1DEUA

Crystal structure of human procathepsin x: a cysteine protease with the proregion covalently linked to the active site cysteine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
275
structure length
275
Chain Sequence
b'RGQTCYRPLRGDGLAPLGRTTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCATHEPSIN X
publication title Crystal structure of human procathepsin X: a cysteine protease with the proregion covalently linked to the active site cysteine.
pubmed doi rcsb
molecule tags Hydrolase
total genus 74
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 3.4.18.1: Cathepsin X.
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1deuA00
3OVZA 3AI8A 1CVZA 3KSEA 1CB5A 1BP4A 2FO5A 2VHFA 2NQIA 3CBKA 2O6XA 3USVA 1GCBA 3V6EA 4YYVA 2YJBA 2IBIA 3P5XA 4N79A 2AUZA 3E1ZB 2FT2A 8PCHA 1A6RA 2B1MA 2DZYA 1YALA 2HD5A 2WBFX 1M6DA 4YYRA 1ZCMA 4K7CA 3B79A 5JA7A 3CH3X 3CH2X 4AXMA 1BGOA 1VJVA 1PE6A 3D6SA 9PAPA 2DC6A 3H8CA 3NHEA 3WXFA 1JQPA 3PW3A 2FRAA 1FH0A 2BDZA 1NQCA 3OF9A 3KKUA 3BC3A 2R9CA 2XU5A 1TL9A 1YVBA 1SP4B 4YV8A 5EF4A 3MHHA 3BOWA 2BDLA 1F2BA 2PREA 3KWZA 1O0EA 2XU1A 4YVAA 3WXEA 1U5IA 2VHSA 2F7DA 3ERVA 4YYQA 1QXPA 1AYUA 1KXRA 1BQIA 1VSNA 1NB5A 4BQVA 3IUTA 1STFE 1MHWA 4QRVA 1F2CA 4CDEB 2YJCA 4W5CA 3H6SA 3ZUAA 1DF0A 3I06A 3QJ3A 5FPWA 2PADA 1F29A 3N3KA 1XKGA 5CVNB 3IV2A 1NLJA 1CS8A 2R9MA 4ZUXU 1QOLA 1NPZA 2P86A 1YT7A 1PBHA 4FK5A 4PI3A 1NB3A 2CIOA 1CPJA 1U9WA 4FIPA 4MSXA 3QSDA 1S4VA 1MEGA 3OF8A 4P6GA 4MZOA 4HWYA 3K24A 2AYNA 1U9XA 2B1NA 3RVVA 3TNXA 3DF0A 2E00A 3LXSA 3N3GA 4QRGA 2FRQA 2F1GA 5J94A 1YK8A 4DMXA 3HD3A 4BS6A 1U9QX 4N4ZA 3F5VA 1ZIVA 3PNRA 1PPOA 1EWLA 3H89A 2R9NA 2FTDA 2GHUA 3IOQA 5CVOB 3HWNA 3PBHA 2JQGR 3BPFA 3RVWA 3F75A 2E03A 2DJGB 5CHTA 1QDQA 2CB5A 3KWBX 2DC8A 1CV8A 2FUDA 3IEJA 2R9FA 3H7DA 4KLBA 1HUCB 2YJ9A 2G6DA 3KX1A 5K16A 4YYSA 1THEA 3OISA 3BWKA 1CSBB 1POPA 4X6HA 1ATKA 1KFXL 4PP1A 1CQDA 2OULA 1X9YA 5JH3A 1PPDA 3U8EA 1MIRA 2GFOA 2XU3A 1AU4A 2DCDA 1DEUA 1U9VA 4Q8HA 4BS5A 2JQFR 3GCBA 1AECA 3BCNA 4W4UA 4PADA 1EWMA 2PBHA 1PIPA 1AYVA 3P5WA 4OELA 4QH6A 3RVXA 1TU6A 2ATOA 2Y5BA 1KFUL 4CDFB 3QT4A 1F2AA 2G8JA 3K9MA 1PXVA 2HHNA 2P7UA 3N4CA 1KHPA 1ME3A 2AS8A 4WA6A 2DCAA 1CTEA 2E01A 2G8EA 4P6EA 6PADA 1AU3A 2P0RA 1GMYA 3P5UA 1ICFA 1MDWA 3MHSA 4I05A 1BY8A 3C9EA 2G7YA 3PDFA 4G54A 3CBJA 1YK7A 3IHPA 3O0UA 2Y6EA 2AIMA 4N8WA 1EWPA 2ARYA 1EWOA 1CJLA 5CHVA 4BSQA 1Q6KA 2HH5A 2DZZA 2PNSA 2AYOA 3KFQA 4Q8GA 1AU2A 4YYWA 1AIMA 3LFYA 1ITOA 1Y4HA 2FQ9A 3M99A 2ACTA 4CDDB 1PPNA 2FYEA 7PCKA 5EGWA 1MS6A 3IMAA 4W5BA 3S3RA 4OEMA 2IPPB 4AXLA 2NQDB 1Y08A 4BPVA 2DCCA 2DC7A 4QBBA 3S3QA 2NQAA 2AVWA 1IWDA 1PADA 3MTNA 3WXGA 4FJCA 1MEMA 4X6JA 3HHIA 4I04A 1PPPA 1QMYA 2AUXA 4XUIA 4RY2A 2YJ2A 4YYUA 1AYWA 2AU1A 1PCIA 1TLOA 5PADA 4DMYA 1K3BB 2DCBA 2C0YA 5CVMA 4CDCB 4I07A 3O1GA 1GECE 2DC9A 2NQGA 4CZWA 2R9OA 3I3TA 2OZ2A 4MZSA 3V6CA 4PP2E 5F02A 2YJ8A 2DJFB 3K8UA 3MORA 1EF7A 1NL6A 3OVXA 1ME4A 3HHAA 2HXZA 4XR7A 2R6NA 4X6IA 3BPMA 2OP3A 4QRXA 2E02A 1AU0A 1KHQA 2XU4A 3KW9A 3H8BA 2H7JA 3P5VA 1SNKA 5A24A 1GLOA
chains in the Genus database with same CATH superfamily
4IP3A 1UKFA 3OVZA 4GUAA 3AI8A 1CVZA 3KSEA 1CB5A 1BP4A 2FO5A 2VHFA 2NQIA 3CBKA 2O6XA 3USVA 1GCBA 3V6EA 4YYVA 4OVZA 2YJBA 2IBIA 3W31A 3P5XA 4N79A 2AUZA 3PHXA 4RKXA 3E1ZB 2FT2A 8PCHA 1A6RA 2B1MA 2DZYA 1YALA 2HD5A 2WBFX 1M6DA 4YYRA 2J7QC 1ZCMA 4K7CA 3B79A 5JA7A 4MI7A 4WURA 3CH3X 3CH2X 4AXMA 1BGOA 1VJVA 1PE6A 3D6SA 9PAPA 2DC6A 3MTVA 3H8CA 5EZQA 1PVJA 3NHEA 3WXFA 1JQPA 3PW3A 2FRAA 1FH0A 2JTCA 2BDZA 3IFUA 1NQCA 3OF9A 3KKUA 3BC3A 2R9CA 2XU5A 4BOZA 1TL9A 1YVBA 1SP4B 4YV8A 5EF4A 3MHHA 3BOWA 2BDLA 1F2BA 2PREA 3KWZA 1O0EA 2XU1A 4YVAA 3WXEA 1U5IA 2VHSA 2F7DA 3ERVA 4YYQA 1QXPA 1AYUA 1KXRA 1BQIA 1VSNA 1NB5A 4BQVA 3IUTA 3PHWA 3ZNHA 1STFE 1MHWA 4QRVA 1F2CA 4CDEB 2YJCA 2AGAA 3BBAA 4W5CA 3H6SA 3ZUAA 1DF0A 3I06A 3QJ3A 3BY4A 4HXDB 5FPWA 2PADA 1F29A 3N3KA 1XKGA 5CVNB 3IV2A 1NLJA 1CS8A 2R9MA 4ZUXU 1QOLA 1NPZA 4A5UA 2P86A 1YT7A 1PBHA 4FK5A 4PI3A 1NB3A 5A24A 2CIOA 4PT5A 1CPJA 1U9WA 4FIPA 2DOSA 4MSXA 3QSDA 1S4VA 3PSEA 1MEGA 4MM3B 3OF8A 4P6GA 4MZOA 4HWYA 3K24A 4BOUA 5JZEA 2AYNA 1U9XA 4M0WA 2B1NA 3RVVA 3TNXA 3PRMA 3DF0A 3O65A 2E00A 3LXSA 3N3GA 4QRGA 2FRQA 2F1GA 5J94A 3RNVA 1YK8A 4DMXA 3HD3A 2UZJA 4BS6A 2J7QA 1U9QX 4N4ZA 3F5VA 4BOSA 1ZIVA 3PNRA 1PPOA 1EWLA 3MJ5A 3H89A 2R9NA 2FTDA 2GHUA 3IOQA 5CVOB 3HWNA 3PBHA 4IUMA 2JQGR 3BPFA 3RVWA 3F75A 2E03A 2DJGB 5CHTA 4R3DA 4RF1A 1QDQA 2CB5A 1YZBA 3TMPA 3KWBX 2DC8A 1CV8A 2FUDA 3IEJA 2R9FA 3H7DA 4KLBA 1HUCB 2YJ9A 3PHUA 2G6DA 3KX1A 5K16A 4YYSA 1THEA 4ZTBA 1DKIA 3OISA 3BWKA 2Z84A 1CSBB 1POPA 4X6HA 3OQCA 1ATKA 1KFXL 4PP1A 1CQDA 2OULA 1X9YA 5JH3A 1PPDA 3U8EA 1MIRA 2GFOA 2XU3A 1AU4A 2DCDA 1DEUA 4BOPA 1U9VA 4Q8HA 4BS5A 2JQFR 3GCBA 1AECA 3BCNA 5EZSA 4BOQA 4W4UA 4PADA 4D8BA 1EWMA 2PBHA 1PIPA 3B21A 3TRKA 1AYVA 3P5WA 4OELA 4QH6A 3RVXA 1TU6A 2ATOA 2Y5BA 1KFUL 4CDFB 3QT4A 4REZA 1F2AA 2G8JA 3BB7A 3K9MA 1PXVA 2HHNA 2P7UA 3N4CA 1KHPA 1ME3A 2AS8A 2FE8A 4WA6A 2DCAA 1CTEA 4XZXA 2E01A 2G8EA 4P6EA 6PADA 4P16A 1AU3A 2P0RA 1GMYA 3P5UA 