3P5WA

Actinidin from actinidia arguta planch (sarusashi)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
220
structure length
220
Chain Sequence
LPDYVDWRSSGAVVDIKDQGQCGSCWAFSTIAAVEGINKIATGDLISLSEQELVDCGRTQNTRGCDGGFMTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGGVGQCGIAKKASYPVKYYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Actinidin
publication title Structural analysis of actinidin and a comparison of cadmium and sulfur anomalous signals from actinidin crystals measured using in-house copper- and chromium-anode X-ray sources
pubmed doi rcsb
total genus 64
structure length 220
sequence length 220
ec nomenclature ec 3.4.22.14: Actinidain.
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3p5wA00
3IHPA 1MEMA 3GCBA 4MSXA 3DF0A 2R6NA 4KLBA 1POPA 4W4UA 2ACTA 2E03A 2R9MA 3NHEA 2FT2A 3PDFA 1ICFA 2E01A 4CZWA 2G6DA 3D6SA 4CDCB 1EF7A 4PADA 2AU1A 3OF8A 2DC9A 4OELA 2NQGA 2YJCA 1DEUA 2C0YA 2DCDA 2DZYA 2AS8A 3F5VA 4DMYA 1BGOA 2DCAA 2WBFX 2GFOA 2HHNA 4YVAA 1DF0A 1PADA 3IUTA 4CDDB 1CB5A 2F1GA 3TNXA 3KKUA 3OVXA 2YJ8A 4YYSA 3RVVA 5A24A 3KWBX 2GHUA 1ZIVA 3KW9A 2PNSA 2DCCA 2XU1A 1HUCB 5CVNB 3RVWA 1AU2A 2ATOA 2CB5A 1CQDA 2HXZA 2HH5A 3MTNA 5CVOB 1PPDA 3H8CA 4QH6A 1MEGA 1EWPA 2P7UA 1TL9A 1PBHA 3F75A 1PE6A 3V6EA 2ARYA 3ERVA 3B79A 3KWZA 4CDFB 4W5BA 2AIMA 1QXPA 2E02A 3OISA 3H8BA 1EWMA 1BY8A 4I04A 1KFUL 3H89A 1YK7A 2R9NA 3CBJA 1K3BB 2VHSA 1U9VA 1KHPA 4I07A 3HHIA 1U9XA 4Q8HA 3BPFA 2FRAA 3I06A 1AECA 5JH3A 2JQGR 1CSBB 5EF4A 3S3QA 3I3TA 2FO5A 2XU5A 2VHFA 4BSQA 2BDZA 2DC8A 2FQ9A 5CHVA 1F29A 3WXGA 1XKGA 3PBHA 1F2AA 1Y4HA 4XR7A 2PREA 3BC3A 3BPMA 4OEMA 2PADA 2P0RA 1THEA 1U9WA 2G8EA 2YJ9A 1GCBA 3O0UA 1U9QX 2OP3A 3P5UA 2DJGB 3IEJA 1SP4B 1NQCA 3IV2A 4Q8GA 2OULA 3BCNA 1F2CA 1CVZA 4RY2A 1QMYA 4PI3A 3N3GA 2F7DA 3USVA 4YYWA 1NB5A 3HD3A 2O6XA 1YK8A 2AYOA 4YYQA 4QRXA 1U5IA 1ITOA 3MORA 2IPPB 1MHWA 5CHTA 1A6RA 2OZ2A 5F02A 2PBHA 2B1MA 2DCBA 3MHSA 1AYUA 1PIPA 9PAPA 3LFYA 2B1NA 1Q6KA 2DC6A 2YJ2A 1PCIA 3WXFA 2NQIA 1EWLA 4I05A 4YYRA 3CBKA 3OF9A 7PCKA 1MS6A 1VSNA 4AXMA 