3H8BA

A combined crystallographic and molecular dynamics study of cathepsin-l retro-binding inhibitors(compound 9)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
215
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A combined crystallographic and molecular dynamics study of cathepsin L retrobinding inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin L1
total genus 64
structure length 215
sequence length 220
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3h8bA00
4W5CA 4PP2E 1YK7A 1SP4B 1POPA 1TL9A 1BP4A 4CZWA 4OEMA 4FIPA 2YJ8A 1AU2A 1ICFA 4PADA 3H7DA 2DCBA 1U9QX 1PADA 3IMAA 4FK5A 2F1GA 1NQCA 4BS5A 1F29A 5CHVA 1CB5A 1MDWA 2DC8A 1ATKA 4OELA 1XKGA 2JQFR 1BQIA 1TLOA 3K9MA 3PW3A 1KHQA 2BDZA 2R9MA 4CDEB 3AI8A 1QDQA 2P0RA 3RVXA 2F7DA 1PPPA 2E03A 1CSBB 3MTNA 3OF8A 5JA7A 1X9YA 3F5VA 1S4VA 2CIOA 2AUZA 3BCNA 3P5XA 3IV2A 4I07A 2R6NA 1O0EA 2XU1A 2P86A 1QXPA 4FJCA 1THEA 3HWNA 5K16A 1KHPA 3I3TA 3KW9A 1NB5A 2NQGA 2OP3A 4YYWA 2R9OA 4AXMA 1CS8A 3B79A 2IBIA 2DC7A 3DF0A 3M99A 2YJ2A 3KWZA 3RVVA 4CDFB 1VJVA 3P5UA 3MHHA 2AVWA 4MSXA 1AYVA 4PI3A 2PREA 1ME4A 4YYVA 2FRQA 3HHAA 3D6SA 4PP1A 3MORA 1KFUL 1KXRA 3PBHA 3PDFA 2O6XA 8PCHA 1GECE 4N4ZA 2NQDB 3IUTA 5A24A 1F2CA 2ARYA 1AU3A 2FUDA 2DC6A 1YVBA 1U9WA 3H89A 3TNXA 2Y6EA 3U8EA 3IOQA 1NLJA 4CDCB 1CQDA 3S3QA 1CPJA 1MHWA 1AU4A 2R9FA 3MHSA 4XUIA 3CBKA 1DEUA 3HHIA 2YJBA 3PNRA 4I04A 3QSDA 2GHUA 2HH5A 1AIMA 1GLOA 2FYEA 2G8EA 2HHNA 1PIPA 4W4UA 3P5VA 2ATOA 1CTEA 1ZCMA 3F75A 1F2AA 3I06A 3BPFA 4K7CA 2XU3A 3K8UA 2AYOA 2JQGR 1BGOA 1M6DA 2E02A 1EF7A 1PXVA 2AUXA 1HUCB 2NQAA 1QOLA 4YV8A 3ERVA 5PADA 4YVAA 2E01A 2FT2A 4YYSA 2DCCA 2XU5A 1EWMA 3OVZA 2DCDA 4YYUA 1EWOA 2H7JA 3H6SA 1NL6A 2DCAA 1ME3A 4Q8GA 4X6JA 2OULA 3USVA 4X6HA 1K3BB 4CDDB 5CVMA 2P7UA 1STFE 1ZIVA 6PADA 2FTDA 2XU4A 2FQ9A 1Q6KA 1MIRA 3BOWA 2YJ9A 1DF0A 4ZUXU 3N4CA 4AXLA 4QRXA 4YYQA 3K24A 1YK8A 2OZ2A 3OF9A 2YJCA 1YT7A 4KLBA 4MZOA 1QMYA 1PPOA 2CB5A 1F2BA 4DMXA 4QRVA 2DJGB 3KFQA 4I05A 2AIMA 1Y08A 4BS6A 2AS8A 3P5WA 3KWBX 3H8BA 1MEGA 2FO5A 2B1NA 3BWKA 1PPDA 1U5IA 2Y5BA 1AECA 1IWDA 2HD5A 1SNKA 2C0YA 3WXEA 3V6CA 2E00A 1EWPA 2R9NA 2AYNA 2DZZA 2PNSA 2ACTA 4N8WA 2PBHA 3LXSA 3V6EA 4BSQA 3BC3A 3OVXA 1YALA 2B1MA 4P6GA 2FRAA 2G7YA 3N3GA 2HXZA 3N3KA 4YYRA 5EGWA 2DJFB 2NQIA 4HWYA 2R9CA 4QBBA 1EWLA 5F02A 3LFYA 3IHPA 3OISA 2BDLA 3IEJA 5J94A 1BY8A 3GCBA 1AU0A 1KFXL 1GMYA 3S3RA 4W5BA 2G6DA 4G54A 4MZSA 3O1GA 2AU1A 1PBHA 3CH3X 5CHTA 4DMYA 1NB3A 4X6IA 1GCBA 3H8CA 3KKUA 2IPPB 3KX1A 1MEMA 2GFOA 4WA6A 5JH3A 2G8JA 3KSEA 4P6EA 2DC9A 3ZUAA 1PCIA 4RY2A 2DZYA 5CVOB 7PCKA 3E1ZB 4N79A 3O0UA 1CJLA 3WXGA 1VSNA 1FH0A 1AYUA 2VHFA 4QH6A 3CBJA 4QRGA 3QJ3A 3NHEA 2PADA 3RVWA 1U9VA 3BPMA 4BQVA 3WXFA 2WBFX 1CVZA 1ITOA 1U9XA 4Q8HA 1AYWA 1PE6A 3C9EA 3CH2X 4XR7A 1CV8A 1A6RA 5CVNB 2VHSA 1Y4HA 9PAPA 5EF4A 1TU6A 1NPZA 3QT4A 3HD3A 4BPVA 1PPNA 5FPWA 1JQPA 1MS6A
