1CV8A

Staphopain, cysteine proteinase from staphylococcus aureus v8
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
b'NEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFGQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHOPAIN
publication title Crystal Structure of a Thiol Proteinase from Staphylococcus Aureus V-8 in the E-64 Inhibitor Complex
pubmed rcsb
molecule tags Cysteine protease
total genus 55
structure length 173
sequence length 173
ec nomenclature ec 3.4.22.48: Staphopain.
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05543 Peptidase_C47 Staphopain peptidase C47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1cv8A00
5CVOB 1TL9A 3KW9A 1MDWA 2E02A 1VSNA 2XU4A 3RVWA 3MHHA 2ARYA 4QH6A 3MORA 8PCHA 1AYVA 2FT2A 2HD5A 2OZ2A 4AXMA 3H8BA 2G6DA 1KHQA 1PIPA 3H6SA 1IWDA 5PADA 2R9NA 3RVVA 1CTEA 2R9FA 1AU4A 3K9MA 2AIMA 4I04A 1X9YA 3MHSA 1KFXL 1M6DA 2DZZA 4BSQA 1ME3A 1SP4B 1YT7A 2H7JA 1DEUA 2HXZA 3CBJA 5JH3A 2NQDB 4QBBA 2DCCA 2E00A 4FJCA 4QRVA 3D6SA 2DC9A 4WA6A 3U8EA 1U9WA 3PBHA 1CV8A 2AUZA 1PPDA 2DCDA 1AIMA 3NHEA 1U9XA 2XU5A 2PNSA 4QRGA 4YYVA 1ZCMA 2AYOA 1MIRA 2JQFR 4N79A 1QOLA 5EF4A 3ZUAA 4CZWA 4BQVA 1CQDA 2ACTA 3AI8A 1Y4HA 1MHWA 3QJ3A 3S3QA 1YK8A 1BQIA 1STFE 1NLJA 1U9VA 3P5WA 2YJBA 2OP3A 4MZSA 3CBKA 2PBHA 3H89A 1K3BB 1PPPA 2NQGA 2YJ8A 4HWYA 2WBFX 3IUTA 1EWOA 1YALA 3OISA 1KXRA 1F29A 1GMYA 2JQGR 5K16A 3BPMA 1F2BA 1AECA 2DJGB 1AYWA 4PI3A 1CS8A 1GCBA 1BY8A 1F2CA 1AU2A 1PBHA 1NL6A 3N4CA 2FO5A 3MTNA 2PADA 2CIOA 2G7YA 4W5CA 6PADA 3P5VA 1AYUA 2DJFB 3KSEA 3K24A 1ZIVA 9PAPA 3C9EA 4CDDB 1Y08A 3TNXA 1QXPA 4P6EA 4YV8A 1ITOA 1MEMA 1CB5A 1XKGA 2FUDA 4FIPA 4KLBA 3PW3A 4MZOA 2P0RA 2AU1A 2FYEA 5FPWA 1HUCB 4PADA 1SNKA 1TU6A 2DC7A 1DF0A 3KX1A 3LFYA 3O0UA 3P5UA 3KWZA 3OF9A 2IPPB 2P86A 3LXSA 3QT4A 2F1GA 4YYQA 3RVXA 3CH2X 3N3GA 1U9QX 4XUIA 1EF7A 3S3RA 3BPFA 1TLOA 2Y5BA 2BDLA 2R6NA 3HD3A 1CVZA 2IBIA 1BGOA 2AUXA 3OVXA 2HH5A 4X6HA 4G54A 2NQIA 2R9OA 3BC3A 5CVNB 5CVMA 2FRQA 2P7UA 4QRXA 2CB5A 1PPOA 2DZYA 3F5VA 4PP2E 3IHPA 1ATKA 2AVWA 4P6GA 4CDCB 1KFUL 4W4UA 4BS5A 3OVZA 1NB3A 3IOQA 1KHPA 2R9MA 5CHTA 2HHNA 1ICFA 1JQPA 5A24A 1A6RA 2DCAA 1GLOA 3H7DA 1NB5A 3QSDA 3H8CA 3CH3X 1PXVA 2OULA 7PCKA 4ZUXU 4FK5A 2Y6EA 3N3KA 1FH0A 4YYSA 2G8JA 1PCIA 4PP1A 4DMYA 3WXEA 3USVA 4OELA 5JA7A 5F02A 2GFOA 3IEJA 3KFQA 3BOWA 4I05A 2VHSA 2B1NA 5J94A 1F2AA 4N4ZA 3V6EA 3KKUA 2YJ9A 2R9CA 2F7DA 1EWPA 1YK7A 3E1ZB 1ME4A 4CDEB 4K7CA 2FQ9A 4W5BA 1POPA 1VJVA 1QDQA 4N8WA 2B1MA 3KWBX 4RY2A 3B79A 2NQAA 4CDFB 2ATOA 