3BWKA 1AU4A 1YT7A 1ME4A 5FPWA 3RVXA 1SNKA 3WXEA 1S4VA 1VJVA 5EGWA 4YV8A 1FH0A 1GECE 2JQFR 1O0EA 1NPZA 1ME3A 2G7YA 4MZSA 1TU6A 3OVZA 4QRGA 2AUZA 3HHAA 3LXSA 3K9MA 2FYEA 1PPPA 3P5VA 4WA6A 1JQPA 5CVMA 4DMXA 1NB3A 2DJFB 3N3KA 5PADA 4W5CA 4QRVA 2R9FA 4MZOA 1NL6A 2AUXA 4N79A 1CJLA 2FUDA 3PW3A 1X9YA 2NQAA 1EWOA 3P5WA 1GLOA 2G8JA 2AVWA 2AYNA 2DZZA 1CV8A 3C9EA 8PCHA 4ZUXU 1PXVA 3P5XA 4YYVA 2XU3A 1MIRA 2P86A 3KFQA 1QOLA 3O1GA 1CS8A 3K8UA 4G54A 3E1ZB 4N4ZA 4PP2E 4X6IA 1ATKA 2FTDA 1Y08A 3HWNA 3H6SA 1PPOA 4AXLA 1AIMA 4PP1A 1IWDA 3CH2X 5K16A 4CDEB 3QSDA 1KFXL 5JA7A 4FJCA 1MDWA 2XU4A 4YYUA 3BOWA 4FIPA 3H7DA 4QBBA 1ZCMA 1YALA 3S3RA 1AYWA 3M99A 1PPNA 1CTEA 3CH3X 1STFE 4XUIA 2DC7A 1TLOA 4BPVA 1AU3A 1KHQA 4K7CA 1QDQA 3ZUAA 4BS6A 2R9CA 3IMAA 1BP4A 1BQIA 3PNRA 3U8EA 3V6CA 4BQVA 3QT4A 1YVBA 2Y6EA 4FK5A 4X6JA 1GMYA 2IBIA 3MHHA 4P6EA 2E00A 4X6HA 1KXRA 1M6DA 2NQDB 4HWYA 1NLJA 4N8WA 2R9OA 3KSEA 3IOQA 2Y5BA 4BS5A 4P6GA 2HD5A 3K24A 3AI8A 3QJ3A 5J94A 1AU0A 6PADA 1F2BA 1CPJA 3KX1A 2FRQA 2H7JA 2YJBA 1AYVA 2BDLA 3N4CA 2CIOA
chains in the Genus database with same CATH superfamily
3IHPA 1MEMA 2AGAA 3GCBA 4MSXA 3DF0A 2R6NA 4KLBA 1POPA 4W4UA 2ACTA 2E03A 2R9MA 3NHEA 2FT2A 3PDFA 1ICFA 2E01A 4CZWA 3MP2A 2G6DA 3D6SA 4CDCB 1EF7A 4PADA 2AU1A 3OF8A 2DC9A 4OELA 4D8IA 4R3DA 4REZA 3PHXA 2NQGA 2YJCA 1DEUA 2C0YA 2DCDA 2DZYA 3OQCA 2AS8A 3F5VA 4DMYA 1BGOA 2DCAA 2WBFX 4BOPA 2GFOA 2HHNA 4YVAA 1DF0A 1PADA 3IUTA 4CDDB 1CB5A 2F1GA 3TNXA 3KKUA 3OVXA 2YJ8A 4YYSA 3RVVA 5A24A 3KWBX 2GHUA 1ZIVA 3KW9A 2PNSA 2DCCA 2XU1A 1HUCB 1YZBA 1DKIA 2J7QC 4RF0A 5CVNB 3RVWA 1AU2A 2ATOA 2CB5A 1CQDA 2HXZA 2HH5A 3MTNA 5CVOB 1PPDA 3H8CA 4QH6A 1MEGA 1EWPA 2P7UA 1TL9A 4OW0A 1PBHA 3F75A 1PE6A 3V6EA 2ARYA 3ERVA 3B79A 3KWZA 4D8EA 3PRPA 4CDFB 2J7QA 4W5BA 2AIMA 1QXPA 5E6JA 2E02A 3OISA 3H8BA 1EWMA 4BOUA 1BY8A 4I04A 1KFUL 4RNAA 3PT2A 3H89A 1YK7A 2R9NA 4PT5A 3CBJA 3W30A 1K3BB 2VHSA 1U9VA 1KHPA 4I07A 3HHIA 1U9XA 2DOSA 4Q8HA 3BPFA 2FRAA 3I06A 1AECA 5JH3A 2JQGR 4OVZA 3MTVA 1CSBB 5EF4A 3S3QA 3I3TA 2FO5A 2XU5A 2VHFA 4BSQA 2BDZA 2DC8A 2FQ9A 