3H8BA

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors(compound 9)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
215
Chain Sequence
b'APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L1
publication title A combined crystallographic and molecular dynamics study of cathepsin L retrobinding inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 215
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h8bA00
2WBFX 2R9MA 3N4CA 2NQGA 4YYUA 2XU4A 1U5IA 4DMXA 4N79A 1Y08A 3B79A 1CPJA 2P86A 5FPWA 1PE6A 2B1NA 1NLJA 2R6NA 3KW9A 2HH5A 3F75A 1NQCA 1S4VA 2E02A 1ATKA 1YK7A 1QXPA 1PXVA 4WA6A 2DZZA 1PCIA 2G8EA 1GMYA 1MS6A 1SNKA 2PNSA 3CBJA 2YJ9A 1AU0A 1YT7A 4OEMA 2DC7A 3BPMA 4I04A 4YVAA 1CSBB 2DCDA 3P5XA 1EF7A 1A6RA 1PADA 3N3GA 1PPDA 1M6DA 2AS8A 4W5BA 2VHFA 1GECE 4Q8GA 1F2AA 2R9CA 3PDFA 4YYRA 5CHTA 1TU6A 3WXEA 4XR7A 4HWYA 1NB5A 3NHEA 4QH6A 4X6IA 3LXSA 2BDZA 2YJCA 2OZ2A 3BOWA 3KKUA 3WXGA 2G6DA 1DEUA 4BS6A 3QJ3A 1AYVA 1MHWA 4PP1A 1CQDA 3GCBA 4ZUXU 1CTEA 2HD5A 2Y6EA 3OISA 2R9OA 1KFUL 3KWBX 4MZOA 5JH3A 4XUIA 2R9FA 1AU4A 4QBBA 2XU5A 4I05A 1EWPA 1NPZA 1ITOA 4OELA 5CVNB 6PADA 2JQGR 1TL9A 2IPPB 3S3QA 3I3TA 4Q8HA 1CS8A 4QRXA 4RY2A 1BGOA 3O0UA 1PIPA 2AUXA 3K24A 2DZYA 2IBIA 5EF4A 1K3BB 4PADA 2E01A 3N3KA 2FYEA 4P6EA 2NQIA 3WXFA 4BSQA 4MSXA 3BCNA 1F29A 3MHHA 2YJ8A 2DC6A 2OULA 3RVXA 5J94A 1BQIA 2AYNA 4BPVA 1EWMA 3BC3A 1KFXL 1KXRA 2Y5BA 2DCCA 1AIMA 4CDFB 3LFYA 3K8UA 3V6CA 1QDQA 3ZUAA 1EWLA 5JA7A 1ME3A 4PP2E 1NL6A 2GHUA 2NQDB 2FRQA 2R9NA 3BPFA 3IHPA 4N8WA 3OVXA 3CBKA 5CVMA 3E1ZB 1AU2A 5EGWA 3PW3A 2DCAA 1QMYA 3KSEA 2AIMA 3QSDA 1MDWA 2ARYA 2CIOA 4W4UA 2G7YA 3P5VA 1AU3A 1PPOA 3QT4A 2C0YA 3H8CA 1VSNA 1F2BA 3D6SA 4CDCB 3H8BA 3IMAA 4YV8A 1EWOA 2HHNA 3MTNA 1GLOA 1U9XA 3OF8A 4PI3A 4MZSA 1XKGA 3TNXA 4X6HA 1MIRA 3O1GA 2CB5A 2E00A 2DC8A 3H6SA 2JQFR 3H89A 3M99A 2AVWA 1CV8A 3BWKA 1YK8A 5PADA 1FH0A 2BDLA 3AI8A 1U9VA 2YJ2A 3P5WA 2F1GA 1Y4HA 1VJVA 2VHSA 5K16A 4N4ZA 3MHSA 2XU1A 2PBHA 1YALA 3F5VA 4CDDB 5CHVA 1U9WA 4YYSA 1X9YA 3RVVA 3HWNA 2OP3A 2PADA 1CB5A 2FRAA 4AXMA 3CH3X 2H7JA 1PPPA 3OF9A 4X6JA 3IV2A 2O6XA 4FIPA 2AUZA 3IOQA 3PNRA 1NB3A 3C9EA 1DF0A 1ME4A 2ATOA 2B1MA 2GFOA 3MORA 4CDEB 1ZIVA 2AYOA 1STFE 1O0EA 2F7DA 4YYQA 3ERVA 2E03A 3U8EA 1HUCB 4AXLA 5F02A 1QOLA 2G8JA 2P7UA 3K9MA 1POPA 2DJFB 2FO5A 2XU3A 2DC9A 1IWDA 4YYWA 4I07A 4K7CA 2P0RA 2FT2A 1TLOA 4DMYA 1ZCMA 3V6EA 3I06A 4P6GA 3IEJA 5A24A 1CVZA 3CH2X 1SP4B 2FUDA 2AU1A 3KWZA 1AYWA 3KFQA 1KHPA 1F2CA 3IUTA 1BY8A 1KHQA 4KLBA 3USVA 1Q6KA 1AYUA 1MEMA 1ICFA 3HHAA 3HHIA 5CVOB 1GCBA 2FTDA 3RVWA 2DCBA 1AECA 4BS5A 2PREA 9PAPA 2YJBA 3S3RA 2DJGB 1CJLA 1PBHA 4BQVA 1MEGA 1U9QX 1PPNA 3DF0A 4YYVA 3HD3A 2ACTA 7PCKA 4FK5A 1YVBA 4FJCA 1THEA 4QRGA 4W5CA 1JQPA 3KX1A 2NQAA 4QRVA 8PCHA 1BP4A 2HXZA 2FQ9A 4G54A 3PBHA 3H7DA 3P5UA 4CZWA 3OVZA
