1DEUA

Crystal structure of human procathepsin x: a cysteine protease with the proregion covalently linked to the active site cysteine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
275
Chain Sequence
RGQTCYRPLRGDGLAPLGRTTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROCATHEPSIN X
publication title Crystal structure of human procathepsin X: a cysteine protease with the proregion covalently linked to the active site cysteine.
pubmed doi rcsb
total genus 74
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 3.4.18.1: Cathepsin X.
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1deuA00
4N4ZA 3KWBX 3WXFA 3ERVA 3GCBA 1GLOA 2JQFR 1F2BA 3OVXA 2YJ2A 2E02A 2PADA 1MDWA 4PI3A 3IMAA 1HUCB 4QBBA 2AVWA 2YJ8A 2WBFX 3O0UA 2H7JA 2FRAA 5JH3A 2YJBA 1YK8A 1TU6A 2FQ9A 3KFQA 4QRVA 2HHNA 5F02A 1ZCMA 5CVMA 1CB5A 4YYVA 1IWDA 4QRGA 4P6GA 1BGOA 1BQIA 1CJLA 4CZWA 1A6RA 2XU1A 3OF9A 1MIRA 2FT2A 1Y4HA 1EWPA 1F2AA 2Y5BA 2PREA 2AU1A 2P0RA 1BY8A 1THEA 1PPDA 4YVAA 3V6CA 5EGWA 3WXEA 1MS6A 2FUDA 1MEMA 1MHWA 2Y6EA 4I07A 2VHFA 1TLOA 4N79A 1KXRA 3BC3A 3OISA 4Q8HA 3HWNA 3CH3X 3KKUA 2B1MA 4YYRA 3P5VA 3HD3A 3DF0A 4X6IA 4DMXA 1YALA 3KSEA 2VHSA 1U5IA 4PADA 1AYVA 2P86A 2R6NA 3I06A 1FH0A 3BOWA 2DC6A 1QOLA 1AU4A 5PADA 1AIMA 1AYUA 1NQCA 4K7CA 1EWOA 1CPJA 3K9MA 3PBHA 2P7UA 3F5VA 3P5UA 2ACTA 3S3QA 4AXMA 1AYWA 3N3KA 3N3GA 3S3RA 4QH6A 3AI8A 3O1GA 1STFE 1AU0A 2G7YA 4MZOA 1CTEA 4FK5A 2NQGA 2BDLA 1U9XA 3QJ3A 1YVBA 5J94A 2ARYA 3PNRA 4CDEB 2OZ2A 3PW3A 1SP4B 1KHPA 3B79A 2YJ9A 5JA7A 1KFUL 1ATKA 2DCCA 3K24A 2R9NA 4OEMA 3N4CA 1QDQA 3I3TA 2AUXA 1POPA 2FTDA 1CV8A 1F2CA 3LXSA 1BP4A 3C9EA 4MZSA 1Y08A 2G6DA 3IV2A 1PBHA 4X6JA 1ICFA 6PADA 3BCNA 2BDZA 3H8BA 3KWZA 4OELA 1PADA 3V6EA 3WXGA 2FYEA 1U9WA 5FPWA 3D6SA 1KFXL 4XUIA 3BWKA 2IBIA 3H8CA 3HHAA 4CDCB 4YYQA 2DC8A 1F29A 3MHSA 3IUTA 1GMYA 2AIMA 4YYWA 3MORA 1EWMA 3U8EA 1VSNA 3MHHA 4BSQA 2DC7A 1NB3A 1Q6KA 1ME3A 2AS8A 2C0YA 1K3BB 3OF8A 4AXLA 4BQVA 1DEUA 2AUZA 2B1NA 2DJFB 1AU3A 1PE6A 2YJCA 3CBJA 1ZIVA 3IOQA 1JQPA 2XU4A 1XKGA 3ZUAA 3USVA 3H89A 4CDFB 8PCHA 1U9QX 2AYOA 2DC9A 7PCKA 4W5CA 4X6HA 1CQDA 3P5XA 2OULA 2CB5A 3RVWA 1NL6A 1TL9A 1PIPA 2DCBA 1CSBB 1NLJA 2E03A 4CDDB 1YK7A 3IHPA 1MEGA 2AYNA 3QSDA 2OP3A 2DCAA 4WA6A 2CIOA 5A24A 4G54A 3M99A 3F75A 4PP1A 5CVNB 1ITOA 9PAPA 2DZZA 2FRQA 3E1ZB 2HXZA 1CVZA 1O0EA 2G8EA 3LFYA 1PCIA 4RY2A 2JQGR 4HWYA 1U9VA 1AECA 3RVVA 3RVXA 1ME4A 1NB5A 3TNXA 4FJCA 2NQDB 1S4VA 1PPOA 4I05A 5CVOB 1PPPA 1PPNA 3CBKA 3P5WA 4MSXA 4BS6A 1GECE 2IPPB 2XU3A 