6N A;  1GCB A;  2FRQ A;  1CSB B;  2E01 A;  3S3R A;  1BP4 A;  2Y5B A;  2AYN A;  2DZY A;  3K8U A;  3H8C A;  1AYV A;  1DEU A;  4PI3 A;  4MZO A;  3BCN A;  3H8B A;  4XUI A;  1KFU L;  1QOL A;  3MTN A;  1PBH A;  2DCB A;  4PP2 E;  4W5C A;  2G8J A;  1VJV A;  4CDD B;  2AUX A;  2IPP B;  4DMX A;  4QBB A;  2HXZ A;  1U5I A;  2PRE A;  3KWZ A;  3BOW A;  3OVX A;  1YT7 A;  1CJL A;  4N8W A;  4DMY A;  2HH5 A;  4YV8 A;  2FUD A;  1GEC E;  1U9X A;  5EGW A;  3HWN A;  3MOR A;  4MZS A; 
#chains in the Genus database with same CATH topology
 4MSX A;  6PAD A;  3WXG A;  1PXV A;  2Y6E A;  2BTW B;  4AXL A;  4X6H A;  1M6D A;  2DC6 A;  4BOZ A;  1S4V A;  1F2A A;  3K24 A;  2BDZ A;  4I05 A;  1U9W A;  3AI8 A;  3USV A;  4CDE B;  1GMY A;  3CH3 X;  1PCI A;  2PBH A;  4QRV A;  2OZ2 A;  1MS6 A;  2NQG A;  1Y08 A;  4AXM A;  2AUZ A;  3V6E A;  2HWK A;  1X9Y A;  2NQI A;  4IUM A;  1QDQ A;  3NHE A;  4BS6 A;  2XU5 A;  2AIM A;  4OEM A;  1U9V A;  4R3D A;  3MHH A;  5CVO B;  5J94 A;  3BBA A;  1PIP A;  4BOU A;  1AYW A;  4YYR A;  1EWP A;  2P0R A;  1TLO A;  4RKX A;  1CTE A;  4OVZ A;  2F7D A;  2VHF A;  2XU1 A;  5PAD A;  2FTD A;  3B21 A;  3IHP A;  1XKG A;  3IMA A;  2BTW A;  3PW3 A;  2AU1 A;  3ERV A;  1PE6 A;  1SP4 B;  2WBF X;  3PHX A;  4M0W A;  5EZS A;  4X6J A;  3KFQ A;  3LFY A;  2DJF B;  3IUT A;  3TMP A;  1NL6 A;  1EWM A;  1FH0 A;  1YK7 A;  2E02 A;  3KWB X;  2DC8 A;  4WA6 A;  3B79 A;  2R9M A;  3RVX A;  3O1G A;  2ATO A;  1AEC A;  1IWD A;  5K16 A;  4ZTB A;  4BOS A;  1YK8 A;  3C0R A;  5E6J A;  3H7D A;  3P5W A;  1BGO A;  2NQA A;  4P16 A;  3N3K A;  1GLO A;  1TU6 A;  4CDF B;  4FJC A;  3OF9 A;  3OIS A;  3DF0 A;  3BC3 A;  3IOQ A;  1KFX L;  1KXR A;  1MIR A;  4YYQ A;  4GUA A;  1NPZ A;  2GFO A;  3E9S A;  4YYV A;  3PNR A;  1DKI A;  3HHA A;  2AYO A;  1YZB A;  1MDW A;  3MP2 A;  1JQP A;  1CQD A;  3RVV A;  4PP1 A;  3V6C A;  1HUC B;  1PPO A;  5CHV A;  4RY2 A;  3P5V A;  1F2C A;  3PRM A;  1F29 A;  3BPM A;  3GCB A;  4RF1 A;  4Q8G A;  4D8I A;  2F1G A;  4PT5 A;  3WXE A;  2G8E A;  3HHI A;  2OP3 A;  3TNX A;  3F5V A;  4XR7 A;  3CH2 X;  2AVW A;  3N4C A;  2JTC A;  4P6E A;  2FO5 A;  1THE A;  1STF E;  1CVZ A;  1U9Q X;  1K3B B;  4FIP A;  2DCA A;  4ZUX U;  4RNA A;  1POP A;  3KKU A;  2YJ2 A;  4KLB A;  4HWY A;  1ZCM A;  4YVA A;  1Q6K A;  5CVM A;  5EZQ A;  1A6R A;  2VHS A;  3I3T A;  2DJG B;  1ME4 A;  3K9M A;  3MJ5 A;  4G54 A;  4K7C A;  3P5X A;  3QSD A;  1ME3 A;  2B1N A;  3PHU A;  1PAD A;  1AU2 A;  2DC9 A;  2DCC A;  4MI7 A;  1BQI A;  3CBK A;  3H89 A;  2PAD A;  3O65 A;  3OQC A;  5F02 A;  4Q8H A;  1EWO A;  3QJ3 A;  1ZIV A;  3H6S A;  3PHW A;  1Y4H A;  4BS5 A;  3KX1 A;  4HXD B;  3QT4 A;  2P7U A;  2B1M A;  4XZX A;  2R9F A;  1CV8 A;  1MHW A;  4CZW A;  1F2B A;  2YJC A;  2YJB A;  3MHS A;  3HD3 A;  4D8E A;  2JQF R;  4RF0 A;  1PPP A;  2IBI A;  3BPF A;  2HD5 A;  4N4Z A;  4W5B A;  1CB5 A;  3I06 A;  2R9O A;  5CVN B;  4QRX A;  4BPV A;  1NQC A;  5EF4 A;  3IEJ A;  2XU3 A;  1UKF A;  4QH6 A;  4YYS A;  3WXF A;  2DZZ A;  3ZUA A;  8PCH A;  9PAP A;  5JA7 A;  7PCK A;  2E00 A;  1MEG A;  4I07 A;  3ZNH A;  2BDL A;  1VSN A;  2OUL A;  2G7Y A;  1NB3 A;  3RVW A;  1NB5 A;  2E03 A;  4BOP A;  2JRI A;  3IV2 A;  1ITO A;  3KSE A;  3TRK A;  4IP3 A;  2FT2 A;  3CBJ A;  2FRA A;  4REZ A;  1AYU A;  1EWL A;  4OW0 A;  2P86 A;  4BOQ A;  4W4U A;  2H7J A;  2FYE A;  1AU0 A;  3N3G A;  1CS8 A;  3W31 A;  1EF7 A;  3OVZ A;  2HHN A;  3PDF A;  4BQV A;  1O0E A;  1BY8 A;  1PPN A;  3LXS A;  1DF0 A;  4A5U A;  2FQ9 A;  3RNV A;  1KHQ A;  3D6S A;  2DCD A;  2NQD B;  3U8E A;  4YYW A;  4N79 A;  3PBH A;  2PNS A;  2ACT A;  1ATK A;  3P5U A;  1SNK A;  4MM3 B;  2CB5 A;  2CIO A;  3S3Q A;  4OEL A;  1NLJ A;  3KW9 A;  2O6X A;  2FE8 A;  2DOS A;  4BSQ A;  3PSE A;  1PVJ A;  2YJ8 A;  2R9C A;  3E1Z B;  2GHU A;  2J7Q C;  1MEM A;  4X6I A;  2YJ9 A;  3C9E A;  2G6D A;  3O0U A;  5A24 A;  2AS8 A;  2R9N A;  4P6G A;  2UZJ A;  4FK5 A;  4WUR A;  5FPW A;  4YYU A;  2XU4 A;  4QRG A;  5JH3 A;  1QXP A;  5CHT A;  4PAD A;  3W30 A;  3OF8 A;  3BB7 A;  5JZE A;  1YAL A;  1AIM A;  2ARY A;  2JQG R;  4CDC B;  2C0Y A;  5KO3 A;  3IFU A;  1CPJ A;  1TL9 A;  1PPD A;  4I04 A;  2DC7 A;  3M99 A;  3BWK A;  1KHP A;  3F75 A;  1AU4 A;  1ICF A;  1YVB A;  3BY4 A;  1QMY A;  1AU3 A;  2R6N A;  1GCB A;  2FRQ A;  1CSB B;  3PRP A;  2E01 A;  2Z84 A;  3S3R