chains in the Genus database with same CATH superfamily
2WBFX 2R9MA 3N4CA 2NQGA 4YYUA 2XU4A 1U5IA 2FE8A 4N79A 4DMXA 1Y08A 3B79A 1CPJA 2P86A 5FPWA 1PE6A 2B1NA 1NLJA 2R6NA 3KW9A 2HH5A 4GUAA 3F75A 1NQCA 1S4VA 2E02A 1ATKA 1YK7A 2UZJA 1QXPA 1PXVA 4WA6A 2DZZA 1PCIA 2G8EA 1GMYA 1MS6A 1SNKA 2PNSA 3CBJA 3PRPA 2YJ9A 1AU0A 1YT7A 4ZTBA 4OEMA 2DC7A 3BPMA 4I04A 4YVAA 1CSBB 4D8IA 2DCDA 3P5XA 4BOSA 1EF7A 1A6RA 1PADA 3N3GA 4XZXA 1UKFA 1PPDA 1M6DA 4MI7A 2AS8A 4W5BA 2VHFA 1GECE 4Q8GA 5E6JA 3MTVA 2HWKA 1F2AA 2R9CA 3PDFA 4YYRA 5CHTA 1TU6A 3WXEA 4XR7A 4HWYA 1NB5A 3NHEA 4QH6A 4X6IA 3ZNHA 3LXSA 5EZQA 2BDZA 2YJCA 2OZ2A 3BOWA 3KKUA 3WXGA 2G6DA 1DEUA 2BTWB 4BS6A 3BB7A 3QJ3A 1AYVA 1MHWA 4PP1A 1CQDA 3GCBA 4ZUXU 2AGAA 1CTEA 2HD5A 2JTCA 2Y6EA 3OISA 2R9OA 1KFUL 3KWBX 4MZOA 3O65A 3PHXA 5JH3A 4XUIA 2R9FA 4OVZA 1AU4A 4QBBA 2XU5A 4I05A 1EWPA 1NPZA 1ITOA 1DKIA 4OELA 5CVNB 6PADA 3PHWA 2JQGR 4RNAA 1TL9A 2IPPB 3S3QA 3I3TA 4Q8HA 3BY4A 1CS8A 4QRXA 4RY2A 4BOZA 1BGOA 3O0UA 1PIPA 2AUXA 3K24A 2DZYA 4RF1A 2IBIA 5EF4A 1K3BB 4IP3A 4PADA 2E01A 3N3KA 2FYEA 2BU3A 4P6EA 3OQCA 2NQIA 3E9SA 3WXFA 5JZEA 4BSQA 4MSXA 2DOSA 3BCNA 1F29A 3MHHA 2YJ8A 2DC6A 3MP2A 4REZA 2OULA 3RVXA 5J94A 3BBAA 1BQIA 2AYNA 4BPVA 1EWMA 1YZBA 3BC3A 1KFXL 1KXRA 2Y5BA 2DCCA 1AIMA 4CDFB 3LFYA 3K8UA 3V6CA 1QDQA 3ZUAA 1EWLA 5JA7A 4A5UA 1ME3A 4PP2E 3TRKA 1NL6A 2GHUA 2NQDB 4R3DA 2FRQA 2R9NA 3BPFA 3IHPA 4N8WA 3OVXA 3CBKA 5CVMA 3E1ZB 1AU2A 5EGWA 3PW3A 2DCAA 1QMYA 5KO3A 3KSEA 2AIMA 3QSDA 1MDWA 2ARYA 3PHUA 2CIOA 4W4UA 2G7YA 3P5VA 1AU3A 1PPOA 3QT4A 2C0YA 3H8CA 1VSNA 1F2BA 3D6SA 4OVZB 4CDCB 3H8BA 3IMAA 4YV8A 1EWOA 2HHNA 3MTNA 3PSEA 1GLOA 1U9XA 3OF8A 4PI3A 4P16A 4MZSA 1XKGA 3TNXA 4X6HA 1MIRA 3RNVA 3O1GA 2CB5A 2E00A 2DC8A 3H6SA 2JQFR 3MJ5A 3H89A 3M99A 2AVWA 1CV8A 3BWKA 1YK8A 5PADA 1FH0A 2BDLA 3AI8A 1U9VA 2YJ2A 1PVJA 3P5WA 4RF0A 2F1GA 1Y4HA 1VJVA 2VHSA 5K16A 4N4ZA 3W30A 3MHSA 2XU1A 2PBHA 1YALA 3F5VA 4CDDB 5CHVA 1U9WA 4YYSA 1X9YA 3RVVA 3HWNA 4HXDB 2OP3A 2PADA 4MM3B 1CB5A 4BOPA 2FRAA 4AXMA 3CH3X 4D8BA 2H7JA 1PPPA 3C0RA 3OF9A 4X6JA 5EZSA 4M0WA 3IV2A 2O6XA 4FIPA 2AUZA 3IOQA 3PNRA 1NB3A 3C9EA 1DF0A 1ME4A 2ATOA 2J7QC 2B1MA 2GFOA 3MORA 4CDEB 1ZIVA 