3BPMA 5K16A 1EWLA 2FO5A 2G8JA 3NHEA 1NPZA 2DJGB 3CH2X 4P6EA 3OVZA 2GFOA 4PP2E 3KX1A 1YT7A 1SNKA 3H6SA 2F7DA 2NQAA 4KLBA 4BPVA 1GCBA 3H7DA 3QT4A 4N8WA 1X9YA 4XR7A 2HH5A 2R9FA 3K8UA 1PXVA 4I04A 2E00A 2HD5A 4W4UA 3PDFA 4DMYA 2GHUA 4YYSA 4QRXA 2O6XA 2ATOA 3KW9A 2R9MA 4FIPA 1M6DA 3IEJA 2E01A 4W5BA 4Q8GA 3BPFA 1KHQA 3HHIA 1AU2A 2R9OA 5CHVA 1CS8A 2PNSA 2XU5A 5CHTA 5EF4A 4ZUXU 2R9CA 4YV8A 1QXPA 1DF0A 1VJVA 4BS5A 1QMYA 2F1GA 3MTNA 2DZYA 2PBHA 2DCDA 2NQIA 4YYUA 1EF7A
chains in the Genus database with same CATH superfamily
4N4ZA 3KWBX 3WXFA 3ERVA 3GCBA 1GLOA 2JQFR 1F2BA 3OVXA 3PHWA 4RNAA 2YJ2A 2E02A 2PADA 1MDWA 4HXDB 4PI3A 3IMAA 1HUCB 4QBBA 2AVWA 2YJ8A 2WBFX 2JTCA 3O0UA 2H7JA 2FRAA 5JH3A 2YJBA 1YK8A 5E6JA 1TU6A 2FQ9A 3KFQA 4QRVA 2HHNA 5F02A 1ZCMA 5CVMA 1CB5A 4A5UA 4YYVA 1IWDA 4QRGA 4P6GA 1BGOA 1BQIA 1CJLA 4CZWA 3PT2A 5JZEA 1A6RA 2XU1A 3OF9A 1MIRA 2FE8A 2FT2A 1Y4HA 1EWPA 1F2AA 2BU3A 2Y5BA 2PREA 2AU1A 2P0RA 1BY8A 1THEA 1PPDA 4YVAA 3V6CA 5EGWA 3WXEA 1MS6A 2FUDA 1MEMA 1MHWA 4OVZA 2Y6EA 4GUAA 4I07A 2VHFA 1TLOA 4N79A 1KXRA 3BC3A 3OISA 4Q8HA 3HWNA 3CH3X 3KKUA 2B1MA 4YYRA 3P5VA 5EZQA 3HD3A 3DF0A 4X6IA 1PVJA 4DMXA 1YALA 3KSEA 2VHSA 1U5IA 4PADA 1AYVA 2P86A 2R6NA 3RNVA 3I06A 1FH0A 3BOWA 2DC6A 1QOLA 4P16A 4BOZA 1AU4A 5PADA 1AIMA 1AYUA 1NQCA 4K7CA 1EWOA 1CPJA 3K9MA 3PBHA 2P7UA 3F5VA 3P5UA 2ACTA 4IUMA 4REZA 3S3QA 4AXMA 1AYWA 3MJ5A 3N3KA 3N3GA 3S3RA 4QH6A 3AI8A 5EZSA 3O1GA 3IFUA 4D8IA 1STFE 1AU0A 2G7YA 4MZOA 4RKXA 1CTEA 3E9SA 4FK5A 2DOSA 4RF0A 2NQGA 2BDLA 1U9XA 3QJ3A 1YVBA 5J94A 2ARYA 3PNRA 4MI7A 4CDEB 2OZ2A 3PW3A 1SP4B 1KHPA 3B79A 1DKIA 2YJ9A 5JA7A 1KFUL 1ATKA 2DCCA 3K24A 2R9NA 4OEMA 3N4CA 1QDQA 2JRIA 3I3TA 2UZJA 2AUXA 1POPA 2FTDA 1CV8A 1F2CA 3LXSA 1BP4A 3C9EA 4MZSA 1Y08A 2G6DA 3IV2A 1PBHA 4BOUA 4X6JA 3PHXA 1ICFA 6PADA 3BCNA 1UKFA 2BDZA 3H8BA 3KWZA 4OELA 1PADA 3V6EA 3WXGA 2FYEA 1U9WA 3PSEA 5FPWA 3D6SA 1KFXL 4XUIA 3BWKA 2IBIA 3H8CA 3HHAA 4CDCB 4YYQA 2DC8A 1F29A 3MHSA 3IUTA 1GMYA 3W31A 2AIMA 4YYWA 3MORA 1EWMA 3U8EA 1VSNA 3MHHA 3BBAA 2BTWB 3ZNHA 4BSQA 2DC7A 1NB3A 1Q6KA 3MP2A 1ME3A 2J7QA 2AS8A 2C0YA 1K3BB 3OF8A 4AXLA 5KO3A 4BQVA 1DEUA 4PT5A 2AUZA 4D8EA 2B1NA 2DJFB 1AU3A 1PE6A 2YJCA 3CBJA 1ZIVA 1YZBA 4WURA 3IOQA 1JQPA 3MTVA 2XU4A 1XKGA 3ZUAA 3USVA 3H89A 4CDFB 8PCHA 1U9QX 2AYOA 2DC9A 7PCKA 3O65A 4W5CA 4BOPA 4X6HA 1CQDA 3P5XA 2OULA 2CB5A 3RVWA 1NL6A 1TL9A 1PIPA 2DCBA 1CSBB 1NLJA 4OW0A 2E03A 4CDDB 1YK7A 3IHPA 1MEGA 2AYNA 3QSDA 2OP3A 2DCAA 3PHUA 4BOQA 3PRPA 4WA6A 2CIOA 5A24A 4G54A 3M99A 3F75A 4PP1A 