5CHVA 1F29A 3WXGA 1XKGA 3PBHA 5EZQA 1F2AA 1Y4HA 4XR7A 2PREA 3BC3A 3BPMA 4OEMA 2PADA 3PRMA 3MJ5A 2P0RA 1THEA 1U9WA 2G8EA 3BY4A 2YJ9A 1GCBA 3TMPA 3O0UA 1U9QX 2HWKA 2OP3A 3P5UA 2DJGB 5KO3A 3IEJA 1SP4B 1NQCA 3IV2A 4Q8GA 2OULA 3BCNA 4RF1A 1F2CA 1CVZA 4RY2A 1QMYA 4PI3A 3N3GA 3ZNHA 2F7DA 3USVA 2BTWA 4YYWA 3HD3A 2O6XA 1NB5A 3IFUA 1YK8A 2AYOA 4YYQA 4QRXA 4GUAA 1U5IA 1ITOA 3MORA 4M0WA 2IPPB 1MHWA 4P16A 5CHTA 1A6RA 2OZ2A 5F02A 2PBHA 4WURA 2BTWB 2B1MA 2DCBA 3MHSA 1AYUA 1PIPA 9PAPA 3LFYA 2B1NA 1Q6KA 2JRIA 2DC6A 2YJ2A 1PCIA 1UKFA 3WXFA 3RNVA 2NQIA 1EWLA 4I05A 4YYRA 3CBKA 3OF9A 7PCKA 1MS6A 1VSNA 4AXMA 3BWKA 1AU4A 1YT7A 1ME4A 5FPWA 4RKXA 3RVXA 1SNKA 3W31A 1S4VA 1VJVA 3WXEA 5EGWA 4BOQA 4BOZA 4YV8A 1FH0A 1GECE 2JQFR 1O0EA 1NPZA 1ME3A 2G7YA 4MZSA 1TU6A 3OVZA 4QRGA 2AUZA 3HHAA 5JZEA 3LXSA 3K9MA 2FYEA 1PPPA 3BB7A 3P5VA 4WA6A 1JQPA 5CVMA 4DMXA 1NB3A 2DJFB 3N3KA 5EZSA 5PADA 4W5CA 4QRVA 2R9FA 4MZOA 1NL6A 2AUXA 4N79A 1CJLA 2FUDA 3PW3A 1X9YA 2NQAA 3BBAA 4OVZB 1EWOA 3P5WA 1GLOA 2G8JA 2AVWA 2AYNA 2DZZA 1CV8A 3C9EA 8PCHA 4IUMA 4ZUXU 1PXVA 3P5XA 4YYVA 2XU3A 1MIRA 3E9SA 2P86A 3KFQA 3B21A 1QOLA 3O1GA 1CS8A 4XZXA 3K8UA 4G54A 3E1ZB 4N4ZA 4PP2E 4X6IA 1ATKA 3PHUA 2FTDA 1Y08A 3HWNA 3H6SA 1PPOA 4AXLA 1AIMA 4PP1A 1IWDA 4ZTBA 3CH2X 5K16A 4CDEB 3QSDA 1KFXL 5JA7A 4FJCA 1MDWA 2XU4A 3TRKA 4YYUA 3BOWA 4FIPA 3H7DA 3C0RA 4MM3B 4QBBA 1ZCMA 1YALA 3S3RA 1AYWA 3M99A 1PPNA 2UZJA 1CTEA 3CH3X 4D8BA 1STFE 4IP3A 4A5UA 4XUIA 2DC7A 3O65A 1TLOA 4BPVA 4MI7A 1AU3A 3PSEA 1KHQA 4K7CA 1QDQA 3ZUAA 4BS6A 2R9CA 3IMAA 2FE8A 2Z84A 1BP4A 1BQIA 3PNRA 4BOSA 3U8EA 3V6CA 4BQVA 3QT4A 1YVBA 2Y6EA 4FK5A 4X6JA 1GMYA 4HXDB 2IBIA 3MHHA 4P6EA 2E00A 4X6HA 1PVJA 1KXRA 1M6DA 2NQDB 4HWYA 1NLJA 2BU3A 4N8WA 2R9OA 3KSEA 3IOQA 2Y5BA 4BS5A 4P6GA 2HD5A 3K24A 3AI8A 3QJ3A 5J94A 1AU0A 6PADA 1F2BA 1CPJA 3KX1A 2FRQA 2JTCA 2H7JA 2YJBA 3PHWA 1AYVA 2BDLA 3N4CA 2CIOA
chains in the Genus database with same CATH topology