2AYOA 4IUMA 1STFE 1O0EA 2F7DA 2JRIA 4YYQA 3ERVA 4WURA 2E03A 3U8EA 1HUCB 4AXLA 5F02A 1QOLA 2G8JA 2P7UA 4D8EA 3K9MA 1POPA 2DJFB 2FO5A 2XU3A 2DC9A 1IWDA 4YYWA 4I07A 3B21A 4K7CA 2P0RA 2FT2A 1TLOA 4DMYA 1ZCMA 4PT5A 3V6EA 3I06A 4P6GA 4BOUA 3IEJA 5A24A 1CVZA 3CH2X 1SP4B 2FUDA 2AU1A 3KWZA 1AYWA 3KFQA 1KHPA 1F2CA 3IUTA 1BY8A 1KHQA 3PT2A 4KLBA 3USVA 4OW0A 1Q6KA 1AYUA 1MEMA 3HHAA 1ICFA 3HHIA 5CVOB 1GCBA 2FTDA 3RVWA 2DCBA 1AECA 2BTWA 4BS5A 2PREA 9PAPA 2YJBA 3S3RA 3IFUA 2DJGB 1CJLA 1PBHA 4BQVA 1MEGA 1U9QX 1PPNA 3DF0A 3TMPA 2Z84A 3PRMA 4BOQA 4YYVA 3HD3A 2ACTA 7PCKA 4FK5A 1YVBA 4FJCA 3W31A 1THEA 4QRGA 4W5CA 1JQPA 3KX1A 2NQAA 4QRVA 8PCHA 1BP4A 2HXZA 2FQ9A 4G54A 3PBHA 3H7DA 3P5UA 4RKXA 2J7QA 4CZWA 3OVZA
chains in the Genus database with same CATH topology
2WBFX 2R9MA 3LTWA 3N4CA 2NQGA 4YYUA 2XU4A 1U5IA 4DMXA 4N79A 1Y08A 3B79A 1CPJA 2P86A 5FPWA 1PE6A 2B1NA 1NLJA 2R6NA 3KW9A 2HH5A 3F75A 1GX3A 1NQCA 1W4TA 1S4VA 2E02A 1ATKA 1YK7A 1QXPA 1PXVA 4WA6A 2DZZA 4C5PA 1PCIA 2G8EA 1GMYA 1MS6A 1SNKA 2PNSA 3CBJA 2YJ9A 1AU0A 1YT7A 4OEMA 1W6FA 2DC7A 3BPMA 4I04A 4YVAA 1CSBB 2DCDA 3P5XA 1EF7A 1A6RA 1PADA 3N3GA 1PPDA 1M6DA 2AS8A 4W5BA 2VHFA 1GECE 4Q8GA 4NV8A 1F2AA 2R9CA 3PDFA 4YYRA 5CHTA 1TU6A 3WXEA 4XR7A 4HWYA 1NB5A 3NHEA 4QH6A 4X6IA 3LXSA 2BDZA 2YJCA 2OZ2A 3BOWA 3KKUA 3WXGA 2G6DA 1DEUA 4BS6A 3QJ3A 1AYVA 1MHWA 4PP1A 1CQDA 3GCBA 4ZUXU 1CTEA 2HD5A 2Y6EA 3OISA 2R9OA 1KFUL 3KWBX 4MZOA 5JH3A 4XUIA 2R9FA 1AU4A 4QBBA 2XU5A 4I05A 1EWPA 1NPZA 1ITOA 4OELA 5CVNB 6PADA 2JQGR 1TL9A 2IPPB 3S3QA 3I3TA 4Q8HA 1CS8A 4QRXA 4RY2A 1BGOA 3O0UA 1PIPA 2AUXA 3K24A 2DZYA 2IBIA 5EF4A 1K3BB 4PADA 2E01A 3N3KA 2FYEA 4P6EA 2NQIA 3WXFA 4BSQA 4MSXA 3BCNA 1F29A 3MHHA 2YJ8A 2DC6A 2OULA 4BGFA 3RVXA 4B55A 5J94A 1BQIA 2AYNA 4BPVA 1EWMA 3BC3A 1KFXL 1KXRA 2Y5BA 2DCCA 1AIMA 4CDFB 3LFYA 1E2TA 3K8UA 3V6CA 1QDQA 4GUZA 3ZUAA 1EWLA 5JA7A 1ME3A 4PP2E 1NL6A 2GHUA 2NQDB 2FRQA 2R9NA 3BPFA 3IHPA 4N8WA 3OVXA 3CBKA 5CVMA 3E1ZB 1AU2A 5EGWA 3PW3A 2DCAA 1QMYA 3KSEA 2AIMA 3QSDA 1MDWA 2ARYA 2CIOA 4W4UA 2G7YA 3P5VA 3D9WA 1AU3A 1PPOA 3QT4A 2C0YA 3H8CA 1VSNA 1F2BA 3D6SA 4CDCB 3H8BA 3IMAA 4YV8A 1EWOA 2HHNA 3MTNA 1GLOA 1U9XA 3OF8A 4PI3A 4MZSA 1XKGA 3TNXA 4X6HA 1MIRA 4NV7A 3O1GA 2CB5A 2E00A 2DC8A 2VFBA 3H6SA 2JQFR 3H89A 3M99A 2AVWA 1CV8A 3BWKA 1YK8A 5PADA 1FH0A 2BDLA 3AI8A 1U9VA 2YJ2A 3P5WA 2F1GA 1Y4HA 1VJVA 2VHSA 2BSZA 4N4ZA 5K16A 3MHSA 2XU1A 2PBHA 1YALA 3F5VA 4CDDB 5CHVA 1U9WA 4YYSA 1X9YA 3RVVA 3HWNA 2OP3A 2PADA 1CB5A 2FRAA 4AXMA 3CH3X 