5CVNB 4D8BA 1ITOA 9PAPA 2DZZA 2FRQA 3E1ZB 2HXZA 1CVZA 1O0EA 2G8EA 3LFYA 1PCIA 4RY2A 3PRMA 2JQGR 4HWYA 1U9VA 1AECA 3RVVA 2BTWA 3RVXA 1ME4A 1NB5A 3TNXA 4FJCA 2NQDB 1S4VA 1PPOA 4I05A 5CVOB 1PPPA 1PPNA 3CBKA 3C0RA 3P5WA 4MSXA 4BS6A 1GECE 2IPPB 2XU3A 3BPMA 5K16A 1EWLA 2FO5A 2G8JA 3NHEA 1NPZA 2DJGB 3CH2X 4P6EA 3OVZA 2GFOA 4PP2E 4IP3A 3KX1A 1YT7A 1SNKA 3H6SA 2F7DA 3W30A 2NQAA 4KLBA 4BPVA 1GCBA 3H7DA 3OQCA 3QT4A 4N8WA 2HWKA 2J7QC 1X9YA 4XR7A 2HH5A 2R9FA 3TMPA 2AGAA 3K8UA 4BOSA 1PXVA 4I04A 3BB7A 2E00A 3B21A 2HD5A 4W4UA 3PDFA 4RF1A 4ZTBA 4DMYA 2GHUA 4YYSA 4QRXA 3KW9A 2ATOA 2O6XA 2R9MA 4FIPA 1M6DA 3IEJA 2E01A 4M0WA 4Q8GA 3BPFA 4W5BA 1KHQA 3HHIA 1AU2A 3BY4A 3TRKA 2R9OA 5CHVA 4XZXA 1CS8A 2PNSA 2XU5A 4MM3B 5CHTA 5EF4A 4ZUXU 2R9CA 4YV8A 1QXPA 1DF0A 1VJVA 4BS5A 1QMYA 2Z84A 4OVZB 2F1GA 3MTNA 2DZYA 2PBHA 4R3DA 2DCDA 2NQIA 4YYUA 1EF7A
chains in the Genus database with same CATH topology
4N4ZA 3KWBX 3WXFA 3ERVA 3GCBA 1GLOA 2JQFR 1F2BA 3OVXA 2YJ2A 2E02A 2BSZA 2PADA 1MDWA 4PI3A 3IMAA 1HUCB 4QBBA 2AVWA 2YJ8A 2WBFX 3O0UA 2H7JA 2FRAA 5JH3A 2YJBA 1YK8A 1TU6A 2FQ9A 3KFQA 4QRVA 2HHNA 5F02A 1ZCMA 5CVMA 1CB5A 4YYVA 1IWDA 4QRGA 4P6GA 1BGOA 1BQIA 1CJLA 4CZWA 1A6RA 2XU1A 3OF9A 1MIRA 2FT2A 1Y4HA 1EWPA 1F2AA 2Y5BA 2PREA 2AU1A 2P0RA 1BY8A 1THEA 1PPDA 4YVAA 3V6CA 5EGWA 3WXEA 1MS6A 2FUDA 1MEMA 1MHWA 2Y6EA 4I07A 2VHFA 1TLOA 4N79A 1KXRA 3BC3A 3OISA 4Q8HA 3HWNA 3CH3X 3KKUA 2B1MA 4YYRA 3P5VA 3HD3A 3DF0A 4X6IA 4DMXA 1YALA 3KSEA 2VHSA 1U5IA 4PADA 1AYVA 2P86A 2R6NA 3I06A 1FH0A 3BOWA 2DC6A 1QOLA 1AU4A 1W6FA 1AIMA 1AYUA 5PADA 1NQCA 4K7CA 1EWOA 1CPJA 4NV8A 3K9MA 3PBHA 2P7UA 3F5VA 3P5UA 2ACTA 3S3QA 4AXMA 1AYWA 3N3KA 3N3GA 3S3RA 4QH6A 3AI8A 3O1GA 1STFE 1AU0A 2G7YA 4MZOA 1CTEA 4FK5A 2NQGA 2BDLA 1U9XA 3QJ3A 1YVBA 5J94A 2ARYA 3PNRA 4CDEB 2OZ2A 3PW3A 1SP4B 1KHPA 3B79A 2YJ9A 5JA7A 1KFUL 1ATKA 2DCCA 3K24A 2R9NA 4OEMA 3N4CA 1QDQA 3I3TA 2AUXA 1POPA 2FTDA 1CV8A 1F2CA 3LXSA 1BP4A 3C9EA 4MZSA 1Y08A 2G6DA 3IV2A 1PBHA 1E2TA 4X6JA 1ICFA 6PADA 3BCNA 2BDZA 3H8BA 3KWZA 4OELA 1PADA 3V6EA 3WXGA 2FYEA 1U9WA 5FPWA 3D6SA 1KFXL 4XUIA 3BWKA 2IBIA 3H8CA 3HHAA 4CDCB 4YYQA 2DC8A 1F29A 3MHSA 3IUTA 1GMYA 2AIMA 4YYWA 3MORA 1EWMA 3U8EA 1VSNA 3MHHA 3LTWA 4BGFA 4BSQA 2DC7A 1NB3A 4GUZA 1Q6KA 1ME3A 2AS8A 2C0YA 1K3BB 3OF8A 4AXLA 4BQVA 1DEUA 2AUZA 2B1NA 2DJFB 1AU3A 1PE6A 2YJCA 3CBJA 1ZIVA 3IOQA 1JQPA 2XU4A 1XKGA 3ZUAA 3USVA 3H89A 4CDFB 8PCHA 1U9QX 2AYOA 2DC9A 7PCKA 4W5CA 4X6HA 1CQDA 3P5XA 2OULA 2CB5A 3RVWA 1NL6A 1TL9A 1PIPA 2DCBA 1CSBB 1NLJA 2E03A 