chains in the Genus database with same CATH superfamily
4W5CA 4PP2E 4D8BA 1YK7A 1SP4B 1POPA 3MP2A 1TL9A 1BP4A 4CZWA 3BY4A 4OEMA 4FIPA 2YJ8A 1AU2A 1ICFA 4PADA 3H7DA 2DCBA 1U9QX 5E6JA 1PADA 3IMAA 4FK5A 3ZNHA 2F1GA 1NQCA 4BS5A 1F29A 5CHVA 1CB5A 1MDWA 2DC8A 1ATKA 4OELA 3C0RA 1XKGA 4BOPA 2JQFR 1BQIA 1TLOA 3K9MA 4MM3B 3PW3A 1KHQA 4HXDB 2BDZA 2R9MA 4CDEB 3AI8A 1QDQA 2P0RA 2F7DA 3RVXA 4IUMA 3MTVA 1PPPA 2E03A 1CSBB 3MTNA 3OF8A 5JA7A 1X9YA 3F5VA 1S4VA 2CIOA 2AUZA 3BCNA 3P5XA 2BTWB 3IV2A 4I07A 2R6NA 1O0EA 2XU1A 2P86A 4RKXA 1QXPA 4FJCA 1THEA 3HWNA 5K16A 1KHPA 3I3TA 3KW9A 1NB5A 3PHUA 2NQGA 2OP3A 4OW0A 4YYWA 2R9OA 4AXMA 1CS8A 4M0WA 3PT2A 3B79A 2IBIA 2DC7A 3DF0A 3M99A 2YJ2A 3KWZA 4REZA 3RVVA 4CDFB 1VJVA 3P5UA 3MHHA 2AVWA 4MSXA 1AYVA 4PI3A 2PREA 1ME4A 4BOUA 4YYVA 2FRQA 3HHAA 3D6SA 4PP1A 3MORA 5KO3A 1KFUL 1KXRA 3PBHA 3PDFA 2O6XA 8PCHA 1GECE 4N4ZA 2NQDB 3IUTA 4BOQA 5A24A 1F2CA 2ARYA 1AU3A 4D8IA 2FUDA 2DC6A 1YVBA 1U9WA 1PVJA 3H89A 3TNXA 2Y6EA 3U8EA 3IOQA 1NLJA 4CDCB 1CQDA 3S3QA 1CPJA 1MHWA 1AU4A 2R9FA 3MHSA 4XUIA 3CBKA 1DEUA 3HHIA 2YJBA 3PNRA 4I04A 3QSDA 2GHUA 2HH5A 2DOSA 1AIMA 1GLOA 2FYEA 3O65A 1DKIA 2G8EA 2HHNA 1PIPA 4W4UA 3P5VA 2ATOA 1CTEA 1ZCMA 3E9SA 3F75A 1F2AA 3I06A 1UKFA 3BPFA 4K7CA 2XU3A 3MJ5A 3K8UA 3W31A 2AYOA 4D8EA 2JQGR 1BGOA 4OVZB 1M6DA 2E02A 1EF7A 1PXVA 2AUXA 1HUCB 2NQAA 1QOLA 4YV8A 3ERVA 5PADA 4YVAA 2E01A 2FT2A 4YYSA 2DCCA 3PSEA 2XU5A 1EWMA 3OVZA 3PHWA 2DCDA 3RNVA 4YYUA 1EWOA 2H7JA 3H6SA 1NL6A 2DCAA 1ME3A 4Q8GA 4X6JA 2OULA 3USVA 4X6HA 1K3BB 5JZEA 4CDDB 5CVMA 2P7UA 4XZXA 1STFE 3TRKA 1ZIVA 6PADA 2FTDA 2XU4A 2FQ9A 4OVZA 2BTWA 1Q6KA 1MIRA 3BOWA 2YJ9A 1DF0A 4ZUXU 3N4CA 4AXLA 4QRXA 4BOSA 4YYQA 3K24A 1YK8A 2OZ2A 3OF9A 2YJCA 1YT7A 4KLBA 4MZOA 1QMYA 1PPOA 2CB5A 1F2BA 4DMXA 4QRVA 2DJGB 3KFQA 5EZQA 4I05A 4RNAA 2AIMA 1Y08A 3BB7A 4BS6A 2AS8A 3P5WA 3KWBX 3H8BA 1MEGA 2FO5A 2B1NA 4P16A 4R3DA 3BWKA 1PPDA 1U5IA 4RF1A 2Y5BA 1AECA 1IWDA 2HD5A 1SNKA 2C0YA 3WXEA 4MI7A 3V6CA 2E00A 1EWPA 3PRPA 2R9NA 2AYNA 2DZZA 2PNSA 2ACTA 4N8WA 2PBHA 3LXSA 3V6EA 1YZBA 4BSQA 3BC3A 3OVXA 4PT5A 1YALA 2B1MA 4P6GA 4ZTBA 2FRAA 2G7YA 3N3GA 2HXZA 3N3KA 