2H7JA 1PPPA 3OF9A 4X6JA 3IV2A 2O6XA 4FIPA 2AUZA 3IOQA 3PNRA 1NB3A 3C9EA 2VFCA 1DF0A 1ME4A 2ATOA 2B1MA 2GFOA 3MORA 4CDEB 1ZIVA 2AYOA 1STFE 1O0EA 2F7DA 4YYQA 3ERVA 2E03A 3U8EA 1HUCB 4AXLA 5F02A 1QOLA 2G8JA 2P7UA 3K9MA 1POPA 2DJFB 2FO5A 2XU3A 2DC9A 1IWDA 4YYWA 4I07A 4K7CA 2P0RA 2FT2A 1TLOA 4DMYA 1ZCMA 3V6EA 3I06A 4P6GA 3IEJA 5A24A 1CVZA 3CH2X 1SP4B 2FUDA 2AU1A 3KWZA 1AYWA 3KFQA 1KHPA 1F2CA 3IUTA 1BY8A 1KHQA 4KLBA 3USVA 1Q6KA 1AYUA 1MEMA 3HHAA 1ICFA 3HHIA 5CVOB 1GCBA 2FTDA 3RVWA 2DCBA 1AECA 4BS5A 2PREA 9PAPA 2YJBA 3S3RA 2DJGB 1CJLA 1PBHA 4BQVA 1MEGA 1U9QX 1PPNA 3DF0A 4YYVA 3HD3A 2ACTA 7PCKA 4FK5A 1YVBA 4FJCA 1THEA 4QRGA 4W5CA 1JQPA 3KX1A 2NQAA 4QRVA 8PCHA 1BP4A 2HXZA 2FQ9A 4G54A 3PBHA 3H7DA 3P5UA 4CZWA 1W5RA 3OVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBF X;  2R9M A;  3N4C A;  2NQG A;  4YYU A;  2XU4 A;  1U5I A;  4DMX A;  4N79 A;  1Y08 A;  3B79 A;  1CPJ A;  2P86 A;  5FPW A;  1PE6 A;  2B1N A;  1NLJ A;  2R6N A;  3KW9 A;  2HH5 A;  3F75 A;  1NQC A;  1S4V A;  2E02 A;  1ATK A;  1YK7 A;  1QXP A;  1PXV A;  4WA6 A;  2DZZ A;  1PCI A;  2G8E A;  1GMY A;  1MS6 A;  1SNK A;  2PNS A;  3CBJ A;  2YJ9 A;  1AU0 A;  1YT7 A;  4OEM A;  2DC7 A;  3BPM A;  4I04 A;  4YVA A;  1CSB B;  2DCD A;  3P5X A;  1EF7 A;  1A6R A;  1PAD A;  3N3G A;  1PPD A;  1M6D A;  2AS8 A;  4W5B A;  2VHF A;  1GEC E;  4Q8G A;  1F2A A;  2R9C A;  3PDF A;  4YYR A;  5CHT A;  1TU6 A;  3WXE A;  4XR7 A;  4HWY A;  1NB5 A;  3NHE A;  4QH6 A;  4X6I A;  3LXS A;  2BDZ A;  2YJC A;  2OZ2 A;  3BOW A;  3KKU A;  3WXG A;  2G6D A;  1DEU A;  4BS6 A;  3QJ3 A;  1AYV A;  1MHW A;  4PP1 A;  1CQD A;  3GCB A;  4ZUX U;  1CTE A;  2HD5 A;  2Y6E A;  3OIS A;  2R9O A;  1KFU L;  3KWB X;  4MZO A;  5JH3 A;  4XUI A;  2R9F A;  1AU4 A;  4QBB A;  2XU5 A;  4I05 A;  1EWP A;  1NPZ A;  1ITO A;  4OEL A;  5CVN B;  6PAD A;  2JQG R;  1TL9 A;  2IPP B;  3S3Q A;  3I3T A;  4Q8H A;  1CS8 A;  4QRX A;  4RY2 A;  1BGO A;  3O0U A;  1PIP A;  2AUX A;  3K24 A;  2DZY A;  2IBI A;  5EF4 A;  1K3B B;  4PAD A;  2E01 A;  3N3K A;  2FYE A;  4P6E A;  2NQI A;  3WXF A;  4BSQ A;  4MSX A;  3BCN A;  1F29 A;  3MHH A;  2YJ8 A;  2DC6 A;  2OUL A;  3RVX A;  5J94 A;  1BQI A;  2AYN A;  4BPV A;  1EWM A;  3BC3 A;  1KFX L;  1KXR A;  2Y5B A;  2DCC A;  1AIM A;  4CDF B;  3LFY A;  3K8U A;  3V6C A;  1QDQ A;  3ZUA A;  1EWL A;  5JA7 A;  1ME3 A;  4PP2 E;  1NL6 A;  2GHU A;  2NQD B;  2FRQ A;  2R9N A;  3BPF A;  3IHP A;  4N8W A;  3OVX A;  3CBK A;  5CVM A;  3E1Z B;  1AU2 A;  5EGW A;  3PW3 