4CDDB 1YK7A 3IHPA 1MEGA 2AYNA 3QSDA 2OP3A 2VFBA 2DCAA 1W5RA 4WA6A 2CIOA 5A24A 4G54A 3M99A 3F75A 4PP1A 5CVNB 1ITOA 9PAPA 2DZZA 2FRQA 3E1ZB 2HXZA 1CVZA 1O0EA 2G8EA 3LFYA 1PCIA 4RY2A 2JQGR 4HWYA 1U9VA 1AECA 3RVVA 3RVXA 1ME4A 1NB5A 3TNXA 4FJCA 1W4TA 2NQDB 1S4VA 1PPOA 4I05A 5CVOB 1PPPA 1PPNA 3CBKA 3P5WA 4MSXA 4BS6A 1GECE 2IPPB 2XU3A 3BPMA 5K16A 1EWLA 2FO5A 2G8JA 3NHEA 1NPZA 2DJGB 3CH2X 4P6EA 4C5PA 3OVZA 3D9WA 2GFOA 4PP2E 3KX1A 1YT7A 1SNKA 3H6SA 2F7DA 4B55A 2NQAA 4KLBA 2VFCA 4BPVA 1GCBA 3H7DA 3QT4A 4N8WA 1X9YA 4XR7A 2HH5A 2R9FA 3K8UA 1PXVA 4I04A 2E00A 2HD5A 4W4UA 3PDFA 4DMYA 2GHUA 4YYSA 4QRXA 2O6XA 2ATOA 3KW9A 2R9MA 4FIPA 1M6DA 3IEJA 2E01A 4W5BA 4Q8GA 3BPFA 1KHQA 3HHIA 1AU2A 1GX3A 2R9OA 5CHVA 1CS8A 2PNSA 2XU5A 5CHTA 5EF4A 4ZUXU 2R9CA 4YV8A 1QXPA 1DF0A 1VJVA 4BS5A 1QMYA 4NV7A 2F1GA 3MTNA 2DZYA 2PBHA 2DCDA 2NQIA 4YYUA 1EF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4Z A;  3KWB X;  3WXF A;  3ERV A;  3GCB A;  1GLO A;  2JQF R;  1F2B A;  3OVX A;  2YJ2 A;  2E02 A;  2PAD A;  1MDW A;  4PI3 A;  3IMA A;  1HUC B;  4QBB A;  2AVW A;  2YJ8 A;  2WBF X;  3O0U A;  2H7J A;  2FRA A;  5JH3 A;  2YJB A;  1YK8 A;  1TU6 A;  2FQ9 A;  3KFQ A;  4QRV A;  2HHN A;  5F02 A;  1ZCM A;  5CVM A;  1CB5 A;  4YYV A;  1IWD A;  4QRG A;  4P6G A;  1BGO A;  1BQI A;  1CJL A;  4CZW A;  1A6R A;  2XU1 A;  3OF9 A;  1MIR A;  2FT2 A;  1Y4H A;  1EWP A;  1F2A A;  2Y5B A;  2PRE A;  2AU1 A;  2P0R A;  1BY8 A;  1THE A;  1PPD A;  4YVA A;  3V6C A;  5EGW A;  3WXE A;  1MS6 A;  2FUD A;  1MEM A;  1MHW A;  2Y6E A;  4I07 A;  2VHF A;  1TLO A;  4N79 A;  1KXR A;  3BC3 A;  3OIS A;  4Q8H A;  3HWN A;  3CH3 X;  3KKU A;  2B1M A;  4YYR A;  3P5V A;  3HD3 A;  3DF0 A;  4X6I A;  4DMX A;  1YAL A;  3KSE A;  2VHS A;  1U5I A;  4PAD A;  1AYV A;  2P86 A;  2R6N A;  3I06 A;  1FH0 A;  3BOW A;  2DC6 A;  1QOL A;  1AU4 A;  5PAD A;  1AIM A;  1AYU A;  1NQC A;  4K7C A;  1EWO A;  1CPJ A;  3K9M A;  3PBH A;  2P7U A;  3F5V A;  3P5U A;  2ACT A;  3S3Q A;  4AXM A;  1AYW A;  3N3K A;  3N3G A;  3S3R A;  4QH6 A;  3AI8 A;  3O1G A;  1STF E;  1AU0 A;  2G7Y A;  4MZO A;  1CTE A;  4FK5 A;  2NQG A;  2BDL A;  1U9X A;  3QJ3 A;  1YVB A;  5J94 A;  2ARY A;  3PNR A;  4CDE B;  2OZ2 A;  3PW3 A;  1SP4 B;  1KHP A;  3B79 A;  2YJ9 A;  5JA7 A;  1KFU L;  1ATK A;  2DCC A;  3K24 A;  2R9N A;  4OEM A;  3N4C A;  1QDQ A;  3I3T A;  2AUX A;  1POP A;  2FTD A;  1CV8 A;  1F2C A;  3LXS A;  1BP4 A;  3C9E A;  4MZS A;  1Y08 A;  2G6D A;  3IV2 A;  1PBH A;  4X6J A;  1ICF A;  6PAD A;  3BCN A;  2BDZ A;  3H8B A;  3KWZ A;  4OEL A;  1PAD A;  3V6E A;  3WXG A;  2FYE A;  1U9W A;  5FPW A;  3D6S A;  1KFX L;  4XUI A;  3BWK A;  2IBI A;  3H8C A;  3HHA A;  4CDC B;  4YYQ A;  2DC8 A;  1F29 A;  3MHS A;  3IUT A;  1GMY A;  2AIM A;  4YYW A;  3MOR A;  1EWM A;  3U8E A;  1VSN A;  3MHH A;  4BSQ A;  2DC7 A;  1NB3 A;  1Q6K A;  1ME3 A;  2AS8 A;  2C0Y A;  1K3B B;  3OF8 A;  4AXL A;  4BQV A;  1DEU A;  2AUZ A;  2B1N A;  2DJF B;  1AU3 A;  1PE6 A;  2YJC A;  3CBJ A;  1ZIV A;  3IOQ A;  1JQP A;  2XU4 A;  1XKG A;  3ZUA A;  3USV A;  3H89 A;  4CDF B;  8PCH A;  1U9Q X;  2AYO A;  2DC9 A;  7PCK A;  4W5C A;  4X6H A;  1CQD A;  3P5X A;  2OUL A;  2CB5 A;  3RVW A;  1NL6 A;  1TL9 A;  1PIP A;  2DCB A;  1CSB B;  1NLJ A;  2E03 A;  4CDD B;  1YK7 A;  3IHP A;  1MEG A;  2AYN A;  3QSD A;  2OP3 A;  2DCA A;  4WA6 A;  2CIO A;  5A24 A;  4G54 A;  3M99 A;  3F75 A;  4PP1 A;  5CVN B;  1ITO A;  9PAP A;  2DZZ A;  2FRQ A;  3E1Z B;  2HXZ A;  1CVZ A;  1O0E A;  2G8E A;  3LFY A;  1PCI A;  4RY2 A;  2JQG R;  4HWY A;  1U9V A;  1AEC A;  3RVV A;  3RVX A;  1ME4 A;  1NB5 A;  3TNX A;  4FJC A;  2NQD B;  1S4V A;  1PPO A;  4I05 A;  5CVO B;  1PPP A;  1PPN A;  3CBK A;  3P5W A;  4MSX A;  4BS6 A;  1GEC E;  2IPP B;  2XU3 A;  3BPM A;  5K16 A;  1EWL A;  2FO5 A;  2G8J A;  3NHE A;  1NPZ A;  2DJG B;  3CH2 X;  4P6E A;  3OVZ A;  2GFO A;  4PP2 E;  3KX1 A;  1YT7 A;  1SNK A;  3H6S A;  2F7D A;  2NQA A;  4KLB A;  4BPV A;  1GCB A;  3H7D A;  3QT4 A;  4N8W A;  1X9Y A;  4XR7 A;  2HH5 A;  2R9F A;  3K8U A;  1PXV A;  4I04 A;  2E00 A;  2HD5 A;  4W4U A;  3PDF A;  4DMY A;  2GHU A;  4YYS A;  4QRX A;  2O6X A;  2ATO A;  3KW9 A;  2R9M A;  4FIP A;  1M6D A;  3IEJ A;  2E01 A;  4W5B A;  4Q8G A;  3BPF A;  1KHQ A;  3HHI A;  1AU2 A;  2R9O A;  5CHV A;  1CS8 A;  2PNS A;  2XU5 A;  5CHT A;  5EF4 A;  4ZUX U;  2R9C A;  4YV8 A;  1QXP A;  1DF0 A;  1VJV A;  4BS5 A;  1QMY A;  2F1G A;  3MTN A;  2DZY A;  2PBH A;  2DCD A;  2NQI A;  4YYU A;  1EF7 A; 
#chains in the Genus database with same CATH topology
 4N4Z A;  3KWB X;  3WXF A;  3ERV A;  3GCB A;  1GLO A;  2JQF R;  1F2B A;  3OVX A;  3PHW A;  4RNA A;  2YJ2 A;  2E02 A;  2PAD A;  1MDW A;  4HXD B;  4PI3 A;  3IMA A;  1HUC B;  4QBB A;  2AVW A;  2YJ8 A;  2WBF X;  2JTC A;  3O0U A;  2H7J A;  2FRA A;  5JH3 A;  2YJB A;  1YK8 A;  5E6J A;  1TU6 A;  2FQ9 A;  3KFQ A;  4QRV A;  2HHN A;  5F02 A;  1ZCM A;  5CVM A;  1CB5 A;  4A5U A;  4YYV A;  1IWD A;  4QRG A;  4P6G A;  1BGO A;  1BQI A;  1CJL A;  4CZW A;  3PT2 A;  5JZE A;  1A6R A;  2XU1 A;  3OF9 A;  1MIR A;  