4YYRA 3PRMA 5EGWA 2DJFB 2NQIA 4HWYA 2R9CA 4QBBA 1EWLA 5F02A 3LFYA 3IHPA 3OISA 2BDLA 3IEJA 5J94A 1BY8A 3GCBA 1AU0A 1KFXL 3TMPA 4IP3A 4A5UA 4BOZA 1GMYA 3S3RA 4W5BA 2FE8A 4RF0A 2G6DA 4G54A 4MZSA 2BU3A 3O1GA 4WURA 3IFUA 2AU1A 1PBHA 3CH3X 3B21A 5CHTA 4DMYA 1NB3A 4X6IA 1GCBA 3H8CA 3KKUA 2IPPB 3KX1A 1MEMA 2GFOA 4WA6A 5JH3A 2G8JA 3KSEA 3OQCA 2UZJA 4P6EA 2DC9A 3ZUAA 2Z84A 1PCIA 4RY2A 2DZYA 5CVOB 7PCKA 2J7QA 3W30A 3PHXA 3E1ZB 4N79A 3O0UA 1CJLA 2JRIA 3WXGA 1VSNA 1FH0A 1AYUA 2VHFA 4QH6A 3CBJA 3BBAA 4QRGA 3QJ3A 4GUAA 3NHEA 5EZSA 2PADA 3RVWA 1U9VA 3BPMA 2J7QC 4BQVA 3WXFA 2WBFX 1CVZA 2HWKA 1ITOA 1U9XA 4Q8HA 1AYWA 1PE6A 3C9EA 3CH2X 4XR7A 1CV8A 1A6RA 2VHSA 5CVNB 1Y4HA 2JTCA 2AGAA 9PAPA 5EF4A 1TU6A 1NPZA 3QT4A 3HD3A 4BPVA 1PPNA 5FPWA 1JQPA 1MS6A
chains in the Genus database with same CATH topology
4W5CA 4PP2E 1YK7A 1SP4B 1POPA 1TL9A 1BP4A 4CZWA 4OEMA 4FIPA 2YJ8A 1AU2A 1GX3A 1ICFA 4PADA 3H7DA 2DCBA 2VFBA 1U9QX 1PADA 3IMAA 4FK5A 2F1GA 1NQCA 4BS5A 1F29A 5CHVA 1CB5A 1MDWA 2DC8A 1ATKA 4OELA 1XKGA 2JQFR 1BQIA 1TLOA 3K9MA 3PW3A 1KHQA 2BDZA 2R9MA 4CDEB 3AI8A 1QDQA 2P0RA 2F7DA 1W6FA 3RVXA 1PPPA 2E03A 1CSBB 3MTNA 3OF8A 5JA7A 1X9YA 3F5VA 1S4VA 2CIOA 2AUZA 3BCNA 3P5XA 3IV2A 4I07A 2R6NA 1O0EA 2XU1A 2P86A 1QXPA 4FJCA 1THEA 3HWNA 5K16A 1KHPA 3I3TA 3KW9A 1NB5A 2NQGA 2OP3A 4YYWA 2R9OA 4AXMA 1CS8A 3B79A 2IBIA 2DC7A 3DF0A 3M99A 2YJ2A 3KWZA 3RVVA 4CDFB 1VJVA 3P5UA 3MHHA 2AVWA 4MSXA 1AYVA 4PI3A 2PREA 1ME4A 4YYVA 2FRQA 3HHAA 3D6SA 4PP1A 3MORA 1KFUL 3D9WA 1KXRA 3PBHA 3PDFA 2O6XA 8PCHA 1GECE 4N4ZA 2NQDB 3IUTA 5A24A 1F2CA 2ARYA 1AU3A 2FUDA 2DC6A 1YVBA 1U9WA 3H89A 3TNXA 2Y6EA 3U8EA 3IOQA 1NLJA 4CDCB 1CQDA 3S3QA 1CPJA 1MHWA 1AU4A 2R9FA 3MHSA 4XUIA 3CBKA 1DEUA 3HHIA 2YJBA 3PNRA 4I04A 3QSDA 2GHUA 2HH5A 1AIMA 1GLOA 2FYEA 2G8EA 2HHNA 1PIPA 4W4UA 3P5VA 2ATOA 1CTEA 1ZCMA 3F75A 1F2AA 3I06A 3BPFA 4K7CA 2XU3A 3K8UA 2AYOA 4NV7A 1E2TA 2JQGR 1BGOA 1M6DA 2E02A 1EF7A 1PXVA 2AUXA 1HUCB 2NQAA 1QOLA 4YV8A 3ERVA 5PADA 4YVAA 2E01A 2FT2A 4YYSA 2DCCA 2XU5A 1EWMA 3OVZA 2DCDA 4YYUA 1EWOA 2H7JA 3H6SA 1NL6A 2DCAA 1ME3A 4Q8GA 4X6JA 2OULA 3USVA 4X6HA 1K3BB 4CDDB 5CVMA 2P7UA 1STFE 1ZIVA 6PADA 2FTDA 2XU4A 2FQ9A 1Q6KA 1MIRA 3BOWA 2YJ9A 1DF0A 1W5RA 3N4CA 4ZUXU 4BGFA 4AXLA 4QRXA 4YYQA 3K24A 1YK8A 2OZ2A 3OF9A 2YJCA 1YT7A 4KLBA 4MZOA 2VFCA 1QMYA 1PPOA 2CB5A 1F2BA 4DMXA 4QRVA 2DJGB 3KFQA 4I05A 2AIMA 1Y08A 2BSZA 4BS6A 2AS8A 3P5WA 3KWBX 3H8BA 1MEGA 2FO5A 2B1NA 3LTWA 3BWKA 1PPDA 1U5IA 2Y5BA 1AECA 1IWDA 2HD5A 1SNKA 2C0YA 3WXEA 3V6CA 2E00A 1EWPA 2R9NA 2AYNA 2DZZA 2PNSA 2ACTA 4N8WA 2PBHA 3LXSA 4NV8A 3V6EA 4BSQA 3BC3A 3OVXA 1YALA 2B1MA 4P6GA 2FRAA 2G7YA 3N3GA 2HXZA 3N3KA 4YYRA 5EGWA 2DJFB 2NQIA 4HWYA 2R9CA 4QBBA 1EWLA 5F02A 3LFYA 3IHPA 3OISA 2BDLA 3IEJA 5J94A 1BY8A 3GCBA 1AU0A 1KFXL 1GMYA 3S3RA 4W5BA 2G6DA 4G54A 4MZSA 3O1GA 2AU1A 1PBHA 3CH3X 5CHTA 4DMYA 1NB3A 4X6IA 1GCBA 3H8CA 3KKUA 2IPPB 3KX1A 1MEMA 2GFOA 4WA6A 5JH3A 2G8JA 3KSEA 4P6EA 2DC9A 3ZUAA 1PCIA 4RY2A 2DZYA 5CVOB 7PCKA 3E1ZB 4N79A 3O0UA 1CJLA 3WXGA 1VSNA 1FH0A 1AYUA 2VHFA 4QH6A 3CBJA 4GUZA 4QRGA 3QJ3A 3NHEA 2PADA 3RVWA 1U9VA 1W4TA 3BPMA 4BQVA 3WXFA 2WBFX 1CVZA 1ITOA 1U9XA 4Q8HA 1AYWA 1PE6A 3C9EA 3CH2X 4XR7A 1CV8A 1A6RA 5CVNB 2VHSA 1Y4HA 9PAPA 5EF4A 1TU6A 1NPZA 3QT4A 3HD3A 4BPVA 4C5PA 4B55A 1PPNA 5FPWA 1JQPA 1MS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5C A;  4PP2 E;  1YK7 A;  1SP4 B;  1POP A;  1TL9 A;  1BP4 A;  4CZW A;  4OEM A;  4FIP A;  2YJ8 A;  1AU2 A;  1ICF A;  4PAD A;  3H7D A;  2DCB A;  1U9Q X;  1PAD A;  3IMA A;  4FK5 A;  2F1G A;  1NQC A;  4BS5 A;  1F29 A;  5CHV A;  1CB5 A;  1MDW A;  2DC8 A;  1ATK A;  4OEL A;  1XKG A;  2JQF R;  1BQI A;  1TLO A;  3K9M A;  3PW3 A;  1KHQ A;  2BDZ A;  2R9M A;  4CDE B;  3AI8 A;  1QDQ A;  2P0R A;  3RVX A;  2F7D A;  1PPP A;  2E03 A;  1CSB B;  3MTN A;  3OF8 A;  5JA7 A;  1X9Y A;  3F5V A;  1S4V A;  2CIO A;  2AUZ A;  3BCN A;  3P5X A;  3IV2 A;  4I07 A;  2R6N A;  1O0E A;  2XU1 A;  2P86 A;  1QXP A;  4FJC A;  1THE A;  3HWN A;  5K16 A;  1KHP A;  3I3T A;  3KW9 A;  1NB5 A;  2NQG A;  2OP3 A;  4YYW A;  2R9O A;  4AXM A;  1CS8 A;  3B79 A;  2IBI A;  2DC7 A;  3DF0 A;  3M99 A;  2YJ2 A;  3KWZ A;  3RVV A;  4CDF B;  1VJV A;  3P5U A;  3MHH A;  2AVW A;  4MSX A;  1AYV A;  4PI3 A;  2PRE A;  1ME4 A;  4YYV A;  2FRQ A;  3HHA A;  3D6S A;  4PP1 A;  3MOR A;  1KFU L;  1KXR A;  3PBH A;  3PDF A;  2O6X A;  8PCH A;  1GEC E;  4N4Z A;  2NQD B;  3IUT A;  5A24 A;  1F2C A;  2ARY A;  1AU3 A;  2FUD A;  2DC6 A;  1YVB A;  1U9W A;  3H89 A;  3TNX A;  2Y6E A;  3U8E A;  3IOQ A;  1NLJ A;  4CDC B;  1CQD A;  3S3Q A;  1CPJ A;  1MHW A;  1AU4 A;  2R9F A;  3MHS A;  4XUI A;  3CBK A;  1DEU A;  3HHI A;  2YJB A;  3PNR A;  4I04 A;  3QSD A;  2GHU A;  2HH5 A;  1AIM A;  1GLO A;  2FYE A;  2G8E A;  2HHN A;  1PIP A;  4W4U A;  3P5V A;  2ATO A;  1CTE A;  1ZCM A;  3F75 A;  1F2A A;  3I06 A;  3BPF A;  4K7C A;  2XU3 A;  3K8U A;  2AYO A;  2JQG R;  1BGO A;  1M6D A;  2E02 A;  1EF7 A;  1PXV A;  2AUX A;  1HUC B;  2NQA A;  1QOL A;  4YV8 A;  3ERV A;  5PAD