4BS6A 1O0EA 4X6IA 2DC6A 4X6JA 4YYUA 3O1GA 1PE6A 4XR7A 1MS6A 3I3TA 4YVAA 4YYRA 1YVBA 3WXGA 2E03A 2E01A 1GECE 1CSBB 2DC8A 3BCNA 1CPJA 3F75A 3BWKA 3IMAA 1U5IA 1THEA 3WXFA 1QMYA 1EWMA 3PDFA 4Q8HA 1AU0A 3P5XA 1PADA 5CHVA 2FRAA 1PPNA 2XU3A 2PREA 1NPZA 4Q8GA 4BPVA 4I07A 2FTDA 3K8UA 2YJCA 1Q6KA 3ERVA 2DCBA 3HHAA 2VHFA 4YYWA 2AYNA 4AXLA 2GHUA 5EGWA 3I06A 3V6CA 1S4VA 2BDZA 3M99A 3DF0A 1BP4A 3HWNA 1MEGA 4MSXA 2XU1A 1AU3A 3HHIA 3GCBA 3OF8A 3IV2A 2O6XA 3PNRA 1NQCA 1CJLA 2AS8A 4OEMA 2G8EA 2YJ2A 1EWLA 4DMXA 2C0YA
chains in the Genus database with same CATH superfamily
5CVOB 4IUMA 1TL9A 3KW9A 1MDWA 2E02A 1VSNA 2XU4A 3RVWA 3MHHA 2ARYA 4QH6A 4XZXA 3MORA 8PCHA 1AYVA 2FT2A 2HD5A 2OZ2A 4AXMA 1YZBA 3H8BA 2G6DA 1KHQA 1PIPA 2BU3A 3H6SA 1IWDA 5PADA 2R9NA 3RVVA 4R3DA 1CTEA 2R9FA 1AU4A 3K9MA 2AIMA 4I04A 1X9YA 3MHSA 3MP2A 1KFXL 1M6DA 2DZZA 4RF0A 3PRPA 4BSQA 1ME3A 1SP4B 1YT7A 2H7JA 1DEUA 2HXZA 2UZJA 3CBJA 5JH3A 2NQDB 4QBBA 2DCCA 2E00A 4FJCA 4QRVA 3D6SA 1UKFA 2DC9A 4WA6A 3U8EA 1U9WA 3PBHA 1CV8A 2AUZA 1PPDA 2DCDA 4M0WA 1AIMA 3NHEA 1U9XA 2JTCA 2XU5A 2PNSA 4QRGA 4YYVA 1ZCMA 2DOSA 5JZEA 2AYOA 1MIRA 2JQFR 3MJ5A 4N79A 1QOLA 5EF4A 3ZUAA 4CZWA 4BQVA 1CQDA 4WURA 2ACTA 3AI8A 1Y4HA 1MHWA 3QJ3A 3PSEA 5EZSA 1YK8A 1BQIA 3S3QA 1STFE 1NLJA 1U9VA 3P5WA 2YJBA 2OP3A 4MZSA 3CBKA 2PBHA 3H89A 1K3BB 1PPPA 2NQGA 2YJ8A 4HWYA 5KO3A 2WBFX 3IUTA 1EWOA 2J7QC 1YALA 3OISA 1KXRA 1F29A 1GMYA 2JQGR 3ZNHA 5K16A 3BPMA 1F2BA 1AECA 2DJGB 1AYWA 4PI3A 1CS8A 1GCBA 1BY8A 4RF1A 1F2CA 1AU2A 1PBHA 3MTVA 1NL6A 3N4CA 2FO5A 3MTNA 2PADA 2CIOA 2G7YA 4BOUA 4W5CA 6PADA 3P5VA 1AYUA 2DJFB 3KSEA 3K24A 1ZIVA 9PAPA 3C9EA 4CDDB 1Y08A 3TNXA 1QXPA 4P6EA 4YV8A 4P16A 1ITOA 1MEMA 1CB5A 1XKGA 2FUDA 4FIPA 3PHUA 4KLBA 3PW3A 4MZOA 2P0RA 5EZQA 2AU1A 4HXDB 2FYEA 5FPWA 1HUCB 4PADA 1SNKA 2BTWB 1TU6A 2DC7A 4ZTBA 1DF0A 3KX1A 3OQCA 3LFYA 3O0UA 3P5UA 3KWZA 4D8IA 3OF9A 4D8EA 2IPPB 2P86A 3LXSA 4REZA 3QT4A 2F1GA 4YYQA 3RVXA 3CH2X 3N3GA 4BOSA 1U9QX 4XUIA 1EF7A 3S3RA 3BPFA 1TLOA 4BOZA 2Y5BA 2BDLA 4OW0A 2R6NA 3HD3A 3PHWA 3C0RA 3BY4A 1CVZA 2IBIA 3PRMA 1BGOA 2AUXA 3OVXA 2HH5A 4X6HA 4G54A 2NQIA 2R9OA 3BC3A 5CVNB 5CVMA 2FRQA 2P7UA 4MM3B 4QRXA 2CB5A 4BOPA 1PPOA 4RNAA 2DZYA 3F5VA 4PP2E 3IHPA 1ATKA 2AVWA 4P6GA 4CDCB 1KFUL 4W4UA 4BS5A 3OVZA 2J7QA 1NB3A 3IOQA 1KHPA 2R9MA 5CHTA 2HHNA 1ICFA 1JQPA 5A24A 1A6RA 2DCAA 1GLOA 3H7DA 1NB5A 3BBAA 3QSDA 3H8CA 3CH3X 1PXVA 2OULA 7PCKA 3W31A 4ZUXU 4FK5A 2Y6EA 3N3KA 1FH0A 4YYSA 2G8JA 1PCIA 4PP1A 4DMYA 3WXEA 3USVA 4OELA 4BOQA 2AGAA 5F02A 2GFOA 3E9SA 