A;  1BP4 A;  2Y5B A;  2AYN A;  2DZY A;  3K8U A;  3H8C A;  1AYV A;  1DEU A;  4PI3 A;  4MZO A;  3BCN A;  3PT2 A;  3H8B A;  4XUI A;  1KFU L;  1QOL A;  3MTN A;  1PBH A;  2DCB A;  4PP2 E;  4W5C A;  2G8J A;  1VJV A;  4CDD B;  2AUX A;  2IPP B;  4DMX A;  4QBB A;  2HXZ A;  4D8B A;  3MTV A;  1U5I A;  2AGA A;  2PRE A;  3KWZ A;  3BOW A;  3OVX A;  1YT7 A;  1CJL A;  2J7Q A;  4N8W A;  4DMY A;  2HH5 A;  4YV8 A;  2FUD A;  4OVZ B;  1GEC E;  1U9X A;  5EGW A;  3HWN A;  2BU3 A;  3MOR A;  4MZS A; 
#chains in the Genus database with same CATH homology
 4MSX A;  6PAD A;  3WXG A;  1PXV A;  2Y6E A;  4AXL A;  4X6H A;  1M6D A;  2DC6 A;  1S4V A;  1F2A A;  3K24 A;  1E2T A;  2BDZ A;  4I05 A;  1U9W A;  3AI8 A;  3USV A;  4CDE B;  1GMY A;  3CH3 X;  1PCI A;  2PBH A;  4QRV A;  2OZ2 A;  1MS6 A;  2NQG A;  1Y08 A;  4AXM A;  2AUZ A;  3V6E A;  1X9Y A;  2NQI A;  1QDQ A;  3NHE A;  4BS6 A;  2XU5 A;  2AIM A;  4OEM A;  1U9V A;  3MHH A;  5CVO B;  5J94 A;  1PIP A;  1AYW A;  1GX3 A;  4YYR A;  1EWP A;  2P0R A;  1TLO A;  1CTE A;  2F7D A;  2VHF A;  2XU1 A;  5PAD A;  2FTD A;  3IHP A;  1XKG A;  3IMA A;  3PW3 A;  2AU1 A;  3ERV A;  1PE6 A;  1SP4 B;  2WBF X;  4X6J A;  3KFQ A;  3LFY A;  2DJF B;  3IUT A;  1NL6 A;  1EWM A;  1FH0 A;  1YK7 A;  2E02 A;  3KWB X;  2DC8 A;  4WA6 A;  3B79 A;  2R9M A;  3RVX A;  3O1G A;  2ATO A;  1AEC A;  1IWD A;  5K16 A;  1YK8 A;  3H7D A;  3P5W A;  1BGO A;  2NQA A;  3N3K A;  1GLO A;  1TU6 A;  4CDF B;  4FJC A;  3OF9 A;  3OIS A;  2VFB A;  3DF0 A;  4B55 A;  3BC3 A;  3IOQ A;  1KFX L;  1KXR A;  1MIR A;  4YYQ A;  1NPZ A;  2BSZ A;  2GFO A;  4YYV A;  3PNR A;  3HHA A;  2AYO A;  1MDW A;  1JQP A;  1CQD A;  3RVV A;  4PP1 A;  3V6C A;  1HUC B;  1PPO A;  5CHV A;  4RY2 A;  3P5V A;  1F2C A;  1F29 A;  3BPM A;  3GCB A;  4Q8G A;  2F1G A;  3WXE A;  2G8E A;  3HHI A;  2OP3 A;  3TNX A;  3F5V A;  4XR7 A;  3CH2 X;  2AVW A;  3N4C A;  4P6E A;  2FO5 A;  1THE A;  1STF E;  1CVZ A;  1U9Q X;  1K3B B;  4FIP A;  2DCA A;  4ZUX U;  4BGF A;  1POP A;  3KKU A;  2YJ2 A;  4KLB A;  4HWY A;  1ZCM A;  4YVA A;  1Q6K A;  5CVM A;  2VHS A;  1A6R A;  3I3T A;  2DJG B;  1ME4 A;  3K9M A;  1W6F A;  4G54 A;  