A;  4YVA A;  2E01 A;  2FT2 A;  4YYS A;  2DCC A;  2XU5 A;  1EWM A;  3OVZ A;  2DCD A;  4YYU A;  1EWO A;  2H7J A;  3H6S A;  1NL6 A;  2DCA A;  1ME3 A;  4Q8G A;  4X6J A;  2OUL A;  3USV A;  4X6H A;  1K3B B;  4CDD B;  5CVM A;  2P7U A;  1STF E;  1ZIV A;  6PAD A;  2FTD A;  2XU4 A;  2FQ9 A;  1Q6K A;  1MIR A;  3BOW A;  2YJ9 A;  1DF0 A;  4ZUX U;  3N4C A;  4AXL A;  4QRX A;  4YYQ A;  3K24 A;  1YK8 A;  2OZ2 A;  3OF9 A;  2YJC A;  1YT7 A;  4KLB A;  4MZO A;  1QMY A;  1PPO A;  2CB5 A;  1F2B A;  4DMX A;  4QRV A;  2DJG B;  3KFQ A;  4I05 A;  2AIM A;  1Y08 A;  4BS6 A;  2AS8 A;  3P5W A;  3KWB X;  3H8B A;  1MEG A;  2FO5 A;  2B1N A;  3BWK A;  1PPD A;  1U5I A;  2Y5B A;  1AEC A;  1IWD A;  2HD5 A;  1SNK A;  2C0Y A;  3WXE A;  3V6C A;  2E00 A;  1EWP A;  2R9N A;  2AYN A;  2DZZ A;  2PNS A;  2ACT A;  4N8W A;  2PBH A;  3LXS A;  3V6E A;  4BSQ A;  3BC3 A;  3OVX A;  1YAL A;  2B1M A;  4P6G A;  2FRA A;  2G7Y A;  3N3G A;  2HXZ A;  3N3K A;  4YYR A;  5EGW A;  2DJF B;  2NQI A;  4HWY A;  2R9C A;  4QBB A;  1EWL A;  5F02 A;  3LFY A;  3IHP A;  3OIS A;  2BDL A;  3IEJ A;  5J94 A;  1BY8 A;  3GCB A;  1AU0 A;  1KFX L;  1GMY A;  3S3R A;  4W5B A;  2G6D A;  4G54 A;  4MZS A;  3O1G A;  2AU1 A;  1PBH A;  3CH3 X;  5CHT A;  4DMY A;  1NB3 A;  4X6I A;  1GCB A;  3H8C A;  3KKU A;  2IPP B;  3KX1 A;  1MEM A;  2GFO A;  4WA6 A;  5JH3 A;  2G8J A;  3KSE A;  4P6E A;  2DC9 A;  3ZUA A;  1PCI A;  4RY2 A;  2DZY A;  5CVO B;  7PCK A;  3E1Z B;  4N79 A;  3O0U A;  1CJL A;  3WXG A;  1VSN A;  1FH0 A;  1AYU A;  2VHF A;  4QH6 A;  3CBJ A;  4QRG A;  3QJ3 A;  3NHE A;  2PAD A;  3RVW A;  1U9V A;  3BPM A;  4BQV A;  3WXF A;  2WBF X;  1CVZ A;  1ITO A;  1U9X A;  4Q8H A;  1AYW A;  1PE6 A;  3C9E A;  3CH2 X;  4XR7 A;  1CV8 A;  1A6R A;  5CVN B;  2VHS A;  1Y4H A;  9PAP A;  5EF4 A;  1TU6 A;  1NPZ A;  3QT4 A;  3HD3 A;  4BPV A;  1PPN A;  5FPW A;  1JQP A;  1MS6 A; 
#chains in the Genus database with same CATH topology
 4W5C A;  4PP2 E;  4D8B A;  1YK7 A;  1SP4 B;  1POP A;  3MP2 A;  1TL9 A;  1BP4 A;  4CZW A;  3BY4 A;  4OEM A;  4FIP A;  2YJ8 A;  1AU2 A;  1ICF A;  4PAD A;  3H7D A;  2DCB A;  1U9Q X;  5E6J A;  1PAD A;  3IMA A;  4FK5 A;  3ZNH A;  2F1G A;  1NQC A;  4BS5 A;  1F29 A;  5CHV A;  1CB5 A;  1MDW A;  2DC8 A;  1ATK A;  4OEL A;  3C0R A;  1XKG A;  4BOP A;  2JQF R;  1BQI A;  1TLO A;  3K9M A;  4MM3 B;  3PW3 A;  1KHQ A;  4HXD B;  2BDZ A;  2R9M A;  4CDE B;  3AI8 A;  1QDQ A;  2P0R A;  2F7D A;  3RVX A;  4IUM A;  3MTV A;  1PPP A;  2E03 A;  1CSB B;  3MTN A;  