3IHPA 1MEMA 3GCBA 4MSXA 3DF0A 2R6NA 4KLBA 1POPA 4W4UA 2ACTA 2E03A 2R9MA 3NHEA 2FT2A 3PDFA 1ICFA 2E01A 4CZWA 2G6DA 3D6SA 4B55A 4CDCB 1EF7A 4PADA 2AU1A 3OF8A 2DC9A 4OELA 3LTWA 2NQGA 2YJCA 1DEUA 2C0YA 2DCDA 2DZYA 2AS8A 3F5VA 4DMYA 1BGOA 2DCAA 2WBFX 2GFOA 2HHNA 4YVAA 1DF0A 1PADA 3IUTA 4CDDB 1CB5A 2F1GA 3TNXA 3KKUA 3OVXA 4NV8A 2YJ8A 4YYSA 3RVVA 5A24A 3KWBX 2GHUA 1ZIVA 3KW9A 2PNSA 2DCCA 2XU1A 1HUCB 5CVNB 3RVWA 1AU2A 2ATOA 2CB5A 1CQDA 2HXZA 2HH5A 3MTNA 5CVOB 1PPDA 3H8CA 4QH6A 1MEGA 1EWPA 2P7UA 1TL9A 1PBHA 3F75A 1PE6A 3V6EA 2ARYA 3ERVA 3B79A 3KWZA 4CDFB 4W5BA 2AIMA 1QXPA 2E02A 3OISA 3H8BA 1EWMA 1BY8A 4I04A 1KFUL 3H89A 1YK7A 2R9NA 4NV7A 3CBJA 1K3BB 2VHSA 1U9VA 1KHPA 4I07A 3HHIA 1U9XA 4Q8HA 3BPFA 4BGFA 2FRAA 3I06A 1AECA 5JH3A 2JQGR 1CSBB 5EF4A 3S3QA 3I3TA 2FO5A 2XU5A 2VHFA 4BSQA 2BDZA 2DC8A 2FQ9A 5CHVA 1F29A 3WXGA 1XKGA 3PBHA 1F2AA 1Y4HA 4XR7A 2PREA 3BC3A 3BPMA 4OEMA 2PADA 2P0RA 1THEA 1U9WA 2G8EA 2YJ9A 1GCBA 3O0UA 1U9QX 2OP3A 3P5UA 2DJGB 3IEJA 1SP4B 1NQCA 3IV2A 4Q8GA 2OULA 3BCNA 1F2CA 1CVZA 4RY2A 1QMYA 4PI3A 3N3GA 2F7DA 3USVA 4YYWA 1NB5A 3HD3A 2O6XA 1YK8A 2AYOA 4YYQA 4QRXA 2VFCA 1U5IA 1ITOA 3MORA 2IPPB 1MHWA 5CHTA 1A6RA 2OZ2A 1GX3A 5F02A 2PBHA 2B1MA 2DCBA 3MHSA 1AYUA 1PIPA 9PAPA 3LFYA 2B1NA 1Q6KA 2DC6A 2YJ2A 1PCIA 3WXFA 2NQIA 1EWLA 4I05A 4YYRA 3CBKA 3OF9A 7PCKA 1MS6A 1VSNA 4AXMA 3BWKA 4C5PA 1AU4A 1YT7A 1ME4A 5FPWA 3RVXA 1SNKA 3WXEA 1S4VA 1VJVA 5EGWA 4YV8A 1FH0A 1GECE 2JQFR 1O0EA 1NPZA 1ME3A 2G7YA 4MZSA 1TU6A 3OVZA 1W4TA 4QRGA 2AUZA 3HHAA 3LXSA 3K9MA 2FYEA 1PPPA 3P5VA 4WA6A 1JQPA 5CVMA 4DMXA 1NB3A 2DJFB 3N3KA 5PADA 4W5CA 4QRVA 2R9FA 4MZOA 1NL6A 2AUXA 4N79A 1CJLA 2FUDA 2BSZA 3PW3A 1X9YA 2NQAA 1EWOA 3P5WA 1GLOA 2G8JA 2AVWA 2AYNA 2DZZA 1CV8A 3C9EA 8PCHA 4ZUXU 1PXVA 3P5XA 4YYVA 2XU3A 1MIRA 2P86A 3KFQA 1QOLA 3O1GA 1CS8A 3K8UA 4G54A 3E1ZB 4N4ZA 4PP2E 4X6IA 1ATKA 2FTDA 1Y08A 3HWNA 3H6SA 1PPOA 4AXLA 1AIMA 4PP1A 1IWDA 3CH2X 5K16A 4CDEB 3QSDA 1KFXL 5JA7A 4FJCA 1MDWA 2XU4A 4YYUA 1E2TA 3BOWA 4FIPA 3H7DA 4QBBA 1ZCMA 1YALA 3D9WA 3S3RA 1AYWA 3M99A 1PPNA 1CTEA 3CH3X 1STFE 4XUIA 2DC7A 1TLOA 4BPVA 2VFBA 1AU3A 1KHQA 4K7CA 1QDQA 3ZUAA 4BS6A 2R9CA 3IMAA 1BP4A 1BQIA 3PNRA 3U8EA 3V6CA 4GUZA 4BQVA 3QT4A 