A;  2DCA A;  1QMY A;  3KSE A;  2AIM A;  3QSD A;  1MDW A;  2ARY A;  2CIO A;  4W4U A;  2G7Y A;  3P5V A;  1AU3 A;  1PPO A;  3QT4 A;  2C0Y A;  3H8C A;  1VSN A;  1F2B A;  3D6S A;  4CDC B;  3H8B A;  3IMA A;  4YV8 A;  1EWO A;  2HHN A;  3MTN A;  1GLO A;  1U9X A;  3OF8 A;  4PI3 A;  4MZS A;  1XKG A;  3TNX A;  4X6H A;  1MIR A;  3O1G A;  2CB5 A;  2E00 A;  2DC8 A;  3H6S A;  2JQF R;  3H89 A;  3M99 A;  2AVW A;  1CV8 A;  3BWK A;  1YK8 A;  5PAD A;  1FH0 A;  2BDL A;  3AI8 A;  1U9V A;  2YJ2 A;  3P5W A;  2F1G A;  1Y4H A;  1VJV A;  2VHS A;  5K16 A;  4N4Z A;  3MHS A;  2XU1 A;  2PBH A;  1YAL A;  3F5V A;  4CDD B;  5CHV A;  1U9W A;  4YYS A;  1X9Y A;  3RVV A;  3HWN A;  2OP3 A;  2PAD A;  1CB5 A;  2FRA A;  4AXM A;  3CH3 X;  2H7J A;  1PPP A;  3OF9 A;  4X6J A;  3IV2 A;  2O6X A;  4FIP A;  2AUZ A;  3IOQ A;  3PNR A;  1NB3 A;  3C9E A;  1DF0 A;  1ME4 A;  2ATO A;  2B1M A;  2GFO A;  3MOR A;  4CDE B;  1ZIV A;  2AYO A;  1STF E;  1O0E A;  2F7D A;  4YYQ A;  3ERV A;  2E03 A;  3U8E A;  1HUC B;  4AXL A;  5F02 A;  1QOL A;  2G8J A;  2P7U A;  3K9M A;  1POP A;  2DJF B;  2FO5 A;  2XU3 A;  2DC9 A;  1IWD A;  4YYW A;  4I07 A;  4K7C A;  2P0R A;  2FT2 A;  1TLO A;  4DMY A;  1ZCM A;  3V6E A;  3I06 A;  4P6G A;  3IEJ A;  5A24 A;  1CVZ A;  3CH2 X;  1SP4 B;  2FUD A;  2AU1 A;  3KWZ A;  1AYW A;  3KFQ A;  1KHP A;  1F2C A;  3IUT A;  1BY8 A;  1KHQ A;  4KLB A;  3USV A;  1Q6K A;  1AYU A;  1MEM A;  1ICF A;  3HHA A;  3HHI A;  5CVO B;  1GCB A;  2FTD A;  3RVW A;  2DCB A;  1AEC A;  4BS5 A;  2PRE A;  9PAP A;  2YJB A;  3S3R A;  2DJG B;  1CJL A;  1PBH A;  4BQV A;  1MEG A;  1U9Q X;  1PPN A;  3DF0 A;  4YYV A;  3HD3 A;  2ACT A;  7PCK A;  4FK5 A;  1YVB A;  4FJC A;  1THE A;  4QRG A;  4W5C A;  1JQP A;  3KX1 A;  2NQA A;  4QRV A;  8PCH A;  1BP4 A;  2HXZ A;  2FQ9 A;  4G54 A;  3PBH A;  3H7D A;  3P5U A;  4CZW A;  3OVZ A; 
#chains in the Genus database with same CATH topology
 2WBF X;  2R9M A;  3N4C A;  2NQG A;  4YYU A;  2XU4 A;  1U5I A;  2FE8 A;  4N79 A;  4DMX A;  1Y08 A;  3B79 A;  1CPJ A;  2P86 A;  5FPW A;  1PE6 A;  2B1N A;  1NLJ A;  2R6N A;  3KW9 A;  2HH5 A;  4GUA A;  3F75 A;  1NQC A;  1S4V A;  2E02 A;  1ATK A;  1YK7 A;  2UZJ A;  1QXP A;  1PXV A;  4WA6 A;  2DZZ A;  1PCI A;  2G8E A;  1GMY A;  1MS6 A;  1SNK A;  2PNS A;  3CBJ A;  3PRP A;  2YJ9 A;  1AU0 A;  1YT7 A;  4ZTB A;  4OEM A;  2DC7 A;  3BPM A;  4I04 A;  4YVA A;  1CSB B;  4D8I A;  2DCD A;  3P5X A;  4BOS A;  1EF7 A;  1A6R A;  1PAD A;  3N3G A;  4XZX A;  1UKF A;  1PPD A;  1M6D