3OF8 A;  5JA7 A;  1X9Y A;  3F5V A;  1S4V A;  2CIO A;  2AUZ A;  3BCN A;  3P5X A;  2BTW B;  3IV2 A;  4I07 A;  2R6N A;  1O0E A;  2XU1 A;  2P86 A;  4RKX A;  1QXP A;  4FJC A;  1THE A;  3HWN A;  5K16 A;  1KHP A;  3I3T A;  3KW9 A;  1NB5 A;  3PHU A;  2NQG A;  2OP3 A;  4OW0 A;  4YYW A;  2R9O A;  4AXM A;  1CS8 A;  4M0W A;  3PT2 A;  3B79 A;  2IBI A;  2DC7 A;  3DF0 A;  3M99 A;  2YJ2 A;  3KWZ A;  4REZ A;  3RVV A;  4CDF B;  1VJV A;  3P5U A;  3MHH A;  2AVW A;  4MSX A;  1AYV A;  4PI3 A;  2PRE A;  1ME4 A;  4BOU A;  4YYV A;  2FRQ A;  3HHA A;  3D6S A;  4PP1 A;  3MOR A;  5KO3 A;  1KFU L;  1KXR A;  3PBH A;  3PDF A;  2O6X A;  8PCH A;  1GEC E;  4N4Z A;  2NQD B;  3IUT A;  4BOQ A;  5A24 A;  1F2C A;  2ARY A;  1AU3 A;  4D8I A;  2FUD A;  2DC6 A;  1YVB A;  1U9W A;  1PVJ A;  3H89 A;  3TNX A;  2Y6E A;  3U8E A;  3IOQ A;  1NLJ A;  4CDC B;  1CQD A;  3S3Q A;  1CPJ A;  1MHW A;  1AU4 A;  2R9F A;  3MHS A;  4XUI A;  3CBK A;  1DEU A;  3HHI A;  2YJB A;  3PNR A;  4I04 A;  3QSD A;  2GHU A;  2HH5 A;  2DOS A;  1AIM A;  1GLO A;  2FYE A;  3O65 A;  1DKI A;  2G8E A;  2HHN A;  1PIP A;  4W4U A;  3P5V A;  2ATO A;  1CTE A;  1ZCM A;  3E9S A;  3F75 A;  1F2A A;  3I06 A;  1UKF A;  3BPF A;  4K7C A;  2XU3 A;  3MJ5 A;  3K8U A;  3W31 A;  2AYO A;  4D8E A;  2JQG R;  1BGO A;  4OVZ B;  1M6D A;  2E02 A;  1EF7 A;  1PXV A;  2AUX A;  1HUC B;  2NQA A;  1QOL A;  4YV8 A;  3ERV A;  5PAD A;  4YVA A;  2E01 A;  2FT2 A;  4YYS A;  2DCC A;  3PSE A;  2XU5 A;  1EWM A;  3OVZ A;  3PHW A;  2DCD A;  3RNV A;  4YYU A;  1EWO A;  2H7J A;  3H6S A;  1NL6 A;  2DCA A;  1ME3 A;  4Q8G A;  4X6J A;  2OUL A;  3USV A;  4X6H A;  1K3B B;  5JZE A;  4CDD B;  5CVM A;  2P7U A;  4XZX A;  1STF E;  3TRK A;  1ZIV A;  6PAD A;  2FTD A;  2XU4 A;  2FQ9 A;  4OVZ A;  2BTW A;  1Q6K A;  1MIR A;  3BOW A;  2YJ9 A;  1DF0 A;  4ZUX U;  3N4C A;  4AXL A;  4QRX A;  4BOS A;  4YYQ A;  3K24 A;  1YK8 A;  2OZ2 A;  3OF9 A;  2YJC A;  1YT7 A;  4KLB A;  4MZO A;  1QMY A;  1PPO A;  2CB5 A;  1F2B A;  4DMX A;  4QRV A;  2DJG B;  3KFQ A;  5EZQ A;  4I05 A;  4RNA A;  2AIM A;  1Y08 A;  3BB7 A;  4BS6 A;  2AS8 A;  3P5W A;  3KWB X;  3H8B A;  1MEG A;  2FO5 A;  2B1N A;  4P16 A;  4R3D A;  3BWK A;  1PPD A;  1U5I A;  4RF1 A;  2Y5B A;  1AEC A;  1IWD A;  2HD5 A;  1SNK A;  2C0Y A;  3WXE A;  4MI7 A;  3V6C A;  2E00 A;  1EWP A;  3PRP A;  2R9N A;  2AYN A;  2DZZ A;  2PNS A;  2ACT A;  4N8W A;  2PBH A;  3LXS A;  3V6E A;  1YZB A;  4BSQ A;  3BC3 A;  3OVX A;  4PT5 A;  1YAL A;  2B1M A;  4P6G A;  4ZTB A;  2FRA