3IEJA 5JA7A 3KFQA 3BOWA 4I05A 2VHSA 3B21A 2B1NA 5J94A 2JRIA 1F2AA 4N4ZA 3V6EA 3KKUA 2YJ9A 2R9CA 2F7DA 1EWPA 4PT5A 4OVZA 3PHXA 1YK7A 1DKIA 3E1ZB 1ME4A 4CDEB 4K7CA 4IP3A 2FQ9A 2Z84A 4W5BA 4A5UA 2HWKA 1POPA 1VJVA 1PVJA 1QDQA 4N8WA 2B1MA 3KWBX 4RY2A 3B79A 2NQAA 4CDFB 2ATOA 3BB7A 4BS6A 1O0EA 4X6IA 2DC6A 4MI7A 4X6JA 4YYUA 3O1GA 1PE6A 4XR7A 1MS6A 3I3TA 4YVAA 4YYRA 1YVBA 3WXGA 2E03A 2E01A 2FE8A 3O65A 1GECE 1CSBB 2DC8A 3BCNA 1CPJA 3F75A 3BWKA 3IMAA 1U5IA 4OVZB 1THEA 3WXFA 1QMYA 1EWMA 3PDFA 4Q8HA 5E6JA 1AU0A 3P5XA 1PADA 5CHVA 2FRAA 1PPNA 3TRKA 2XU3A 2PREA 1NPZA 4GUAA 4Q8GA 4BPVA 3RNVA 4I07A 2FTDA 3K8UA 2YJCA 1Q6KA 3ERVA 2DCBA 3HHAA 2VHFA 4YYWA 2AYNA 4AXLA 2GHUA 5EGWA 3I06A 3V6CA 1S4VA 2BDZA 3M99A 3DF0A 1BP4A 3HWNA 1MEGA 4MSXA 4RKXA 2XU1A 1AU3A 3HHIA 3GCBA 3IFUA 3OF8A 4D8BA 3IV2A 3TMPA 2O6XA 3PNRA 1NQCA 1CJLA 2AS8A 4OEMA 2G8EA 2BTWA 3PT2A 3W30A 2YJ2A 1EWLA 4DMXA 2C0YA
chains in the Genus database with same CATH topology
5CVOB 1TL9A 3KW9A 1MDWA 2BSZA 2E02A 1VSNA 2XU4A 3RVWA 3MHHA 2ARYA 4QH6A 3MORA 8PCHA 1AYVA 2FT2A 2HD5A 2OZ2A 4AXMA 3H8BA 2G6DA 1KHQA 1PIPA 3H6SA 1IWDA 5PADA 2R9NA 3RVVA 1CTEA 2R9FA 1AU4A 3K9MA 2AIMA 4I04A 4BGFA 1X9YA 3MHSA 1KFXL 1M6DA 2DZZA 4BSQA 1ME3A 1SP4B 1YT7A 2H7JA 1DEUA 2HXZA 3CBJA 5JH3A 2NQDB 4QBBA 2DCCA 2E00A 4FJCA 4B55A 4QRVA 3D6SA 2VFCA 2DC9A 4WA6A 3U8EA 1U9WA 3PBHA 1CV8A 2AUZA 1PPDA 2DCDA 1AIMA 3NHEA 1U9XA 2XU5A 2PNSA 4QRGA 4YYVA 1ZCMA 2AYOA 1MIRA 2JQFR 4N79A 1QOLA 5EF4A 3ZUAA 4CZWA 4BQVA 1CQDA 2ACTA 3AI8A 1Y4HA 1MHWA 3QJ3A 3S3QA 1YK8A 1BQIA 1STFE 1NLJA 1U9VA 3P5WA 2YJBA 2OP3A 4MZSA 3CBKA 2PBHA 3H89A 1K3BB 1GX3A 1PPPA 2NQGA 2YJ8A 4HWYA 2WBFX 3IUTA 1EWOA 1YALA 3OISA 1KXRA 1F29A 1GMYA 2JQGR 5K16A 3BPMA 1F2BA 1AECA 2DJGB 1AYWA 4PI3A 1CS8A 1GCBA 1BY8A 1F2CA 4C5PA 1AU2A 1PBHA 1NL6A 3N4CA 2FO5A 3MTNA 2PADA 2CIOA 2G7YA 4W5CA 6PADA 3P5VA 1W6FA 1AYUA 2DJFB 3KSEA 3K24A 1ZIVA 9PAPA 3C9EA 4CDDB 1Y08A 3TNXA 1QXPA 4P6EA 4YV8A 1ITOA 1MEMA 1CB5A 1XKGA 2FUDA 4FIPA 4KLBA 3PW3A 4MZOA 2P0RA 2AU1A 2FYEA 5FPWA 1HUCB 4PADA 1SNKA 1TU6A 2DC7A 1DF0A 3KX1A 3LFYA 3O0UA 3P5UA 3KWZA 3OF9A 2IPPB 2P86A 3LXSA 3QT4A 2F1GA 4YYQA 3RVXA 3CH2X 3N3GA 1U9QX 4XUIA 1EF7A 3S3RA 3BPFA 1TLOA 2Y5BA 2BDLA 3LTWA 2R6NA 3HD3A 1CVZA 2IBIA 1BGOA 2AUXA 3OVXA 2HH5A 4X6HA 4G54A 2NQIA 2R9OA 3BC3A 5CVNB 5CVMA 1E2TA 2FRQA 2P7UA 4QRXA 2CB5A 1PPOA 2DZYA 3F5VA 4PP2E 3IHPA 1ATKA 2AVWA 4P6GA 4CDCB 1KFUL 4W4UA 4BS5A 3OVZA 1NB3A 3IOQA 1KHPA 2R9MA 5CHTA 2HHNA 1ICFA 1JQPA 5A24A 1A6RA 2DCAA 1GLOA 3H7DA 1NB5A 3QSDA 3H8CA 