1ICFA 1MDWA 3MHSA 4I05A 1BY8A 3C9EA 2G7YA 3PDFA 4G54A 3CBJA 1YK7A 3IHPA 3O0UA 2Y6EA 2AIMA 4N8WA 1EWPA 2ARYA 1EWOA 1CJLA 5CHVA 4BSQA 1Q6KA 2HH5A 2DZZA 2PNSA 2AYOA 3KFQA 4Q8GA 1AU2A 4YYWA 3W30A 1AIMA 3LFYA 1ITOA 1Y4HA 2FQ9A 3M99A 2ACTA 2BTWB 4CDDB 4D8EA 1PPNA 2FYEA 7PCKA 5EGWA 4D8IA 1MS6A 3IMAA 4W5BA 3S3RA 2JRIA 4OEMA 2IPPB 4AXLA 3E9SA 2NQDB 1Y08A 4BPVA 2DCCA 2DC7A 4QBBA 2BU3A 3S3QA 2NQAA 5KO3A 2AVWA 1IWDA 1PADA 3MTNA 3WXGA 4FJCA 1MEMA 4X6JA 3HHIA 4I04A 1PPPA 1QMYA 2AUXA 4XUIA 4RY2A 2YJ2A 3PT2A 4YYUA 1AYWA 2AU1A 2HWKA 3C0RA 1PCIA 4OVZB 1TLOA 5PADA 4DMYA 5E6JA 1K3BB 2DCBA 3PRPA 2C0YA 5CVMA 4CDCB 4I07A 3O1GA 4RNAA 4RF0A 1GECE 2DC9A 2NQGA 4CZWA 2R9OA 3I3TA 2OZ2A 4MZSA 3V6CA 4PP2E 5F02A 2BTWA 2YJ8A 2DJFB 3K8UA 3MORA 1EF7A 1NL6A 3OVXA 1ME4A 3HHAA 2HXZA 4XR7A 2R6NA 4X6IA 3BPMA 4OW0A 2OP3A 4QRXA 2E02A 1AU0A 1KHQA 2XU4A 3KW9A 3H8BA 2H7JA 3P5VA 1SNKA 3MP2A 1GLOA
chains in the Genus database with same CATH topology
3OVZA 3AI8A 1CVZA 3KSEA 1CB5A 1BP4A 2FO5A 2VHFA 2NQIA 3CBKA 2O6XA 3USVA 1GCBA 3V6EA 4YYVA 2YJBA 2IBIA 3LTWA 3P5XA 4N79A 2AUZA 3E1ZB 4B55A 2VFBA 2FT2A 8PCHA 1A6RA 2B1MA 2DZYA 1YALA 2HD5A 2WBFX 1M6DA 4YYRA 1ZCMA 4K7CA 3B79A 5JA7A 3CH3X 3CH2X 4AXMA 1BGOA 1VJVA 1PE6A 3D6SA 9PAPA 2DC6A 3H8CA 3NHEA 3WXFA 1JQPA 3PW3A 2FRAA 1FH0A 2BDZA 1NQCA 3OF9A 3KKUA 3BC3A 2R9CA 2XU5A 1TL9A 1YVBA 1SP4B 4YV8A 5EF4A 3MHHA 3BOWA 2BDLA 1F2BA 2PREA 3KWZA 1O0EA 2XU1A 4YVAA 3WXEA 1U5IA 2VHSA 2F7DA 3ERVA 4YYQA 1QXPA 1AYUA 1KXRA 1BQIA 1VSNA 1NB5A 4BQVA 3IUTA 1STFE 1MHWA 4QRVA 1F2CA 4CDEB 2YJCA 4W5CA 3H6SA 3ZUAA 1DF0A 3I06A 3QJ3A 5FPWA 2PADA 1F29A 3N3KA 1XKGA 5CVNB 3IV2A 1NLJA 1CS8A 2R9MA 4ZUXU 1QOLA 1NPZA 2P86A 1YT7A 1PBHA 4FK5A 4PI3A 1NB3A 2CIOA 1CPJA 1U9WA 4FIPA 4MSXA 3QSDA 1S4VA 1MEGA 3OF8A 4P6GA 4MZOA 4HWYA 3K24A 2AYNA 1U9XA 2B1NA 3RVVA 3TNXA 3DF0A 2E00A 3LXSA 3N3GA 4QRGA 2FRQA 2F1GA 5J94A 1YK8A 4DMXA 3HD3A 4BS6A 1U9QX 4N4ZA 3F5VA 1ZIVA 3PNRA 1PPOA 1EWLA 3H89A 2R9NA 2FTDA 1W5RA 2GHUA 3IOQA 5CVOB 3HWNA 3PBHA 2JQGR 3BPFA 3RVWA 3F75A 2E03A 2DJGB 5CHTA 1QDQA 2CB5A 3D9WA 3KWBX 2DC8A 1CV8A 2FUDA 3IEJA 2R9FA 3H7DA 4KLBA 1HUCB 2YJ9A 2G6DA 3KX1A 5K16A 4YYSA 1THEA 3OISA 3BWKA 1CSBB 1POPA 4X6HA 1ATKA 1KFXL 4NV7A 4PP1A 1CQDA 2OULA 1X9YA 5JH3A 1PPDA 3U8EA 1MIRA 2GFOA 2XU3A 1AU4A 2DCDA 1DEUA 1U9VA 4Q8HA 4BS5A 1E2TA 2JQFR 3GCBA 1AECA 3BCNA 4W4UA 4PADA 1W4TA 1EWMA 1W6FA 2PBHA 1PIPA 1AYVA 3P5WA 4OELA 4QH6A 3RVXA 1TU6A 2ATOA 2Y5BA 1KFUL 4CDFB 3QT4A 1F2AA 2G8JA 3K9MA 1PXVA 2HHNA 2P7UA 3N4CA 1KHPA 1ME3A 2AS8A 4WA6A 