A;  2G7Y A;  3N3G A;  2HXZ A;  3N3K A;  4YYR A;  3PRM A;  5EGW A;  2DJF B;  2NQI A;  4HWY A;  2R9C A;  4QBB A;  1EWL A;  5F02 A;  3LFY A;  3IHP A;  3OIS A;  2BDL A;  3IEJ A;  5J94 A;  1BY8 A;  3GCB A;  1AU0 A;  1KFX L;  3TMP A;  4IP3 A;  4A5U A;  4BOZ A;  1GMY A;  3S3R A;  4W5B A;  2FE8 A;  4RF0 A;  2G6D A;  4G54 A;  4MZS A;  2BU3 A;  3O1G A;  4WUR A;  3IFU A;  2AU1 A;  1PBH A;  3CH3 X;  3B21 A;  5CHT A;  4DMY A;  1NB3 A;  4X6I A;  1GCB A;  3H8C A;  3KKU A;  2IPP B;  3KX1 A;  1MEM A;  2GFO A;  4WA6 A;  5JH3 A;  2G8J A;  3KSE A;  3OQC A;  2UZJ A;  4P6E A;  2DC9 A;  3ZUA A;  2Z84 A;  1PCI A;  4RY2 A;  2DZY A;  5CVO B;  7PCK A;  2J7Q A;  3W30 A;  3PHX A;  3E1Z B;  4N79 A;  3O0U A;  1CJL A;  2JRI A;  3WXG A;  1VSN A;  1FH0 A;  1AYU A;  2VHF A;  4QH6 A;  3CBJ A;  3BBA A;  4QRG A;  3QJ3 A;  4GUA A;  3NHE A;  5EZS A;  2PAD A;  3RVW A;  1U9V A;  3BPM A;  2J7Q C;  4BQV A;  3WXF A;  2WBF X;  1CVZ A;  2HWK A;  1ITO A;  1U9X A;  4Q8H A;  1AYW A;  1PE6 A;  3C9E A;  3CH2 X;  4XR7 A;  1CV8 A;  1A6R A;  2VHS A;  5CVN B;  1Y4H A;  2JTC A;  2AGA A;  9PAP A;  5EF4 A;  1TU6 A;  1NPZ A;  3QT4 A;  3HD3 A;  4BPV A;  1PPN A;  5FPW A;  1JQP A;  1MS6 A; 
#chains in the Genus database with same CATH homology
 4W5C A;  4PP2 E;  1YK7 A;  1SP4 B;  1POP A;  1TL9 A;  1BP4 A;  4CZW A;  4OEM A;  4FIP A;  2YJ8 A;  1AU2 A;  1GX3 A;  1ICF A;  4PAD A;  3H7D A;  2DCB A;  2VFB A;  1U9Q X;  1PAD A;  3IMA A;  4FK5 A;  2F1G A;  1NQC A;  4BS5 A;  1F29 A;  5CHV A;  1CB5 A;  1MDW A;  2DC8 A;  1ATK A;  4OEL A;  1XKG A;  2JQF R;  1BQI A;  1TLO A;  3K9M A;  3PW3 A;  1KHQ A;  2BDZ A;  2R9M A;  4CDE B;  3AI8 A;  1QDQ A;  2P0R A;  2F7D A;  1W6F A;  3RVX A;  1PPP A;  2E03 A;  1CSB B;  3MTN A;  3OF8 A;  5JA7 A;  1X9Y A;  3F5V A;  1S4V A;  2CIO A;  2AUZ A;  3BCN A;  3P5X A;  3IV2 A;  4I07 A;  2R6N A;  1O0E A;  2XU1 A;  2P86 A;  1QXP A;  4FJC A;  1THE A;  3HWN A;  5K16 A;  1KHP A;  3I3T A;  3KW9 A;  1NB5 A;  2NQG A;  2OP3 A;  4YYW A;  2R9O A;  4AXM A;  1CS8 A;  3B79 A;  2IBI A;  2DC7 A;  3DF0 A;  3M99 A;  2YJ2 A;  3KWZ A;  3RVV A;  4CDF B;  1VJV A;  3P5U A;  3MHH A;  2AVW A;  4MSX A;  1AYV A;  4PI3 A;  2PRE A;  1ME4 A;  4YYV A;  2FRQ A;  3HHA A;  3D6S A;  4PP1 A;  3MOR A;  1KFU L;  3D9W A;  1KXR A;  3PBH A;  3PDF A;  2O6X A;  8PCH A;  1GEC E;  4N4Z A;  2NQD B;  3IUT A;  5A24 A;  1F2C A;  2ARY A;  1AU3 A;  2FUD A;  2DC6 A;  1YVB A;  1U9W A;  3H89 A;  3TNX A;  2Y6E A;  3U8E A;  3IOQ A;  1NLJ A;  4CDC B;  