A;  4MI7 A;  2AS8 A;  4W5B A;  2VHF A;  1GEC E;  4Q8G A;  5E6J A;  3MTV A;  2HWK A;  1F2A A;  2R9C A;  3PDF A;  4YYR A;  5CHT A;  1TU6 A;  3WXE A;  4XR7 A;  4HWY A;  1NB5 A;  3NHE A;  4QH6 A;  4X6I A;  3ZNH A;  3LXS A;  5EZQ A;  2BDZ A;  2YJC A;  2OZ2 A;  3BOW A;  3KKU A;  3WXG A;  2G6D A;  1DEU A;  2BTW B;  4BS6 A;  3BB7 A;  3QJ3 A;  1AYV A;  1MHW A;  4PP1 A;  1CQD A;  3GCB A;  4ZUX U;  2AGA A;  1CTE A;  2HD5 A;  2JTC A;  2Y6E A;  3OIS A;  2R9O A;  1KFU L;  3KWB X;  4MZO A;  3O65 A;  3PHX A;  5JH3 A;  4XUI A;  2R9F A;  4OVZ A;  1AU4 A;  4QBB A;  2XU5 A;  4I05 A;  1EWP A;  1NPZ A;  1ITO A;  1DKI A;  4OEL A;  5CVN B;  6PAD A;  3PHW A;  2JQG R;  4RNA A;  1TL9 A;  2IPP B;  3S3Q A;  3I3T A;  4Q8H A;  3BY4 A;  1CS8 A;  4QRX A;  4RY2 A;  4BOZ A;  1BGO A;  3O0U A;  1PIP A;  2AUX A;  3K24 A;  2DZY A;  4RF1 A;  2IBI A;  5EF4 A;  1K3B B;  4IP3 A;  4PAD A;  2E01 A;  3N3K A;  2FYE A;  2BU3 A;  4P6E A;  3OQC A;  2NQI A;  3E9S A;  3WXF A;  5JZE A;  4BSQ A;  4MSX A;  2DOS A;  3BCN A;  1F29 A;  3MHH A;  2YJ8 A;  2DC6 A;  3MP2 A;  4REZ A;  2OUL A;  3RVX A;  5J94 A;  3BBA A;  1BQI A;  2AYN A;  4BPV A;  1EWM A;  1YZB A;  3BC3 A;  1KFX L;  1KXR A;  2Y5B A;  2DCC A;  1AIM A;  4CDF B;  3LFY A;  3K8U A;  3V6C A;  1QDQ A;  3ZUA A;  1EWL A;  5JA7 A;  4A5U A;  1ME3 A;  4PP2 E;  3TRK A;  1NL6 A;  2GHU A;  2NQD B;  4R3D A;  2FRQ A;  2R9N A;  3BPF A;  3IHP A;  4N8W A;  3OVX A;  3CBK A;  5CVM A;  3E1Z B;  1AU2 A;  5EGW A;  3PW3 A;  2DCA A;  1QMY A;  5KO3 A;  3KSE A;  2AIM A;  3QSD A;  1MDW A;  2ARY A;  3PHU A;  2CIO A;  4W4U A;  2G7Y A;  3P5V A;  1AU3 A;  1PPO A;  3QT4 A;  2C0Y A;  3H8C A;  1VSN A;  1F2B A;  3D6S A;  4OVZ B;  4CDC B;  3H8B A;  3IMA A;  4YV8 A;  1EWO A;  2HHN A;  3MTN A;  3PSE A;  1GLO A;  1U9X A;  3OF8 A;  4PI3 A;  4P16 A;  4MZS A;  1XKG A;  3TNX A;  4X6H A;  1MIR A;  3RNV A;  3O1G A;  2CB5 A;  2E00 A;  2DC8 A;  3H6S A;  2JQF R;  3MJ5 A;  3H89 A;  3M99 A;  2AVW A;  1CV8 A;  3BWK A;  1YK8 A;  5PAD A;  1FH0 A;  2BDL A;  3AI8 A;  1U9V A;  2YJ2 A;  1PVJ A;  3P5W A;  4RF0 A;  2F1G A;  1Y4H A;  1VJV A;  2VHS A;  5K16 A;  4N4Z A;  3W30 A;  3MHS A;  2XU1 A;  2PBH A;  1YAL A;  3F5V A;  4CDD B;  5CHV A;  1U9W A;  4YYS A;  1X9Y A;  3RVV A;  3HWN A;  4HXD B;  2OP3 A;  2PAD A;  4MM3 B;  1CB5 A;  4BOP A;  2FRA A;  4AXM A;  3CH3 X;  4D8B A;  2H7J A;  1PPP A;  3C0R A;  3OF9 A;  4X6J A;  5EZS A;  4M0W A;  3IV2 A;  2O6X A;  4FIP A;  2AUZ A;  3IOQ A;  3PNR A;  1NB3 A;  