2FE8 A;  2FT2 A;  1Y4H A;  1EWP A;  1F2A A;  2BU3 A;  2Y5B A;  2PRE A;  2AU1 A;  2P0R A;  1BY8 A;  1THE A;  1PPD A;  4YVA A;  3V6C A;  5EGW A;  3WXE A;  1MS6 A;  2FUD A;  1MEM A;  1MHW A;  4OVZ A;  2Y6E A;  4GUA A;  4I07 A;  2VHF A;  1TLO A;  4N79 A;  1KXR A;  3BC3 A;  3OIS A;  4Q8H A;  3HWN A;  3CH3 X;  3KKU A;  2B1M A;  4YYR A;  3P5V A;  5EZQ A;  3HD3 A;  3DF0 A;  4X6I A;  1PVJ A;  4DMX A;  1YAL A;  3KSE A;  2VHS A;  1U5I A;  4PAD A;  1AYV A;  2P86 A;  2R6N A;  3RNV A;  3I06 A;  1FH0 A;  3BOW A;  2DC6 A;  1QOL A;  4P16 A;  4BOZ A;  1AU4 A;  5PAD A;  1AIM A;  1AYU A;  1NQC A;  4K7C A;  1EWO A;  1CPJ A;  3K9M A;  3PBH A;  2P7U A;  3F5V A;  3P5U A;  2ACT A;  4IUM A;  4REZ A;  3S3Q A;  4AXM A;  1AYW A;  3MJ5 A;  3N3K A;  3N3G A;  3S3R A;  4QH6 A;  3AI8 A;  5EZS A;  3O1G A;  3IFU A;  4D8I A;  1STF E;  1AU0 A;  2G7Y A;  4MZO A;  4RKX A;  1CTE A;  3E9S A;  4FK5 A;  2DOS A;  4RF0 A;  2NQG A;  2BDL A;  1U9X A;  3QJ3 A;  1YVB A;  5J94 A;  2ARY A;  3PNR A;  4MI7 A;  4CDE B;  2OZ2 A;  3PW3 A;  1SP4 B;  1KHP A;  3B79 A;  1DKI A;  2YJ9 A;  5JA7 A;  1KFU L;  1ATK A;  2DCC A;  3K24 A;  2R9N A;  4OEM A;  3N4C A;  1QDQ A;  2JRI A;  3I3T A;  2UZJ A;  2AUX A;  1POP A;  2FTD A;  1CV8 A;  1F2C A;  3LXS A;  1BP4 A;  3C9E A;  4MZS A;  1Y08 A;  2G6D A;  3IV2 A;  1PBH A;  4BOU A;  4X6J A;  3PHX A;  1ICF A;  6PAD A;  3BCN A;  1UKF A;  2BDZ A;  3H8B A;  3KWZ A;  4OEL A;  1PAD A;  3V6E A;  3WXG A;  2FYE A;  1U9W A;  3PSE A;  5FPW A;  3D6S A;  1KFX L;  4XUI A;  3BWK A;  2IBI A;  3H8C A;  3HHA A;  4CDC B;  4YYQ A;  2DC8 A;  1F29 A;  3MHS A;  3IUT A;  1GMY A;  3W31 A;  2AIM A;  4YYW A;  3MOR A;  1EWM A;  3U8E A;  1VSN A;  3MHH A;  3BBA A;  2BTW B;  3ZNH A;  4BSQ A;  2DC7 A;  1NB3 A;  1Q6K A;  3MP2 A;  1ME3 A;  2J7Q A;  2AS8 A;  2C0Y A;  1K3B B;  3OF8 A;  4AXL A;  5KO3 A;  4BQV A;  1DEU A;  4PT5 A;  2AUZ A;  4D8E A;  2B1N A;  2DJF B;  1AU3 A;  1PE6 A;  2YJC A;  3CBJ A;  1ZIV A;  1YZB A;  4WUR A;  3IOQ A;  1JQP A;  3MTV A;  2XU4 A;  1XKG A;  3ZUA A;  3USV A;  3H89 A;  4CDF B;  8PCH A;  1U9Q X;  2AYO A;  2DC9 A;  7PCK A;  3O65 A;  4W5C A;  4BOP A;  4X6H A;  1CQD A;  3P5X A;  2OUL A;  2CB5 A;  3RVW A;  1NL6 A;  1TL9 A;  1PIP A;  2DCB A;  1CSB B;  1NLJ A;  4OW0 A;  2E03 A;  4CDD B;  1YK7 A;  3IHP A;  1MEG A;  2AYN A;  3QSD A;  2OP3 A;  2DCA A;  3PHU A;  4BOQ A;  3PRP A;  4WA6 A;  2CIO A;  5A24 A;  4G54 A;  3M99 A;  3F75 A;  4PP1 A;  5CVN B;  4D8B A;  1ITO A;  9PAP A;  2DZZ A;  2FRQ A;  3E1Z B;  