1YVBA 2Y6EA 4FK5A 4X6JA 1GMYA 2IBIA 3MHHA 4P6EA 2E00A 4X6HA 1W5RA 1KXRA 1M6DA 2NQDB 4HWYA 1NLJA 4N8WA 3KSEA 2R9OA 3IOQA 2Y5BA 4BS5A 4P6GA 2HD5A 3K24A 3AI8A 3QJ3A 5J94A 1AU0A 1W6FA 6PADA 1F2BA 1CPJA 3KX1A 2FRQA 2H7JA 2YJBA 1AYVA 2BDLA 3N4CA 2CIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP A;  1MEM A;  3GCB A;  4MSX A;  3DF0 A;  2R6N A;  4KLB A;  1POP A;  4W4U A;  2ACT A;  2E03 A;  2R9M A;  3NHE A;  2FT2 A;  3PDF A;  1ICF A;  2E01 A;  4CZW A;  2G6D A;  3D6S A;  4CDC B;  1EF7 A;  4PAD A;  2AU1 A;  3OF8 A;  2DC9 A;  4OEL A;  2NQG A;  2YJC A;  1DEU A;  2C0Y A;  2DCD A;  2DZY A;  2AS8 A;  3F5V A;  4DMY A;  1BGO A;  2DCA A;  2WBF X;  2GFO A;  2HHN A;  4YVA A;  1DF0 A;  1PAD A;  3IUT A;  4CDD B;  1CB5 A;  2F1G A;  3TNX A;  3KKU A;  3OVX A;  2YJ8 A;  4YYS A;  3RVV A;  5A24 A;  3KWB X;  2GHU A;  1ZIV A;  3KW9 A;  2PNS A;  2DCC A;  2XU1 A;  1HUC B;  5CVN B;  3RVW A;  1AU2 A;  2ATO A;  2CB5 A;  1CQD A;  2HXZ A;  2HH5 A;  3MTN A;  5CVO B;  1PPD A;  3H8C A;  4QH6 A;  1MEG A;  1EWP A;  2P7U A;  1TL9 A;  1PBH A;  3F75 A;  1PE6 A;  3V6E A;  2ARY A;  3ERV A;  3B79 A;  3KWZ A;  4CDF B;  4W5B A;  2AIM A;  1QXP A;  2E02 A;  3OIS A;  3H8B A;  1EWM A;  1BY8 A;  4I04 A;  1KFU L;  3H89 A;  1YK7 A;  2R9N A;  3CBJ A;  1K3B B;  2VHS A;  1U9V A;  1KHP A;  4I07 A;  3HHI A;  1U9X A;  4Q8H A;  3BPF A;  2FRA A;  3I06 A;  1AEC A;  5JH3 A;  2JQG R;  1CSB B;  5EF4 A;  3S3Q A;  3I3T A;  2FO5 A;  2XU5 A;  2VHF A;  4BSQ A;  2BDZ A;  2DC8 A;  2FQ9 A;  5CHV A;  1F29 A;  3WXG A;  1XKG A;  3PBH A;  1F2A A;  1Y4H A;  4XR7 A;  2PRE A;  3BC3 A;  3BPM A;  4OEM A;  2PAD A;  2P0R A;  1THE A;  1U9W A;  2G8E A;  2YJ9 A;  1GCB A;  3O0U A;  1U9Q X;  2OP3 A;  3P5U A;  2DJG B;  3IEJ A;  1SP4 B;  1NQC A;  3IV2 A;  4Q8G A;  2OUL A;  3BCN A;  1F2C A;  1CVZ A;  4RY2 A;  1QMY A;  4PI3 A;  3N3G A;  2F7D A;  3USV A;  4YYW A;  1NB5 A;  3HD3 A;  2O6X A;  1YK8 A;  2AYO A;  4YYQ A;  4QRX A;  1U5I A;  1ITO A;  3MOR A;  2IPP B;  1MHW A;  5CHT A;  1A6R A;  2OZ2 A;  5F02 A;  2PBH A;  2B1M A;  2DCB A;  3MHS