3CH3X 1PXVA 2OULA 7PCKA 4ZUXU 4FK5A 2Y6EA 3N3KA 1FH0A 4YYSA 2G8JA 1PCIA 4PP1A 4DMYA 3WXEA 3USVA 4OELA 5JA7A 5F02A 2GFOA 3IEJA 3KFQA 3BOWA 4I05A 2VHSA 2B1NA 5J94A 1F2AA 4N4ZA 3V6EA 3KKUA 2YJ9A 2R9CA 3D9WA 2F7DA 1EWPA 1YK7A 3E1ZB 1ME4A 4CDEB 4K7CA 2FQ9A 4W5BA 1POPA 1VJVA 1QDQA 4N8WA 2B1MA 4NV8A 3KWBX 4RY2A 3B79A 2NQAA 4CDFB 2ATOA 4BS6A 1O0EA 4X6IA 2DC6A 4X6JA 4YYUA 3O1GA 1PE6A 4XR7A 1MS6A 3I3TA 4YVAA 4YYRA 1YVBA 3WXGA 2E03A 2E01A 1W4TA 1GECE 1CSBB 2DC8A 3BCNA 1CPJA 3F75A 3BWKA 3IMAA 1U5IA 1W5RA 1THEA 3WXFA 1QMYA 1EWMA 3PDFA 4Q8HA 4NV7A 1AU0A 3P5XA 1PADA 5CHVA 2FRAA 1PPNA 2XU3A 2PREA 1NPZA 4GUZA 4Q8GA 4BPVA 4I07A 2FTDA 3K8UA 2YJCA 1Q6KA 3ERVA 2DCBA 3HHAA 2VHFA 4YYWA 2VFBA 2AYNA 4AXLA 2GHUA 5EGWA 3I06A 3V6CA 1S4VA 2BDZA 3M99A 3DF0A 1BP4A 3HWNA 1MEGA 4MSXA 2XU1A 1AU3A 3HHIA 3GCBA 3OF8A 3IV2A 2O6XA 3PNRA 1NQCA 1CJLA 2AS8A 4OEMA 2G8EA 2YJ2A 1EWLA 4DMXA 2C0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CVO B;  1TL9 A;  3KW9 A;  1MDW A;  2E02 A;  1VSN A;  2XU4 A;  3RVW A;  3MHH A;  2ARY A;  4QH6 A;  3MOR A;  8PCH A;  1AYV A;  2FT2 A;  2HD5 A;  2OZ2 A;  4AXM A;  3H8B A;  2G6D A;  1KHQ A;  1PIP A;  3H6S A;  1IWD A;  5PAD A;  2R9N A;  3RVV A;  1CTE A;  2R9F A;  1AU4 A;  3K9M A;  2AIM A;  4I04 A;  1X9Y A;  3MHS A;  1KFX L;  1M6D A;  2DZZ A;  4BSQ A;  1ME3 A;  1SP4 B;  1YT7 A;  2H7J A;  1DEU A;  2HXZ A;  3CBJ A;  5JH3 A;  2NQD B;  4QBB A;  2DCC A;  2E00 A;  4FJC A;  4QRV A;  3D6S A;  2DC9 A;  4WA6 A;  3U8E A;  1U9W A;  3PBH A;  1CV8 A;  2AUZ A;  1PPD A;  2DCD A;  1AIM A;  3NHE A;  1U9X A;  2XU5 A;  2PNS A;  4QRG A;  4YYV A;  1ZCM A;  2AYO A;  1MIR A;  2JQF R;  4N79 A;  1QOL A;  5EF4 A;  3ZUA A;  4CZW A;  4BQV A;  1CQD A;  2ACT A;  3AI8 A;  1Y4H A;  1MHW A;  3QJ3 A;  3S3Q A;  1YK8 A;  1BQI A;  1STF E;  1NLJ A;  1U9V A;  3P5W A;  2YJB A;  2OP3 A;  4MZS A;  3CBK A;  2PBH A;  3H89 A;  1K3B B;  1PPP A;  2NQG A;  2YJ8 A;  4HWY A;  2WBF X;  3IUT A;  1EWO A;  1YAL A;  3OIS A;  1KXR A;  1F29 A;  1GMY A;  2JQG R;  5K16 A;  3BPM A;  1F2B A;  1AEC A;  2DJG B;  1AYW A;  4PI3 A;  1CS8 A;  1GCB A;  1BY8 A;  1F2C A;  1AU2 A;  1PBH A;  1NL6 A;  3N4C A;  2FO5 A;  3MTN A;  2PAD A;  2CIO A;  2G7Y A;  4W5C A;  6PAD A;  3P5V A;  1AYU A;  2DJF B;  3KSE A;  3K24 A;  1ZIV A;  9PAP A;  3C9E A;  4CDD B;  1Y08 A;  3TNX A;  1QXP A;  4P6E A;  4YV8 A;  1ITO A;  1MEM A;  1CB5 A;  1XKG A;  2FUD A;  4FIP A;  4KLB A;  3PW3 A;  4MZO A;  2P0R A;  2AU1 A;  2FYE A;  5FPW A;  1HUC B;  4PAD A;  1SNK A;  1TU6 A;  2DC7 A;  