4K7C A;  3P5X A;  3QSD A;  1ME3 A;  2B1N A;  1PAD A;  1AU2 A;  2DC9 A;  2DCC A;  1BQI A;  3CBK A;  3H89 A;  2PAD A;  5F02 A;  4Q8H A;  1EWO A;  3QJ3 A;  1ZIV A;  3H6S A;  2VFC A;  1Y4H A;  4BS5 A;  3KX1 A;  3QT4 A;  2P7U A;  3LTW A;  2B1M A;  3D9W A;  2R9F A;  1CV8 A;  1MHW A;  4CZW A;  1F2B A;  2YJC A;  2YJB A;  3MHS A;  3HD3 A;  2JQF R;  1PPP A;  2IBI A;  3BPF A;  2HD5 A;  4N4Z A;  4W5B A;  1CB5 A;  3I06 A;  2R9O A;  4NV8 A;  5CVN B;  4QRX A;  4BPV A;  1NQC A;  5EF4 A;  3IEJ A;  2XU3 A;  4QH6 A;  4YYS A;  3WXF A;  2DZZ A;  3ZUA A;  8PCH A;  9PAP A;  5JA7 A;  7PCK A;  2E00 A;  1MEG A;  4I07 A;  2BDL A;  1VSN A;  2OUL A;  2G7Y A;  1NB3 A;  4GUZ A;  3RVW A;  1NB5 A;  2E03 A;  3IV2 A;  1ITO A;  3KSE A;  2FT2 A;  3CBJ A;  2FRA A;  1AYU A;  1EWL A;  2P86 A;  4W4U A;  2H7J A;  2FYE A;  1AU0 A;  3N3G A;  1CS8 A;  1EF7 A;  3OVZ A;  2HHN A;  3PDF A;  4BQV A;  1O0E A;  1BY8 A;  1PPN A;  3LXS A;  1DF0 A;  2FQ9 A;  1KHQ A;  3D6S A;  2DCD A;  2NQD B;  3U8E A;  4YYW A;  4N79 A;  3PBH A;  2PNS A;  2ACT A;  1ATK A;  3P5U A;  1SNK A;  2CB5 A;  2CIO A;  3S3Q A;  4OEL A;  1NLJ A;  3KW9 A;  2O6X A;  4BSQ A;  2YJ8 A;  2R9C A;  3E1Z B;  2GHU A;  1MEM A;  4X6I A;  2YJ9 A;  3C9E A;  2G6D A;  3O0U A;  5A24 A;  2AS8 A;  2R9N A;  4P6G A;  4FK5 A;  5FPW A;  4YYU A;  2XU4 A;  4QRG A;  5JH3 A;  1QXP A;  5CHT A;  4PAD A;  3OF8 A;  4NV7 A;  1YAL A;  1AIM A;  2ARY A;  2JQG R;  4CDC B;  2C0Y A;  1CPJ A;  1TL9 A;  1PPD A;  4I04 A;  2DC7 A;  3M99 A;  3BWK A;  1KHP A;  3F75 A;  1AU4 A;  1ICF A;  1YVB A;  1QMY A;  1AU3 A;  2R6N A;  1GCB A;  2FRQ A;  1CSB B;  2E01 A;  3S3R A;  1BP4 A;  2Y5B A;  3K8U A;  2AYN A;  2DZY A;  1W5R A;  3H8C A;  1AYV A;  1DEU A;  4PI3 A;  4MZO A;  3BCN A;  1W4T A;  3H8B A;  4XUI A;  1KFU L;  1QOL A;  3MTN A;  1PBH A;  2DCB A;  4PP2 E;  4W5C A;  2G8J A;  1VJV A;  4CDD B;  2AUX A;  2IPP B;  4DMX A;  4QBB A;  2HXZ A;  1U5I A;  2PRE A;  3KWZ A;  3BOW A;  3OVX A;  1YT7 A;  1CJL A;  4N8W A;  4DMY A;  2HH5 A;  4YV8 A;  2FUD A;  1GEC E;  1U9X A;  5EGW A;  3HWN A;  3MOR A;  4C5P A;  4MZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...