2HXZ A;  1CVZ A;  1O0E A;  2G8E A;  3LFY A;  1PCI A;  4RY2 A;  3PRM A;  2JQG R;  4HWY A;  1U9V A;  1AEC A;  3RVV A;  2BTW A;  3RVX A;  1ME4 A;  1NB5 A;  3TNX A;  4FJC A;  2NQD B;  1S4V A;  1PPO A;  4I05 A;  5CVO B;  1PPP A;  1PPN A;  3CBK A;  3C0R A;  3P5W A;  4MSX A;  4BS6 A;  1GEC E;  2IPP B;  2XU3 A;  3BPM A;  5K16 A;  1EWL A;  2FO5 A;  2G8J A;  3NHE A;  1NPZ A;  2DJG B;  3CH2 X;  4P6E A;  3OVZ A;  2GFO A;  4PP2 E;  4IP3 A;  3KX1 A;  1YT7 A;  1SNK A;  3H6S A;  2F7D A;  3W30 A;  2NQA A;  4KLB A;  4BPV A;  1GCB A;  3H7D A;  3OQC A;  3QT4 A;  4N8W A;  2HWK A;  2J7Q C;  1X9Y A;  4XR7 A;  2HH5 A;  2R9F A;  3TMP A;  2AGA A;  3K8U A;  4BOS A;  1PXV A;  4I04 A;  3BB7 A;  2E00 A;  3B21 A;  2HD5 A;  4W4U A;  3PDF A;  4RF1 A;  4ZTB A;  4DMY A;  2GHU A;  4YYS A;  4QRX A;  3KW9 A;  2ATO A;  2O6X A;  2R9M A;  4FIP A;  1M6D A;  3IEJ A;  2E01 A;  4M0W A;  4Q8G A;  3BPF A;  4W5B A;  1KHQ A;  3HHI A;  1AU2 A;  3BY4 A;  3TRK A;  2R9O A;  5CHV A;  4XZX A;  1CS8 A;  2PNS A;  2XU5 A;  4MM3 B;  5CHT A;  5EF4 A;  4ZUX U;  2R9C A;  4YV8 A;  1QXP A;  1DF0 A;  1VJV A;  4BS5 A;  1QMY A;  2Z84 A;  4OVZ B;  2F1G A;  3MTN A;  2DZY A;  2PBH A;  4R3D A;  2DCD A;  2NQI A;  4YYU A;  1EF7 A; 
#chains in the Genus database with same CATH homology
 4N4Z A;  3KWB X;  3WXF A;  3ERV A;  3GCB A;  1GLO A;  2JQF R;  1F2B A;  3OVX A;  2YJ2 A;  2E02 A;  2BSZ A;  2PAD A;  1MDW A;  4PI3 A;  3IMA A;  1HUC B;  4QBB A;  2AVW A;  2YJ8 A;  2WBF X;  3O0U A;  2H7J A;  2FRA A;  5JH3 A;  2YJB A;  1YK8 A;  1TU6 A;  2FQ9 A;  3KFQ A;  4QRV A;  2HHN A;  5F02 A;  1ZCM A;  5CVM A;  1CB5 A;  4YYV A;  1IWD A;  4QRG A;  4P6G A;  1BGO A;  1BQI A;  1CJL A;  4CZW A;  1A6R A;  2XU1 A;  3OF9 A;  1MIR A;  2FT2 A;  1Y4H A;  1EWP A;  1F2A A;  2Y5B A;  2PRE A;  2AU1 A;  2P0R A;  1BY8 A;  1THE A;  1PPD A;  4YVA A;  3V6C A;  5EGW A;  3WXE A;  1MS6 A;  2FUD A;  1MEM A;  1MHW A;  2Y6E A;  4I07 A;  2VHF A;  1TLO A;  4N79 A;  1KXR A;  3BC3 A;  3OIS A;  4Q8H A;  3HWN A;  3CH3 X;  3KKU A;  2B1M A;  4YYR A;  3P5V A;  3HD3 A;  3DF0 A;  4X6I A;  4DMX A;  1YAL A;  3KSE A;  2VHS A;  1U5I A;  4PAD A;  1AYV A;  2P86 A;  2R6N A;  3I06 A;  1FH0 A;  3BOW A;  2DC6 A;  1QOL A;  1AU4 A;  1W6F A;  1AIM A;  1AYU A;  5PAD A;  1NQC A;  4K7C A;  1EWO A;  1CPJ A;  4NV8 A;  3K9M A;  3PBH A;  2P7U A;  3F5V A;  3P5U A;  2ACT A;  3S3Q A;  4AXM A;  1AYW A;  3N3K A;  3N3G A;  3S3R A;  4QH6 A;  3AI8 A;  3O1G A;  1STF E;  1AU0 A;  2G7Y A;  4MZO A;  1CTE A;  4FK5 A;  2NQG