1DF0 A;  3KX1 A;  3LFY A;  3O0U A;  3P5U A;  3KWZ A;  3OF9 A;  2IPP B;  2P86 A;  3LXS A;  3QT4 A;  2F1G A;  4YYQ A;  3RVX A;  3CH2 X;  3N3G A;  1U9Q X;  4XUI A;  1EF7 A;  3S3R A;  3BPF A;  1TLO A;  2Y5B A;  2BDL A;  2R6N A;  3HD3 A;  1CVZ A;  2IBI A;  1BGO A;  2AUX A;  3OVX A;  2HH5 A;  4X6H A;  4G54 A;  2NQI A;  2R9O A;  3BC3 A;  5CVN B;  5CVM A;  2FRQ A;  2P7U A;  4QRX A;  2CB5 A;  1PPO A;  2DZY A;  3F5V A;  4PP2 E;  3IHP A;  1ATK A;  2AVW A;  4P6G A;  4CDC B;  1KFU L;  4W4U A;  4BS5 A;  3OVZ A;  1NB3 A;  3IOQ A;  1KHP A;  2R9M A;  5CHT A;  2HHN A;  1ICF A;  1JQP A;  5A24 A;  1A6R A;  2DCA A;  1GLO A;  3H7D A;  1NB5 A;  3QSD A;  3H8C A;  3CH3 X;  1PXV A;  2OUL A;  7PCK A;  4ZUX U;  4FK5 A;  2Y6E A;  3N3K A;  1FH0 A;  4YYS A;  2G8J A;  1PCI A;  4PP1 A;  4DMY A;  3WXE A;  3USV A;  4OEL A;  5JA7 A;  5F02 A;  2GFO A;  3IEJ A;  3KFQ A;  3BOW A;  4I05 A;  2VHS A;  2B1N A;  5J94 A;  1F2A A;  4N4Z A;  3V6E A;  3KKU A;  2YJ9 A;  2R9C A;  2F7D A;  1EWP A;  1YK7 A;  3E1Z B;  1ME4 A;  4CDE B;  4K7C A;  2FQ9 A;  4W5B A;  1POP A;  1VJV A;  1QDQ A;  4N8W A;  2B1M A;  3KWB X;  4RY2 A;  3B79 A;  2NQA A;  4CDF B;  2ATO A;  4BS6 A;  1O0E A;  4X6I A;  2DC6 A;  4X6J A;  4YYU A;  3O1G A;  1PE6 A;  4XR7 A;  1MS6 A;  3I3T A;  4YVA A;  4YYR A;  1YVB A;  3WXG A;  2E03 A;  2E01 A;  1GEC E;  1CSB B;  2DC8 A;  3BCN A;  1CPJ A;  3F75 A;  3BWK A;  3IMA A;  1U5I A;  1THE A;  3WXF A;  1QMY A;  1EWM A;  3PDF A;  4Q8H A;  1AU0 A;  3P5X A;  1PAD A;  5CHV A;  2FRA A;  1PPN A;  2XU3 A;  2PRE A;  1NPZ A;  4Q8G A;  4BPV A;  4I07 A;  2FTD A;  3K8U A;  2YJC A;  1Q6K A;  3ERV A;  2DCB A;  3HHA A;  2VHF A;  4YYW A;  2AYN A;  4AXL A;  2GHU A;  5EGW A;  3I06 A;  3V6C A;  1S4V A;  2BDZ A;  3M99 A;  3DF0 A;  1BP4 A;  3HWN A;  1MEG A;  4MSX A;  2XU1 A;  1AU3 A;  3HHI A;  3GCB A;  3OF8 A;  3IV2 A;  2O6X A;  3PNR A;  1NQC A;  1CJL A;  2AS8 A;  4OEM A;  2G8E A;  2YJ2 A;  1EWL A;  4DMX A;  2C0Y A; 
#chains in the Genus database with same CATH topology
 5CVO B;  4IUM A;  1TL9 A;  3KW9 A;  1MDW A;  2E02 A;  1VSN A;  2XU4 A;  3RVW A;  3MHH A;  2ARY A;  4QH6 A;  4XZX A;  3MOR A;  8PCH A;  1AYV A;  2FT2 A;  2HD5 A;  2OZ2 A;  4AXM A;  1YZB A;  3H8B A;  2G6D A;  1KHQ A;  1PIP A;  2BU3 A;  3H6S A;  1IWD A;  5PAD A;  2R9N A;  3RVV A;  4R3D A;  1CTE A;  2R9F A;  1AU4 A;  3K9M A;  2AIM A;  4I04 A;  1X9Y A;  3MHS A;  3MP2 A;  1KFX L;  1M6D A;  2DZZ A;  4RF0 A;  3PRP A;  4BSQ A;  1ME3 A;  1SP4 B;  1YT7 A;  2H7J A;  1DEU A;  2HXZ A;  2UZJ A;  3CBJ A;  5JH3 A;  2NQD B;  4QBB A;  2DCC A;  2E00 A;  4FJC A;  4QRV A;  3D6S A;  1UKF A;  2DC9 A;  4WA6 A;  3U8E A;  1U9W A;  3PBH A;  1CV8 A;  2AUZ A;  1PPD A;  2DCD A;  4M0W A;  1AIM A;  3NHE A;  1U9X A;  2JTC A;  2XU5 A;  2PNS A;  4QRG A;  4YYV A;  1ZCM A;  2DOS A;  5JZE A;  2AYO A;  1MIR A;  2JQF R;  3MJ5 A;  4N79 A;  1QOL A;  5EF4 A;  3ZUA A;  4CZW A;  4BQV A;  1CQD A;  4WUR A;  2ACT A;  3AI8 A;  1Y4H A;  1MHW A;  3QJ3 A;  3PSE A;  5EZS A;  1YK8 A;  1BQI A;  3S3Q A;  1STF E;  1NLJ A;  1U9V A;  3P5W A;  2YJB A;  2OP3 A;  4MZS A;  3CBK A;  2PBH A;  3H89 A;  1K3B B;  1PPP A;  2NQG A;  2YJ8 A;  4HWY A;  5KO3 A;  2WBF X;  3IUT A;  1EWO A;  2J7Q C;  1YAL A;  3OIS A;  1KXR A;  1F29 A;  1GMY A;  2JQG R;  3ZNH A;  5K16 A;  3BPM A;  1F2B A;  1AEC A;  2DJG B;  1AYW A;  4PI3 A;  1CS8 A;  1GCB A;  1BY8 A;  4RF1 A;  1F2C A;  1AU2 A;  1PBH A;  3MTV A;  1NL6 A;  3N4C A;  2FO5 A;  3MTN A;  2PAD A;  2CIO A;  2G7Y A;  4BOU A;  4W5C A;  6PAD A;  3P5V A;  1AYU A;  2DJF B;  3KSE A;  3K24 A;  1ZIV A;  9PAP A;  3C9E A;  4CDD B;  1Y08 A;  3TNX A;  1QXP A;  4P6E A;  4YV8 A;  4P16 A;  1ITO A;  1MEM A;  1CB5 A;  1XKG A;  2FUD A;  4FIP A;  3PHU A;  4KLB A;  3PW3 A;  4MZO A;  2P0R A;  5EZQ A;  2AU1 A;  4HXD B;  2FYE A;  5FPW A;  1HUC B;  4PAD A;  1SNK A;  2BTW B;  1TU6 A;  2DC7 A;  4ZTB A;  1DF0 A;  3KX1 A;  3OQC A;  3LFY A;  3O0U A;  3P5U A;  3KWZ A;  4D8I A;  3OF9 A;  4D8E A;  2IPP B;  2P86 A;  3LXS A;  4REZ A;  3QT4 A;  2F1G A;  4YYQ A;  3RVX A;  3CH2 X;  3N3G A;  4BOS A;  1U9Q X;  4XUI A;  1EF7 A;  3S3R A;  3BPF A;  1TLO A;  4BOZ A;  2Y5B A;  2BDL A;  4OW0 A;  2R6N A;  3HD3 A;  3PHW A;  3C0R A;  3BY4 A;  1CVZ A;  2IBI A;  3PRM A;  1BGO A;  2AUX A;  3OVX A;  2HH5 A;  4X6H A;  4G54 A;  2NQI A;  2R9O A;  3BC3 A;  5CVN B;  5CVM A;  2FRQ A;  2P7U A;  4MM3 B;  4QRX A;  2CB5 A;  4BOP A;  1PPO A;  4RNA A;  2DZY A;  3F5V A;  4PP2 E;  3IHP A;  1ATK A;  2AVW A;  4P6G A;  4CDC B;  1KFU L;  4W4U A;  4BS5 A;  3OVZ A;  2J7Q A;  1NB3 A;  3IOQ A;  1KHP A;  2R9M A;  5CHT A;  2HHN A;  1ICF A;  1JQP A;  5A24 A;  1A6R A;  2DCA A;  1GLO A;  3H7D A;  1NB5 A;  3BBA A;  3QSD A;  3H8C A;  3CH3 X;  1PXV A;  2OUL A;  7PCK A;  3W31 A;  4ZUX U;  4FK5 A;  2Y6E A;  3N3K A;  1FH0 A;  4YYS A;  2G8J A;  1PCI A;  4PP1 A;  4DMY A;  3WXE A;  3USV A;  4OEL A;  4BOQ A;  2AGA A;  5F02 A;  2GFO A;  3E9S A;  3IEJ A;  5JA7 A;  3KFQ A;  3BOW A;  4I05 A;  2VHS A;  3B21 A;  2B1N A;  5J94 A;  2JRI A;  1F2A A;  4N4Z A;  3V6E