3C9E A;  1DF0 A;  1ME4 A;  2ATO A;  2J7Q C;  2B1M A;  2GFO A;  3MOR A;  4CDE B;  1ZIV A;  2AYO A;  4IUM A;  1STF E;  1O0E A;  2F7D A;  2JRI A;  4YYQ A;  3ERV A;  4WUR A;  2E03 A;  3U8E A;  1HUC B;  4AXL A;  5F02 A;  1QOL A;  2G8J A;  2P7U A;  4D8E A;  3K9M A;  1POP A;  2DJF B;  2FO5 A;  2XU3 A;  2DC9 A;  1IWD A;  4YYW A;  4I07 A;  3B21 A;  4K7C A;  2P0R A;  2FT2 A;  1TLO A;  4DMY A;  1ZCM A;  4PT5 A;  3V6E A;  3I06 A;  4P6G A;  4BOU A;  3IEJ A;  5A24 A;  1CVZ A;  3CH2 X;  1SP4 B;  2FUD A;  2AU1 A;  3KWZ A;  1AYW A;  3KFQ A;  1KHP A;  1F2C A;  3IUT A;  1BY8 A;  1KHQ A;  3PT2 A;  4KLB A;  3USV A;  4OW0 A;  1Q6K A;  1AYU A;  1MEM A;  3HHA A;  1ICF A;  3HHI A;  5CVO B;  1GCB A;  2FTD A;  3RVW A;  2DCB A;  1AEC A;  2BTW A;  4BS5 A;  2PRE A;  9PAP A;  2YJB A;  3S3R A;  3IFU A;  2DJG B;  1CJL A;  1PBH A;  4BQV A;  1MEG A;  1U9Q X;  1PPN A;  3DF0 A;  3TMP A;  2Z84 A;  3PRM A;  4BOQ A;  4YYV A;  3HD3 A;  2ACT A;  7PCK A;  4FK5 A;  1YVB A;  4FJC A;  3W31 A;  1THE A;  4QRG A;  4W5C A;  1JQP A;  3KX1 A;  2NQA A;  4QRV A;  8PCH A;  1BP4 A;  2HXZ A;  2FQ9 A;  4G54 A;  3PBH A;  3H7D A;  3P5U A;  4RKX A;  2J7Q A;  4CZW A;  3OVZ A; 
#chains in the Genus database with same CATH homology
 2WBF X;  2R9M A;  3LTW A;  3N4C A;  2NQG A;  4YYU A;  2XU4 A;  1U5I A;  4DMX A;  4N79 A;  1Y08 A;  3B79 A;  1CPJ A;  2P86 A;  5FPW A;  1PE6 A;  2B1N A;  1NLJ A;  2R6N A;  3KW9 A;  2HH5 A;  3F75 A;  1GX3 A;  1NQC A;  1W4T A;  1S4V A;  2E02 A;  1ATK A;  1YK7 A;  1QXP A;  1PXV A;  4WA6 A;  2DZZ A;  4C5P A;  1PCI A;  2G8E A;  1GMY A;  1MS6 A;  1SNK A;  2PNS A;  3CBJ A;  2YJ9 A;  1AU0 A;  1YT7 A;  4OEM A;  1W6F A;  2DC7 A;  3BPM A;  4I04 A;  4YVA A;  1CSB B;  2DCD A;  3P5X A;  1EF7 A;  1A6R A;  1PAD A;  3N3G A;  1PPD A;  1M6D A;  2AS8 A;  4W5B A;  2VHF A;  1GEC E;  4Q8G A;  4NV8 A;  1F2A A;  2R9C A;  3PDF A;  4YYR A;  5CHT A;  1TU6 A;  3WXE A;  4XR7 A;  4HWY A;  1NB5 A;  3NHE A;  4QH6 A;  4X6I A;  3LXS A;  2BDZ A;  2YJC A;  2OZ2 A;  3BOW A;  3KKU A;  3WXG A;  2G6D A;  1DEU A;  4BS6 A;  3QJ3 A;  1AYV A;  1MHW A;  4PP1 A;  1CQD A;  3GCB A;  4ZUX U;  1CTE A;  2HD5 A;  2Y6E A;  3OIS A;  2R9O A;  1KFU L;  3KWB X;  4MZO A;  5JH3 A;  4XUI A;  2R9F A;  1AU4 A;  4QBB A;  2XU5 A;  4I05 A;  1EWP A;  1NPZ A;  1ITO A;  4OEL A;  5CVN B;  6PAD A;  2JQG R;  1TL9 A;  2IPP B;  3S3Q A;  3I3T A;  4Q8H A;  1CS8 A;  4QRX A;  4RY2 A;  1BGO A;  3O0U A;  1PIP A;  2AUX A;  3K24 A;  2DZY A;  2IBI A;  5EF4 A;  