A;  1AYU A;  1PIP A;  9PAP A;  3LFY A;  2B1N A;  1Q6K A;  2DC6 A;  2YJ2 A;  1PCI A;  3WXF A;  2NQI A;  1EWL A;  4I05 A;  4YYR A;  3CBK A;  3OF9 A;  7PCK A;  1MS6 A;  1VSN A;  4AXM A;  3BWK A;  1AU4 A;  1YT7 A;  1ME4 A;  5FPW A;  3RVX A;  1SNK A;  3WXE A;  1S4V A;  1VJV A;  5EGW A;  4YV8 A;  1FH0 A;  1GEC E;  2JQF R;  1O0E A;  1NPZ A;  1ME3 A;  2G7Y A;  4MZS A;  1TU6 A;  3OVZ A;  4QRG A;  2AUZ A;  3HHA A;  3LXS A;  3K9M A;  2FYE A;  1PPP A;  3P5V A;  4WA6 A;  1JQP A;  5CVM A;  4DMX A;  1NB3 A;  2DJF B;  3N3K A;  5PAD A;  4W5C A;  4QRV A;  2R9F A;  4MZO A;  1NL6 A;  2AUX A;  4N79 A;  1CJL A;  2FUD A;  3PW3 A;  1X9Y A;  2NQA A;  1EWO A;  3P5W A;  1GLO A;  2G8J A;  2AVW A;  2AYN A;  2DZZ A;  1CV8 A;  3C9E A;  8PCH A;  4ZUX U;  1PXV A;  3P5X A;  4YYV A;  2XU3 A;  1MIR A;  2P86 A;  3KFQ A;  1QOL A;  3O1G A;  1CS8 A;  3K8U A;  4G54 A;  3E1Z B;  4N4Z A;  4PP2 E;  4X6I A;  1ATK A;  2FTD A;  1Y08 A;  3HWN A;  3H6S A;  1PPO A;  4AXL A;  1AIM A;  4PP1 A;  1IWD A;  3CH2 X;  5K16 A;  4CDE B;  3QSD A;  1KFX L;  5JA7 A;  4FJC A;  1MDW A;  2XU4 A;  4YYU A;  3BOW A;  4FIP A;  3H7D A;  4QBB A;  1ZCM A;  1YAL A;  3S3R A;  1AYW A;  3M99 A;  1PPN A;  1CTE A;  3CH3 X;  1STF E;  4XUI A;  2DC7 A;  1TLO A;  4BPV A;  1AU3 A;  1KHQ A;  4K7C A;  1QDQ A;  3ZUA A;  4BS6 A;  2R9C A;  3IMA A;  1BP4 A;  1BQI A;  3PNR A;  3U8E A;  3V6C A;  4BQV A;  3QT4 A;  1YVB A;  2Y6E A;  4FK5 A;  4X6J A;  1GMY A;  2IBI A;  3MHH A;  4P6E A;  2E00 A;  4X6H A;  1KXR A;  1M6D A;  2NQD B;  4HWY A;  1NLJ A;  4N8W A;  2R9O A;  3KSE A;  3IOQ A;  2Y5B A;  4BS5 A;  4P6G A;  2HD5 A;  3K24 A;  3AI8 A;  3QJ3 A;  5J94 A;  1AU0 A;  6PAD A;  1F2B A;  1CPJ A;  3KX1 A;  2FRQ A;  2H7J A;  2YJB A;  1AYV A;  2BDL A;  3N4C A;  2CIO A; 
#chains in the Genus database with same CATH topology