A;  3KKU A;  2YJ9 A;  2R9C A;  2F7D A;  1EWP A;  4PT5 A;  4OVZ A;  3PHX A;  1YK7 A;  1DKI A;  3E1Z B;  1ME4 A;  4CDE B;  4K7C A;  4IP3 A;  2FQ9 A;  2Z84 A;  4W5B A;  4A5U A;  2HWK A;  1POP A;  1VJV A;  1PVJ A;  1QDQ A;  4N8W A;  2B1M A;  3KWB X;  4RY2 A;  3B79 A;  2NQA A;  4CDF B;  2ATO A;  3BB7 A;  4BS6 A;  1O0E A;  4X6I A;  2DC6 A;  4MI7 A;  4X6J A;  4YYU A;  3O1G A;  1PE6 A;  4XR7 A;  1MS6 A;  3I3T A;  4YVA A;  4YYR A;  1YVB A;  3WXG A;  2E03 A;  2E01 A;  2FE8 A;  3O65 A;  1GEC E;  1CSB B;  2DC8 A;  3BCN A;  1CPJ A;  3F75 A;  3BWK A;  3IMA A;  1U5I A;  4OVZ B;  1THE A;  3WXF A;  1QMY A;  1EWM A;  3PDF A;  4Q8H A;  5E6J A;  1AU0 A;  3P5X A;  1PAD A;  5CHV A;  2FRA A;  1PPN A;  3TRK A;  2XU3 A;  2PRE A;  1NPZ A;  4GUA A;  4Q8G A;  4BPV A;  3RNV A;  4I07 A;  2FTD A;  3K8U A;  2YJC A;  1Q6K A;  3ERV A;  2DCB A;  3HHA A;  2VHF A;  4YYW A;  2AYN A;  4AXL A;  2GHU A;  5EGW A;  3I06 A;  3V6C A;  1S4V A;  2BDZ A;  3M99 A;  3DF0 A;  1BP4 A;  3HWN A;  1MEG A;  4MSX A;  4RKX A;  2XU1 A;  1AU3 A;  3HHI A;  3GCB A;  3IFU A;  3OF8 A;  4D8B A;  3IV2 A;  3TMP A;  2O6X A;  3PNR A;  1NQC A;  1CJL A;  2AS8 A;  4OEM A;  2G8E A;  2BTW A;  3PT2 A;  3W30 A;  2YJ2 A;  1EWL A;  4DMX A;  2C0Y A; 
#chains in the Genus database with same CATH homology
 5CVO B;  1TL9 A;  3KW9 A;  1MDW A;  2BSZ A;  2E02 A;  1VSN A;  2XU4 A;  3RVW A;  3MHH A;  2ARY A;  4QH6 A;  3MOR A;  8PCH A;  1AYV A;  2FT2 A;  2HD5 A;  2OZ2 A;  4AXM A;  3H8B A;  2G6D A;  1KHQ A;  1PIP A;  3H6S A;  1IWD A;  5PAD A;  2R9N A;  3RVV A;  1CTE A;  2R9F A;  1AU4 A;  3K9M A;  2AIM A;  4I04 A;  4BGF A;  1X9Y A;  3MHS A;  1KFX L;  1M6D A;  2DZZ A;  4BSQ A;  1ME3 A;  1SP4 B;  1YT7 A;  2H7J A;  1DEU A;  2HXZ A;  3CBJ A;  5JH3 A;  2NQD B;  4QBB A;  2DCC A;  2E00 A;  4FJC A;  4B55 A;  4QRV A;  3D6S A;  2VFC A;  2DC9 A;  4WA6 A;  3U8E A;  1U9W A;  3PBH A;  1CV8 A;  2AUZ A;  1PPD A;  2DCD A;  1AIM A;  3NHE A;  1U9X A;  2XU5 A;  2PNS A;  4QRG A;  4YYV A;  1ZCM A;  2AYO A;  1MIR A;  2JQF R;  4N79 A;  1QOL A;  5EF4 A;  3ZUA A;  4CZW A;  4BQV A;  1CQD A;  2ACT A;  3AI8 A;  1Y4H A;  1MHW A;  3QJ3 A;  3S3Q A;  1YK8 A;  1BQI A;  1STF E;  1NLJ A;  1U9V A;  3P5W A;  2YJB A;  2OP3 A;  4MZS A;  3CBK A;  2PBH A;  3H89 A;  1K3B B;  1GX3 A;  1PPP A;  2NQG A;  2YJ8 A;  4HWY A;  2WBF X;  3IUT A;  1EWO A;  1YAL A;  3OIS A;  1KXR A;  1F29 A;  1GMY A;  2JQG R;  5K16 A;  3BPM A;  1F2B A;  1AEC A;  2DJG B;  1AYW A;  4PI3 A;  1CS8 A;  1GCB A;  1BY8 A;  1F2C A;  4C5P