2DCAA 4C5PA 1CTEA 2E01A 2G8EA 4P6EA 6PADA 1AU3A 2P0RA 1GMYA 3P5UA 1ICFA 1MDWA 3MHSA 4I05A 1BY8A 3C9EA 2G7YA 3PDFA 4G54A 3CBJA 1YK7A 3IHPA 3O0UA 2Y6EA 2AIMA 4N8WA 1EWPA 2ARYA 1EWOA 1CJLA 5CHVA 4BSQA 1Q6KA 2HH5A 2DZZA 2PNSA 2AYOA 3KFQA 4Q8GA 1AU2A 4YYWA 1AIMA 3LFYA 1ITOA 1Y4HA 2FQ9A 3M99A 2ACTA 4CDDB 1PPNA 2FYEA 7PCKA 5EGWA 2VFCA 1GX3A 1MS6A 3IMAA 4W5BA 3S3RA 4OEMA 2IPPB 4AXLA 2NQDB 1Y08A 4BPVA 2DCCA 2DC7A 4QBBA 3S3QA 2NQAA 2AVWA 1IWDA 1PADA 3MTNA 3WXGA 4FJCA 1MEMA 4X6JA 3HHIA 4I04A 1PPPA 1QMYA 2AUXA 4XUIA 4RY2A 2YJ2A 4YYUA 1AYWA 2AU1A 1PCIA 1TLOA 5PADA 4DMYA 1K3BB 2DCBA 2C0YA 5CVMA 4BGFA 4CDCB 4I07A 3O1GA 4NV8A 1GECE 2DC9A 2NQGA 4CZWA 2R9OA 3I3TA 2OZ2A 4MZSA 3V6CA 4PP2E 5F02A 2YJ8A 2DJFB 3K8UA 3MORA 4GUZA 1EF7A 1NL6A 3OVXA 1ME4A 3HHAA 2BSZA 2HXZA 4XR7A 2R6NA 4X6IA 3BPMA 2OP3A 4QRXA 2E02A 1AU0A 1KHQA 2XU4A 3KW9A 3H8BA 2H7JA 3P5VA 1SNKA 5A24A 1GLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVZ A;  3AI8 A;  1CVZ A;  3KSE A;  1CB5 A;  1BP4 A;  2FO5 A;  2VHF A;  2NQI A;  3CBK A;  2O6X A;  3USV A;  1GCB A;  3V6E A;  4YYV A;  2YJB A;  2IBI A;  3P5X A;  4N79 A;  2AUZ A;  3E1Z B;  2FT2 A;  8PCH A;  1A6R A;  2B1M A;  2DZY A;  1YAL A;  2HD5 A;  2WBF X;  1M6D A;  4YYR A;  1ZCM A;  4K7C A;  3B79 A;  5JA7 A;  3CH3 X;  3CH2 X;  4AXM A;  1BGO A;  1VJV A;  1PE6 A;  3D6S A;  9PAP A;  2DC6 A;  3H8C A;  3NHE A;  3WXF A;  1JQP A;  3PW3 A;  2FRA A;  1FH0 A;  2BDZ A;  1NQC A;  3OF9 A;  3KKU A;  3BC3 A;  2R9C A;  2XU5 A;  1TL9 A;  1YVB A;  1SP4 B;  4YV8 A;  5EF4 A;  3MHH A;  3BOW A;  2BDL A;  1F2B A;  2PRE A;  3KWZ A;  1O0E A;  2XU1 A;  4YVA A;  3WXE A;  1U5I A;  2VHS A;  2F7D A;  3ERV A;  4YYQ A;  1QXP A;  1AYU A;  1KXR A;  1BQI A;  1VSN A;  1NB5 A;  4BQV A;  3IUT A;  1STF E;  1MHW A;  4QRV A;  1F2C A;  4CDE B;  2YJC A;  4W5C A;  3H6S A;  3ZUA A;  1DF0 A;  3I06 A;  3QJ3 A;  5FPW A;  2PAD A;  1F29 A;  3N3K A;  1XKG A;  5CVN B;  3IV2 A;  1NLJ A;  1CS8 A;  2R9M A;  4ZUX U;  1QOL A;  1NPZ A;  2P86 A;  1YT7 A;  1PBH A;  4FK5 A;  4PI3 A;  1NB3 A;  2CIO A;  1CPJ A;  1U9W A;  4FIP A;  4MSX A;  3QSD A;  1S4V A;  1MEG A;  3OF8 A;  4P6G A;  4MZO A;  4HWY A;  3K24 A;  2AYN A;  1U9X A;  2B1N A;  3RVV A;  3TNX A;  3DF0 A;  2E00 A;  3LXS A;  3N3G A;  4QRG A;  2FRQ A;  2F1G A;  5J94 A;  1YK8 A;  4DMX A;  3HD3 A;  4BS6 A;  1U9Q X;  4N4Z A;  3F5V A;  1ZIV A;  3PNR A;  1PPO A;  1EWL A;  3H89 A;  2R9N A;  2FTD A;  2GHU A;  3IOQ A;  5CVO B;  3HWN A;  3PBH A;  2JQG R;  3BPF A;  3RVW A;  3F75 A;  2E03 A;  