 3IHP A;  1MEM A;  2AGA A;  3GCB A;  4MSX A;  3DF0 A;  2R6N A;  4KLB A;  1POP A;  4W4U A;  2ACT A;  2E03 A;  2R9M A;  3NHE A;  2FT2 A;  3PDF A;  1ICF A;  2E01 A;  4CZW A;  3MP2 A;  2G6D A;  3D6S A;  4CDC B;  1EF7 A;  4PAD A;  2AU1 A;  3OF8 A;  2DC9 A;  4OEL A;  4D8I A;  4R3D A;  4REZ A;  3PHX A;  2NQG A;  2YJC A;  1DEU A;  2C0Y A;  2DCD A;  2DZY A;  3OQC A;  2AS8 A;  3F5V A;  4DMY A;  1BGO A;  2DCA A;  2WBF X;  4BOP A;  2GFO A;  2HHN A;  4YVA A;  1DF0 A;  1PAD A;  3IUT A;  4CDD B;  1CB5 A;  2F1G A;  3TNX A;  3KKU A;  3OVX A;  2YJ8 A;  4YYS A;  3RVV A;  5A24 A;  3KWB X;  2GHU A;  1ZIV A;  3KW9 A;  2PNS A;  2DCC A;  2XU1 A;  1HUC B;  1YZB A;  1DKI A;  2J7Q C;  4RF0 A;  5CVN B;  3RVW A;  1AU2 A;  2ATO A;  2CB5 A;  1CQD A;  2HXZ A;  2HH5 A;  3MTN A;  5CVO B;  1PPD A;  3H8C A;  4QH6 A;  1MEG A;  1EWP A;  2P7U A;  1TL9 A;  4OW0 A;  1PBH A;  3F75 A;  1PE6 A;  3V6E A;  2ARY A;  3ERV A;  3B79 A;  3KWZ A;  4D8E A;  3PRP A;  4CDF B;  2J7Q A;  4W5B A;  2AIM A;  1QXP A;  5E6J A;  2E02 A;  3OIS A;  3H8B A;  1EWM A;  4BOU A;  1BY8 A;  4I04 A;  1KFU L;  4RNA A;  3PT2 A;  3H89 A;  1YK7 A;  2R9N A;  4PT5 A;  3CBJ A;  3W30 A;  1K3B B;  2VHS A;  1U9V A;  1KHP A;  4I07 A;  3HHI A;  1U9X A;  2DOS A;  4Q8H A;  3BPF A;  2FRA A;  3I06 A;  1AEC A;  5JH3 A;  2JQG R;  4OVZ A;  3MTV A;  1CSB B;  5EF4 A;  3S3Q A;  3I3T A;  2FO5 A;  2XU5 A;  2VHF A;  4BSQ A;  2BDZ A;  2DC8 A;  2FQ9 A;  5CHV A;  1F29 A;  3WXG A;  1XKG A;  3PBH A;  5EZQ A;  1F2A A;  1Y4H A;  4XR7 A;  2PRE A;  3BC3 A;  3BPM A;  4OEM A;  2PAD A;  3PRM A;  3MJ5 A;  2P0R A;  1THE A;  1U9W A;  2G8E A;  3BY4 A;  2YJ9 A;  1GCB A;  3TMP A;  3O0U A;  1U9Q X;  2HWK A;  2OP3 A;  3P5U A;  2DJG B;  5KO3 A;  3IEJ A;  1SP4 B;  1NQC A;  3IV2 A;  4Q8G A;  2OUL A;  3BCN A;  4RF1 A;  1F2C A;  1CVZ A;  4RY2 A;  1QMY A;  4PI3 A;  3N3G A;  3ZNH A;  2F7D A;  3USV A;  2BTW A;  4YYW A;  3HD3 A;  2O6X A;  1NB5 A;  3IFU A;  1YK8 A;  2AYO A;  4YYQ A;  4QRX A;  4GUA A;  1U5I A;  1ITO A;  3MOR A;  4M0W A;  2IPP B;  1MHW A;  4P16 A;  5CHT A;  1A6R A;  2OZ2 A;  5F02 A;  2PBH A;  4WUR A;  2BTW B;  2B1M A;  2DCB A;  3MHS A;  1AYU A;  1PIP A;  9PAP A;  3LFY A;  2B1N A;  1Q6K A;  2JRI A;  2DC6 A;  2YJ2 A;  1PCI A;  1UKF A;  3WXF A;  3RNV A;  2NQI A;  1EWL A;  4I05 A;  