A;  1AU2 A;  1PBH A;  1NL6 A;  3N4C A;  2FO5 A;  3MTN A;  2PAD A;  2CIO A;  2G7Y A;  4W5C A;  6PAD A;  3P5V A;  1W6F A;  1AYU A;  2DJF B;  3KSE A;  3K24 A;  1ZIV A;  9PAP A;  3C9E A;  4CDD B;  1Y08 A;  3TNX A;  1QXP A;  4P6E A;  4YV8 A;  1ITO A;  1MEM A;  1CB5 A;  1XKG A;  2FUD A;  4FIP A;  4KLB A;  3PW3 A;  4MZO A;  2P0R A;  2AU1 A;  2FYE A;  5FPW A;  1HUC B;  4PAD A;  1SNK A;  1TU6 A;  2DC7 A;  1DF0 A;  3KX1 A;  3LFY A;  3O0U A;  3P5U A;  3KWZ A;  3OF9 A;  2IPP B;  2P86 A;  3LXS A;  3QT4 A;  2F1G A;  4YYQ A;  3RVX A;  3CH2 X;  3N3G A;  1U9Q X;  4XUI A;  1EF7 A;  3S3R A;  3BPF A;  1TLO A;  2Y5B A;  2BDL A;  3LTW A;  2R6N A;  3HD3 A;  1CVZ A;  2IBI A;  1BGO A;  2AUX A;  3OVX A;  2HH5 A;  4X6H A;  4G54 A;  2NQI A;  2R9O A;  3BC3 A;  5CVN B;  5CVM A;  1E2T A;  2FRQ A;  2P7U A;  4QRX A;  2CB5 A;  1PPO A;  2DZY A;  3F5V A;  4PP2 E;  3IHP A;  1ATK A;  2AVW A;  4P6G A;  4CDC B;  1KFU L;  4W4U A;  4BS5 A;  3OVZ A;  1NB3 A;  3IOQ A;  1KHP A;  2R9M A;  5CHT A;  2HHN A;  1ICF A;  1JQP A;  5A24 A;  1A6R A;  2DCA A;  1GLO A;  3H7D A;  1NB5 A;  3QSD A;  3H8C A;  3CH3 X;  1PXV A;  2OUL A;  7PCK A;  4ZUX U;  4FK5 A;  2Y6E A;  3N3K A;  1FH0 A;  4YYS A;  2G8J A;  1PCI A;  4PP1 A;  4DMY A;  3WXE A;  3USV A;  4OEL A;  5JA7 A;  5F02 A;  2GFO A;  3IEJ A;  3KFQ A;  3BOW A;  4I05 A;  2VHS A;  2B1N A;  5J94 A;  1F2A A;  4N4Z A;  3V6E A;  3KKU A;  2YJ9 A;  2R9C A;  3D9W A;  2F7D A;  1EWP A;  1YK7 A;  3E1Z B;  1ME4 A;  4CDE B;  4K7C A;  2FQ9 A;  4W5B A;  1POP A;  1VJV A;  1QDQ A;  4N8W A;  2B1M A;  4NV8 A;  3KWB X;  4RY2 A;  3B79 A;  2NQA A;  4CDF B;  2ATO A;  4BS6 A;  1O0E A;  4X6I A;  2DC6 A;  4X6J A;  4YYU A;  3O1G A;  1PE6 A;  4XR7 A;  1MS6 A;  3I3T A;  4YVA A;  4YYR A;  1YVB A;  3WXG A;  2E03 A;  2E01 A;  1W4T A;  1GEC E;  1CSB B;  2DC8 A;  3BCN A;  1CPJ A;  3F75 A;  3BWK A;  3IMA A;  1U5I A;  1W5R A;  1THE A;  3WXF A;  1QMY A;  1EWM A;  3PDF A;  4Q8H A;  4NV7 A;  1AU0 A;  3P5X A;  1PAD A;  5CHV A;  2FRA A;  1PPN A;  2XU3 A;  2PRE A;  1NPZ A;  4GUZ A;  4Q8G A;  4BPV A;  4I07 A;  2FTD A;  3K8U A;  2YJC A;  1Q6K A;  3ERV A;  2DCB A;  3HHA A;  2VHF A;  4YYW A;  2VFB A;  2AYN A;  4AXL A;  2GHU A;  5EGW A;  3I06 A;  3V6C A;  1S4V A;  2BDZ A;  3M99 A;  3DF0 A;  1BP4 A;  3HWN A;  1MEG A;  4MSX A;  2XU1 A;  1AU3 A;  3HHI A;  3GCB A;  3OF8 A;  3IV2 A;  2O6X A;  3PNR A;  1NQC A;  1CJL A;  2AS8 A;  4OEM A;  2G8E A;  2YJ2 A;  1EWL A;  4DMX A;  2C0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...