2DJG B;  5CHT A;  1QDQ A;  2CB5 A;  3KWB X;  2DC8 A;  1CV8 A;  2FUD A;  3IEJ A;  2R9F A;  3H7D A;  4KLB A;  1HUC B;  2YJ9 A;  2G6D A;  3KX1 A;  5K16 A;  4YYS A;  1THE A;  3OIS A;  3BWK A;  1CSB B;  1POP A;  4X6H A;  1ATK A;  1KFX L;  4PP1 A;  1CQD A;  2OUL A;  1X9Y A;  5JH3 A;  1PPD A;  3U8E A;  1MIR A;  2GFO A;  2XU3 A;  1AU4 A;  2DCD A;  1DEU A;  1U9V A;  4Q8H A;  4BS5 A;  2JQF R;  3GCB A;  1AEC A;  3BCN A;  4W4U A;  4PAD A;  1EWM A;  2PBH A;  1PIP A;  1AYV A;  3P5W A;  4OEL A;  4QH6 A;  3RVX A;  1TU6 A;  2ATO A;  2Y5B A;  1KFU L;  4CDF B;  3QT4 A;  1F2A A;  2G8J A;  3K9M A;  1PXV A;  2HHN A;  2P7U A;  3N4C A;  1KHP A;  1ME3 A;  2AS8 A;  4WA6 A;  2DCA A;  1CTE A;  2E01 A;  2G8E A;  4P6E A;  6PAD A;  1AU3 A;  2P0R A;  1GMY A;  3P5U A;  1ICF A;  1MDW A;  3MHS A;  4I05 A;  1BY8 A;  3C9E A;  2G7Y A;  3PDF A;  4G54 A;  3CBJ A;  1YK7 A;  3IHP A;  3O0U A;  2Y6E A;  2AIM A;  4N8W A;  1EWP A;  2ARY A;  1EWO A;  1CJL A;  5CHV A;  4BSQ A;  1Q6K A;  2HH5 A;  2DZZ A;  2PNS A;  2AYO A;  3KFQ A;  4Q8G A;  1AU2 A;  4YYW A;  1AIM A;  3LFY A;  1ITO A;  1Y4H A;  2FQ9 A;  3M99 A;  2ACT A;  4CDD B;  1PPN A;  2FYE A;  7PCK A;  5EGW A;  1MS6 A;  3IMA A;  4W5B A;  3S3R A;  4OEM A;  2IPP B;  4AXL A;  2NQD B;  1Y08 A;  4BPV A;  2DCC A;  2DC7 A;  4QBB A;  3S3Q A;  2NQA A;  2AVW A;  1IWD A;  1PAD A;  3MTN A;  3WXG A;  4FJC A;  1MEM A;  4X6J A;  3HHI A;  4I04 A;  1PPP A;  1QMY A;  2AUX A;  4XUI A;  4RY2 A;  2YJ2 A;  4YYU A;  1AYW A;  2AU1 A;  1PCI A;  1TLO A;  5PAD A;  4DMY A;  1K3B B;  2DCB A;  2C0Y A;  5CVM A;  4CDC B;  4I07 A;  3O1G A;  1GEC E;  2DC9 A;  2NQG A;  4CZW A;  2R9O A;  3I3T A;  2OZ2 A;  4MZS A;  3V6C A;  4PP2 E;  5F02 A;  2YJ8 A;  2DJF B;  3K8U A;  3MOR A;  1EF7 A;  1NL6 A;  3OVX A;  1ME4 A;  3HHA A;  2HXZ A;  4XR7 A;  2R6N A;  4X6I A;  3BPM A;  2OP3 A;  4QRX A;  2E02 A;  1AU0 A;  1KHQ A;  2XU4 A;  3KW9 A;  3H8B A;  2H7J A;  3P5V A;  1SNK A;  5A24 A;  1GLO A; 
#chains in the Genus database with same CATH topology
 4IP3 A;  1UKF A;  3OVZ A;  4GUA A;  3AI8 A;  1CVZ A;  3KSE A;  1CB5 A;  1BP4 A;  2FO5 A;  2VHF A;  2NQI A;  3CBK A;  2O6X A;  3USV A;  1GCB A;  3V6E A;  4YYV A;  4OVZ A;  2YJB A;  2IBI A;  3W31 A;  3P5X A;  4N79 A;  2AUZ A;  3PHX A;  4RKX A;  3E1Z B;  2FT2 A;  8PCH A;  1A6R A;  2B1M A;  2DZY A;  1YAL A;  2HD5 A;  2WBF X;  1M6D A;  4YYR A;  2J7Q C;  1ZCM A;  4K7C A;  3B79 A;  5JA7 A;  4MI7 A;  4WUR A;  3CH3 X;  3CH2 X;  4AXM A;  1BGO A;  1VJV A;  1PE6 A;  3D6S A;  9PAP A;  2DC6 A;  3MTV A;  3H8C A;  5EZQ A;  1PVJ A;  3NHE A;  3WXF A;  1JQP A;  3PW3 A;  2FRA A;  1FH0 A;  2JTC A;  2BDZ A;  3IFU A;  1NQC A;  3OF9 A;  3KKU A;  3BC3 A;  2R9C A;  2XU5 A;  4BOZ A;  1TL9 A;  1YVB A;  1SP4 B;  4YV8 A;  5EF4 A;  3MHH A;  3BOW A;  2BDL A;  1F2B A;  2PRE A;  3KWZ A;  1O0E A;  2XU1 A;  4YVA A;  3WXE A;  1U5I A;  2VHS A;  2F7D A;  3ERV A;  4YYQ A;  1QXP A;  1AYU A;  1KXR A;  1BQI A;  1VSN A;  1NB5 A;  4BQV A;  3IUT A;  3PHW A;  3ZNH A;  1STF E;  1MHW A;  4QRV A;  1F2C A;  4CDE B;  2YJC A;  2AGA A;  3BBA A;  4W5C A;  3H6S A;  3ZUA A;  1DF0 A;  3I06 A;  3QJ3 A;  3BY4 A;  4HXD B;  5FPW A;  2PAD A;  1F29 A;  3N3K A;  1XKG A;  5CVN B;  3IV2 A;  1NLJ A;  1CS8 A;  2R9M A;  4ZUX U;  1QOL A;  1NPZ A;  4A5U A;  2P86 A;  1YT7 A;  1PBH A;  4FK5 A;  4PI3 A;  1NB3 A;  5A24 A;  2CIO A;  4PT5 A;  1CPJ A;  1U9W A;  4FIP A;  2DOS A;  4MSX A;  3QSD A;  1S4V A;  3PSE A;  1MEG A;  4MM3 B;  3OF8 A;  4P6G A;  4MZO A;  4HWY A;  3K24 A;  4BOU A;  5JZE A;  2AYN A;  1U9X A;  4M0W A;  2B1N A;  3RVV A;  3TNX A;  3PRM A;  3DF0 A;  3O65 A;  2E00 A;  3LXS A;  3N3G A;  4QRG A;  2FRQ A;  2F1G A;  5J94 A;  3RNV A;  1YK8 A;  4DMX A;  3HD3 A;  2UZJ A;  4BS6 A;  2J7Q A;  1U9Q X;  4N4Z A;  3F5V A;  4BOS A;  1ZIV A;  3PNR A;  1PPO A;  1EWL A;  3MJ5 A;  3H89 A;  2R9N A;  2FTD A;  2GHU A;  3IOQ A;  5CVO B;  3HWN A;  3PBH A;  4IUM A;  2JQG R;  3BPF A;  3RVW A;  3F75 A;  2E03 A;  2DJG B;  5CHT A;  4R3D A;  4RF1 A;  1QDQ A;  2CB5 A;  1YZB A;  3TMP A;  3KWB X;  2DC8 A;  1CV8 A;  2FUD A;  3IEJ A;  2R9F A;  3H7D A;  4KLB A;  1HUC B;  2YJ9 A;  3PHU A;  2G6D A;  3KX1 A;  5K16 A;  4YYS A;  1THE A;  4ZTB A;  1DKI A;  3OIS A;  3BWK A;  2Z84 A;  1CSB B;  1POP A;  4X6H A;  3OQC A;  1ATK A;  1KFX L;  4PP1 A;  1CQD A;  2OUL A;  1X9Y A;  5JH3 A;  1PPD A;  3U8E A;  1MIR A;  2GFO A;  2XU3 A;  1AU4 A;  2DCD A;  1DEU A;  4BOP A;  1U9V A;  4Q8H A;  4BS5 A;  2JQF R;  3GCB A;  1AEC A;  3BCN A;  5EZS A;  4BOQ A;  4W4U A;  4PAD A;  4D8B A;  1EWM A;  2PBH A;  1PIP A;  3B21 A;  3TRK A;  1AYV A;  3P5W A;  4OEL A;  4QH6 A;  3RVX A;  1TU6 A;  2ATO A;  2Y5B A;  1KFU L;  4CDF B;  3QT4 A;  4REZ A;  1F2A A;  2G8J A;  3BB7 A;  3K9M A;  1PXV A;  2HHN A;  2P7U A;  3N4C A;  1KHP A;  1ME3 A;  2AS8 A;  2FE8 A;  4WA6 A;  2DCA A;  1CTE A;  4XZX A;  2E01 A;  2G8E A;  4P6E A;  6PAD A;  4P16 A;  1AU3 A;  2P0R A;  1GMY A;  3P5U A;  1ICF A;  1MDW A;  3MHS A;  4I05 A;  1BY8 A;  3C9E A;  2G7Y A;  3PDF A;  4G54 A;  3CBJ A;  1YK7 A;  3IHP A;  