1K3B B;  4PAD A;  2E01 A;  3N3K A;  2FYE A;  4P6E A;  2NQI A;  3WXF A;  4BSQ A;  4MSX A;  3BCN A;  1F29 A;  3MHH A;  2YJ8 A;  2DC6 A;  2OUL A;  4BGF A;  3RVX A;  4B55 A;  5J94 A;  1BQI A;  2AYN A;  4BPV A;  1EWM A;  3BC3 A;  1KFX L;  1KXR A;  2Y5B A;  2DCC A;  1AIM A;  4CDF B;  3LFY A;  1E2T A;  3K8U A;  3V6C A;  1QDQ A;  4GUZ A;  3ZUA A;  1EWL A;  5JA7 A;  1ME3 A;  4PP2 E;  1NL6 A;  2GHU A;  2NQD B;  2FRQ A;  2R9N A;  3BPF A;  3IHP A;  4N8W A;  3OVX A;  3CBK A;  5CVM A;  3E1Z B;  1AU2 A;  5EGW A;  3PW3 A;  2DCA A;  1QMY A;  3KSE A;  2AIM A;  3QSD A;  1MDW A;  2ARY A;  2CIO A;  4W4U A;  2G7Y A;  3P5V A;  3D9W A;  1AU3 A;  1PPO A;  3QT4 A;  2C0Y A;  3H8C A;  1VSN A;  1F2B A;  3D6S A;  4CDC B;  3H8B A;  3IMA A;  4YV8 A;  1EWO A;  2HHN A;  3MTN A;  1GLO A;  1U9X A;  3OF8 A;  4PI3 A;  4MZS A;  1XKG A;  3TNX A;  4X6H A;  1MIR A;  4NV7 A;  3O1G A;  2CB5 A;  2E00 A;  2DC8 A;  2VFB A;  3H6S A;  2JQF R;  3H89 A;  3M99 A;  2AVW A;  1CV8 A;  3BWK A;  1YK8 A;  5PAD A;  1FH0 A;  2BDL A;  3AI8 A;  1U9V A;  2YJ2 A;  3P5W A;  2F1G A;  1Y4H A;  1VJV A;  2VHS A;  2BSZ A;  4N4Z A;  5K16 A;  3MHS A;  2XU1 A;  2PBH A;  1YAL A;  3F5V A;  4CDD B;  5CHV A;  1U9W A;  4YYS A;  1X9Y A;  3RVV A;  3HWN A;  2OP3 A;  2PAD A;  1CB5 A;  2FRA A;  4AXM A;  3CH3 X;  2H7J A;  1PPP A;  3OF9 A;  4X6J A;  3IV2 A;  2O6X A;  4FIP A;  2AUZ A;  3IOQ A;  3PNR A;  1NB3 A;  3C9E A;  2VFC A;  1DF0 A;  1ME4 A;  2ATO A;  2B1M A;  2GFO A;  3MOR A;  4CDE B;  1ZIV A;  2AYO A;  1STF E;  1O0E A;  2F7D A;  4YYQ A;  3ERV A;  2E03 A;  3U8E A;  1HUC B;  4AXL A;  5F02 A;  1QOL A;  2G8J A;  2P7U A;  3K9M A;  1POP A;  2DJF B;  2FO5 A;  2XU3 A;  2DC9 A;  1IWD A;  4YYW A;  4I07 A;  4K7C A;  2P0R A;  2FT2 A;  1TLO A;  4DMY A;  1ZCM A;  3V6E A;  3I06 A;  4P6G A;  3IEJ A;  5A24 A;  1CVZ A;  3CH2 X;  1SP4 B;  2FUD A;  2AU1 A;  3KWZ A;  1AYW A;  3KFQ A;  1KHP A;  1F2C A;  3IUT A;  1BY8 A;  1KHQ A;  4KLB A;  3USV A;  1Q6K A;  1AYU A;  1MEM A;  3HHA A;  1ICF A;  3HHI A;  5CVO B;  1GCB A;  2FTD A;  3RVW A;  2DCB A;  1AEC A;  4BS5 A;  2PRE A;  9PAP A;  2YJB A;  3S3R A;  2DJG B;  1CJL A;  1PBH A;  4BQV A;  1MEG A;  1U9Q X;  1PPN A;  3DF0 A;  4YYV A;  3HD3 A;  2ACT A;  7PCK A;  4FK5 A;  1YVB A;  4FJC A;  1THE A;  4QRG A;  4W5C A;  1JQP A;  3KX1 A;  2NQA A;  4QRV A;  8PCH A;  1BP4 A;  2HXZ A;  2FQ9 A;  4G54 A;  3PBH A;  3H7D A;  3P5U A;  4CZW A;  1W5R A;  3OVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...