1CQD A;  3S3Q A;  1CPJ A;  1MHW A;  1AU4 A;  2R9F A;  3MHS A;  4XUI A;  3CBK A;  1DEU A;  3HHI A;  2YJB A;  3PNR A;  4I04 A;  3QSD A;  2GHU A;  2HH5 A;  1AIM A;  1GLO A;  2FYE A;  2G8E A;  2HHN A;  1PIP A;  4W4U A;  3P5V A;  2ATO A;  1CTE A;  1ZCM A;  3F75 A;  1F2A A;  3I06 A;  3BPF A;  4K7C A;  2XU3 A;  3K8U A;  2AYO A;  4NV7 A;  1E2T A;  2JQG R;  1BGO A;  1M6D A;  2E02 A;  1EF7 A;  1PXV A;  2AUX A;  1HUC B;  2NQA A;  1QOL A;  4YV8 A;  3ERV A;  5PAD A;  4YVA A;  2E01 A;  2FT2 A;  4YYS A;  2DCC A;  2XU5 A;  1EWM A;  3OVZ A;  2DCD A;  4YYU A;  1EWO A;  2H7J A;  3H6S A;  1NL6 A;  2DCA A;  1ME3 A;  4Q8G A;  4X6J A;  2OUL A;  3USV A;  4X6H A;  1K3B B;  4CDD B;  5CVM A;  2P7U A;  1STF E;  1ZIV A;  6PAD A;  2FTD A;  2XU4 A;  2FQ9 A;  1Q6K A;  1MIR A;  3BOW A;  2YJ9 A;  1DF0 A;  1W5R A;  3N4C A;  4ZUX U;  4BGF A;  4AXL A;  4QRX A;  4YYQ A;  3K24 A;  1YK8 A;  2OZ2 A;  3OF9 A;  2YJC A;  1YT7 A;  4KLB A;  4MZO A;  2VFC A;  1QMY A;  1PPO A;  2CB5 A;  1F2B A;  4DMX A;  4QRV A;  2DJG B;  3KFQ A;  4I05 A;  2AIM A;  1Y08 A;  2BSZ A;  4BS6 A;  2AS8 A;  3P5W A;  3KWB X;  3H8B A;  1MEG A;  2FO5 A;  2B1N A;  3LTW A;  3BWK A;  1PPD A;  1U5I A;  2Y5B A;  1AEC A;  1IWD A;  2HD5 A;  1SNK A;  2C0Y A;  3WXE A;  3V6C A;  2E00 A;  1EWP A;  2R9N A;  2AYN A;  2DZZ A;  2PNS A;  2ACT A;  4N8W A;  2PBH A;  3LXS A;  4NV8 A;  3V6E A;  4BSQ A;  3BC3 A;  3OVX A;  1YAL A;  2B1M A;  4P6G A;  2FRA A;  2G7Y A;  3N3G A;  2HXZ A;  3N3K A;  4YYR A;  5EGW A;  2DJF B;  2NQI A;  4HWY A;  2R9C A;  4QBB A;  1EWL A;  5F02 A;  3LFY A;  3IHP A;  3OIS A;  2BDL A;  3IEJ A;  5J94 A;  1BY8 A;  3GCB A;  1AU0 A;  1KFX L;  1GMY A;  3S3R A;  4W5B A;  2G6D A;  4G54 A;  4MZS A;  3O1G A;  2AU1 A;  1PBH A;  3CH3 X;  5CHT A;  4DMY A;  1NB3 A;  4X6I A;  1GCB A;  3H8C A;  3KKU A;  2IPP B;  3KX1 A;  1MEM A;  2GFO A;  4WA6 A;  5JH3 A;  2G8J A;  3KSE A;  4P6E A;  2DC9 A;  3ZUA A;  1PCI A;  4RY2 A;  2DZY A;  5CVO B;  7PCK A;  3E1Z B;  4N79 A;  3O0U A;  1CJL A;  3WXG A;  1VSN A;  1FH0 A;  1AYU A;  2VHF A;  4QH6 A;  3CBJ A;  4GUZ A;  4QRG A;  3QJ3 A;  3NHE A;  2PAD A;  3RVW A;  1U9V A;  1W4T A;  3BPM A;  4BQV A;  3WXF A;  2WBF X;  1CVZ A;  1ITO A;  1U9X A;  4Q8H A;  1AYW A;  1PE6 A;  3C9E A;  3CH2 X;  4XR7 A;  1CV8 A;  1A6R A;  5CVN B;  2VHS A;  1Y4H A;  9PAP A;  5EF4 A;  1TU6 A;  1NPZ A;  3QT4 A;  3HD3 A;  4BPV A;  4C5P A;  4B55 A;  1PPN A;  5FPW A;  1JQP A;  1MS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...