3O0U A;  2Y6E A;  2AIM A;  4N8W A;  1EWP A;  2ARY A;  1EWO A;  1CJL A;  5CHV A;  4BSQ A;  1Q6K A;  2HH5 A;  2DZZ A;  2PNS A;  2AYO A;  3KFQ A;  4Q8G A;  1AU2 A;  4YYW A;  3W30 A;  1AIM A;  3LFY A;  1ITO A;  1Y4H A;  2FQ9 A;  3M99 A;  2ACT A;  2BTW B;  4CDD B;  4D8E A;  1PPN A;  2FYE A;  7PCK A;  5EGW A;  4D8I A;  1MS6 A;  3IMA A;  4W5B A;  3S3R A;  2JRI A;  4OEM A;  2IPP B;  4AXL A;  3E9S A;  2NQD B;  1Y08 A;  4BPV A;  2DCC A;  2DC7 A;  4QBB A;  2BU3 A;  3S3Q A;  2NQA A;  5KO3 A;  2AVW A;  1IWD A;  1PAD A;  3MTN A;  3WXG A;  4FJC A;  1MEM A;  4X6J A;  3HHI A;  4I04 A;  1PPP A;  1QMY A;  2AUX A;  4XUI A;  4RY2 A;  2YJ2 A;  3PT2 A;  4YYU A;  1AYW A;  2AU1 A;  2HWK A;  3C0R A;  1PCI A;  4OVZ B;  1TLO A;  5PAD A;  4DMY A;  5E6J A;  1K3B B;  2DCB A;  3PRP A;  2C0Y A;  5CVM A;  4CDC B;  4I07 A;  3O1G A;  4RNA A;  4RF0 A;  1GEC E;  2DC9 A;  2NQG A;  4CZW A;  2R9O A;  3I3T A;  2OZ2 A;  4MZS A;  3V6C A;  4PP2 E;  5F02 A;  2BTW A;  2YJ8 A;  2DJF B;  3K8U A;  3MOR A;  1EF7 A;  1NL6 A;  3OVX A;  1ME4 A;  3HHA A;  2HXZ A;  4XR7 A;  2R6N A;  4X6I A;  3BPM A;  4OW0 A;  2OP3 A;  4QRX A;  2E02 A;  1AU0 A;  1KHQ A;  2XU4 A;  3KW9 A;  3H8B A;  2H7J A;  3P5V A;  1SNK A;  3MP2 A;  1GLO A; 
#chains in the Genus database with same CATH homology
 3OVZ A;  3AI8 A;  1CVZ A;  3KSE A;  1CB5 A;  1BP4 A;  2FO5 A;  2VHF A;  2NQI A;  3CBK A;  2O6X A;  3USV A;  1GCB A;  3V6E A;  4YYV A;  2YJB A;  2IBI A;  3LTW A;  3P5X A;  4N79 A;  2AUZ A;  3E1Z B;  4B55 A;  2VFB A;  2FT2 A;  8PCH A;  1A6R A;  2B1M A;  2DZY A;  1YAL A;  2HD5 A;  2WBF X;  1M6D A;  4YYR A;  1ZCM A;  4K7C A;  3B79 A;  5JA7 A;  3CH3 X;  3CH2 X;  4AXM A;  1BGO A;  1VJV A;  1PE6 A;  3D6S A;  9PAP A;  2DC6 A;  3H8C A;  3NHE A;  3WXF A;  1JQP A;  3PW3 A;  2FRA A;  1FH0 A;  2BDZ A;  1NQC A;  3OF9 A;  3KKU A;  3BC3 A;  2R9C A;  2XU5 A;  1TL9 A;  1YVB A;  1SP4 B;  4YV8 A;  5EF4 A;  3MHH A;  3BOW A;  2BDL A;  1F2B A;  2PRE A;  3KWZ A;  1O0E A;  2XU1 A;  4YVA A;  3WXE A;  1U5I A;  2VHS A;  2F7D A;  3ERV A;  4YYQ A;  1QXP A;  1AYU A;  1KXR A;  1BQI A;  1VSN A;  1NB5 A;  4BQV A;  3IUT A;  1STF E;  1MHW A;  4QRV A;  1F2C A;  4CDE B;  2YJC A;  4W5C A;  3H6S A;  3ZUA A;  1DF0 A;  3I06 A;  3QJ3 A;  5FPW A;  2PAD A;  1F29 A;  3N3K A;  1XKG A;  5CVN B;  3IV2 A;  1NLJ A;  1CS8 A;  2R9M A;  4ZUX U;  1QOL A;  1NPZ A;  2P86 A;  1YT7 A;  1PBH A;  4FK5 A;  4PI3 A;  1NB3 A;  2CIO A;  1CPJ A;  1U9W A;  4FIP A;  4MSX A;  3QSD A;  1S4V A;  1MEG A;  3OF8 A;  4P6G