A;  2BDL A;  1U9X A;  3QJ3 A;  1YVB A;  5J94 A;  2ARY A;  3PNR A;  4CDE B;  2OZ2 A;  3PW3 A;  1SP4 B;  1KHP A;  3B79 A;  2YJ9 A;  5JA7 A;  1KFU L;  1ATK A;  2DCC A;  3K24 A;  2R9N A;  4OEM A;  3N4C A;  1QDQ A;  3I3T A;  2AUX A;  1POP A;  2FTD A;  1CV8 A;  1F2C A;  3LXS A;  1BP4 A;  3C9E A;  4MZS A;  1Y08 A;  2G6D A;  3IV2 A;  1PBH A;  1E2T A;  4X6J A;  1ICF A;  6PAD A;  3BCN A;  2BDZ A;  3H8B A;  3KWZ A;  4OEL A;  1PAD A;  3V6E A;  3WXG A;  2FYE A;  1U9W A;  5FPW A;  3D6S A;  1KFX L;  4XUI A;  3BWK A;  2IBI A;  3H8C A;  3HHA A;  4CDC B;  4YYQ A;  2DC8 A;  1F29 A;  3MHS A;  3IUT A;  1GMY A;  2AIM A;  4YYW A;  3MOR A;  1EWM A;  3U8E A;  1VSN A;  3MHH A;  3LTW A;  4BGF A;  4BSQ A;  2DC7 A;  1NB3 A;  4GUZ A;  1Q6K A;  1ME3 A;  2AS8 A;  2C0Y A;  1K3B B;  3OF8 A;  4AXL A;  4BQV A;  1DEU A;  2AUZ A;  2B1N A;  2DJF B;  1AU3 A;  1PE6 A;  2YJC A;  3CBJ A;  1ZIV A;  3IOQ A;  1JQP A;  2XU4 A;  1XKG A;  3ZUA A;  3USV A;  3H89 A;  4CDF B;  8PCH A;  1U9Q X;  2AYO A;  2DC9 A;  7PCK A;  4W5C A;  4X6H A;  1CQD A;  3P5X A;  2OUL A;  2CB5 A;  3RVW A;  1NL6 A;  1TL9 A;  1PIP A;  2DCB A;  1CSB B;  1NLJ A;  2E03 A;  4CDD B;  1YK7 A;  3IHP A;  1MEG A;  2AYN A;  3QSD A;  2OP3 A;  2VFB A;  2DCA A;  1W5R A;  4WA6 A;  2CIO A;  5A24 A;  4G54 A;  3M99 A;  3F75 A;  4PP1 A;  5CVN B;  1ITO A;  9PAP A;  2DZZ A;  2FRQ A;  3E1Z B;  2HXZ A;  1CVZ A;  1O0E A;  2G8E A;  3LFY A;  1PCI A;  4RY2 A;  2JQG R;  4HWY A;  1U9V A;  1AEC A;  3RVV A;  3RVX A;  1ME4 A;  1NB5 A;  3TNX A;  4FJC A;  1W4T A;  2NQD B;  1S4V A;  1PPO A;  4I05 A;  5CVO B;  1PPP A;  1PPN A;  3CBK A;  3P5W A;  4MSX A;  4BS6 A;  1GEC E;  2IPP B;  2XU3 A;  3BPM A;  5K16 A;  1EWL A;  2FO5 A;  2G8J A;  3NHE A;  1NPZ A;  2DJG B;  3CH2 X;  4P6E A;  4C5P A;  3OVZ A;  3D9W A;  2GFO A;  4PP2 E;  3KX1 A;  1YT7 A;  1SNK A;  3H6S A;  2F7D A;  4B55 A;  2NQA A;  4KLB A;  2VFC A;  4BPV A;  1GCB A;  3H7D A;  3QT4 A;  4N8W A;  1X9Y A;  4XR7 A;  2HH5 A;  2R9F A;  3K8U A;  1PXV A;  4I04 A;  2E00 A;  2HD5 A;  4W4U A;  3PDF A;  4DMY A;  2GHU A;  4YYS A;  4QRX A;  2O6X A;  2ATO A;  3KW9 A;  2R9M A;  4FIP A;  1M6D A;  3IEJ A;  2E01 A;  4W5B A;  4Q8G A;  3BPF A;  1KHQ A;  3HHI A;  1AU2 A;  1GX3 A;  2R9O A;  5CHV A;  1CS8 A;  2PNS A;  2XU5 A;  5CHT A;  5EF4 A;  4ZUX U;  2R9C A;  4YV8 A;  1QXP A;  1DF0 A;  1VJV A;  4BS5 A;  1QMY A;  4NV7 A;  2F1G A;  3MTN A;  2DZY A;  2PBH A;  2DCD A;  2NQI A;  4YYU A;  1EF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...