A;  4MZO A;  4HWY A;  3K24 A;  2AYN A;  1U9X A;  2B1N A;  3RVV A;  3TNX A;  3DF0 A;  2E00 A;  3LXS A;  3N3G A;  4QRG A;  2FRQ A;  2F1G A;  5J94 A;  1YK8 A;  4DMX A;  3HD3 A;  4BS6 A;  1U9Q X;  4N4Z A;  3F5V A;  1ZIV A;  3PNR A;  1PPO A;  1EWL A;  3H89 A;  2R9N A;  2FTD A;  1W5R A;  2GHU A;  3IOQ A;  5CVO B;  3HWN A;  3PBH A;  2JQG R;  3BPF A;  3RVW A;  3F75 A;  2E03 A;  2DJG B;  5CHT A;  1QDQ A;  2CB5 A;  3D9W A;  3KWB X;  2DC8 A;  1CV8 A;  2FUD A;  3IEJ A;  2R9F A;  3H7D A;  4KLB A;  1HUC B;  2YJ9 A;  2G6D A;  3KX1 A;  5K16 A;  4YYS A;  1THE A;  3OIS A;  3BWK A;  1CSB B;  1POP A;  4X6H A;  1ATK A;  1KFX L;  4NV7 A;  4PP1 A;  1CQD A;  2OUL A;  1X9Y A;  5JH3 A;  1PPD A;  3U8E A;  1MIR A;  2GFO A;  2XU3 A;  1AU4 A;  2DCD A;  1DEU A;  1U9V A;  4Q8H A;  4BS5 A;  1E2T A;  2JQF R;  3GCB A;  1AEC A;  3BCN A;  4W4U A;  4PAD A;  1W4T A;  1EWM A;  1W6F A;  2PBH A;  1PIP A;  1AYV A;  3P5W A;  4OEL A;  4QH6 A;  3RVX A;  1TU6 A;  2ATO A;  2Y5B A;  1KFU L;  4CDF B;  3QT4 A;  1F2A A;  2G8J A;  3K9M A;  1PXV A;  2HHN A;  2P7U A;  3N4C A;  1KHP A;  1ME3 A;  2AS8 A;  4WA6 A;  2DCA A;  4C5P A;  1CTE A;  2E01 A;  2G8E A;  4P6E A;  6PAD A;  1AU3 A;  2P0R A;  1GMY A;  3P5U A;  1ICF A;  1MDW A;  3MHS A;  4I05 A;  1BY8 A;  3C9E A;  2G7Y A;  3PDF A;  4G54 A;  3CBJ A;  1YK7 A;  3IHP A;  3O0U A;  2Y6E A;  2AIM A;  4N8W A;  1EWP A;  2ARY A;  1EWO A;  1CJL A;  5CHV A;  4BSQ A;  1Q6K A;  2HH5 A;  2DZZ A;  2PNS A;  2AYO A;  3KFQ A;  4Q8G A;  1AU2 A;  4YYW A;  1AIM A;  3LFY A;  1ITO A;  1Y4H A;  2FQ9 A;  3M99 A;  2ACT A;  4CDD B;  1PPN A;  2FYE A;  7PCK A;  5EGW A;  2VFC A;  1GX3 A;  1MS6 A;  3IMA A;  4W5B A;  3S3R A;  4OEM A;  2IPP B;  4AXL A;  2NQD B;  1Y08 A;  4BPV A;  2DCC A;  2DC7 A;  4QBB A;  3S3Q A;  2NQA A;  2AVW A;  1IWD A;  1PAD A;  3MTN A;  3WXG A;  4FJC A;  1MEM A;  4X6J A;  3HHI A;  4I04 A;  1PPP A;  1QMY A;  2AUX A;  4XUI A;  4RY2 A;  2YJ2 A;  4YYU A;  1AYW A;  2AU1 A;  1PCI A;  1TLO A;  5PAD A;  4DMY A;  1K3B B;  2DCB A;  2C0Y A;  5CVM A;  4BGF A;  4CDC B;  4I07 A;  3O1G A;  4NV8 A;  1GEC E;  2DC9 A;  2NQG A;  4CZW A;  2R9O A;  3I3T A;  2OZ2 A;  4MZS A;  3V6C A;  4PP2 E;  5F02 A;  2YJ8 A;  2DJF B;  3K8U A;  3MOR A;  4GUZ A;  1EF7 A;  1NL6 A;  3OVX A;  1ME4 A;  3HHA A;  2BSZ A;  2HXZ A;  4XR7 A;  2R6N A;  4X6I A;  3BPM A;  2OP3 A;  4QRX A;  2E02 A;  1AU0 A;  1KHQ A;  2XU4 A;  3KW9 A;  3H8B A;  2H7J A;  3P5V A;  1SNK A;  5A24 A;  1GLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...