4YYR A;  3CBK A;  3OF9 A;  7PCK A;  1MS6 A;  1VSN A;  4AXM A;  3BWK A;  1AU4 A;  1YT7 A;  1ME4 A;  5FPW A;  4RKX A;  3RVX A;  1SNK A;  3W31 A;  1S4V A;  1VJV A;  3WXE A;  5EGW A;  4BOQ A;  4BOZ A;  4YV8 A;  1FH0 A;  1GEC E;  2JQF R;  1O0E A;  1NPZ A;  1ME3 A;  2G7Y A;  4MZS A;  1TU6 A;  3OVZ A;  4QRG A;  2AUZ A;  3HHA A;  5JZE A;  3LXS A;  3K9M A;  2FYE A;  1PPP A;  3BB7 A;  3P5V A;  4WA6 A;  1JQP A;  5CVM A;  4DMX A;  1NB3 A;  2DJF B;  3N3K A;  5EZS A;  5PAD A;  4W5C A;  4QRV A;  2R9F A;  4MZO A;  1NL6 A;  2AUX A;  4N79 A;  1CJL A;  2FUD A;  3PW3 A;  1X9Y A;  2NQA A;  3BBA A;  4OVZ B;  1EWO A;  3P5W A;  1GLO A;  2G8J A;  2AVW A;  2AYN A;  2DZZ A;  1CV8 A;  3C9E A;  8PCH A;  4IUM A;  4ZUX U;  1PXV A;  3P5X A;  4YYV A;  2XU3 A;  1MIR A;  3E9S A;  2P86 A;  3KFQ A;  3B21 A;  1QOL A;  3O1G A;  1CS8 A;  4XZX A;  3K8U A;  4G54 A;  3E1Z B;  4N4Z A;  4PP2 E;  4X6I A;  1ATK A;  3PHU A;  2FTD A;  1Y08 A;  3HWN A;  3H6S A;  1PPO A;  4AXL A;  1AIM A;  4PP1 A;  1IWD A;  4ZTB A;  3CH2 X;  5K16 A;  4CDE B;  3QSD A;  1KFX L;  5JA7 A;  4FJC A;  1MDW A;  2XU4 A;  3TRK A;  4YYU A;  3BOW A;  4FIP A;  3H7D A;  3C0R A;  4MM3 B;  4QBB A;  1ZCM A;  1YAL A;  3S3R A;  1AYW A;  3M99 A;  1PPN A;  2UZJ A;  1CTE A;  3CH3 X;  4D8B A;  1STF E;  4IP3 A;  4A5U A;  4XUI A;  2DC7 A;  3O65 A;  1TLO A;  4BPV A;  4MI7 A;  1AU3 A;  3PSE A;  1KHQ A;  4K7C A;  1QDQ A;  3ZUA A;  4BS6 A;  2R9C A;  3IMA A;  2FE8 A;  2Z84 A;  1BP4 A;  1BQI A;  3PNR A;  4BOS A;  3U8E A;  3V6C A;  4BQV A;  3QT4 A;  1YVB A;  2Y6E A;  4FK5 A;  4X6J A;  1GMY A;  4HXD B;  2IBI A;  3MHH A;  4P6E A;  2E00 A;  4X6H A;  1PVJ A;  1KXR A;  1M6D A;  2NQD B;  4HWY A;  1NLJ A;  2BU3 A;  4N8W A;  2R9O A;  3KSE A;  3IOQ A;  2Y5B A;  4BS5 A;  4P6G A;  2HD5 A;  3K24 A;  3AI8 A;  3QJ3 A;  5J94 A;  1AU0 A;  6PAD A;  1F2B A;  1CPJ A;  3KX1 A;  2FRQ A;  2JTC A;  2H7J A;  2YJB A;  3PHW A;  1AYV A;  2BDL A;  3N4C A;  2CIO A; 
#chains in the Genus database with same CATH homology
 3IHP A;  1MEM A;  3GCB A;  4MSX A;  3DF0 A;  2R6N A;  4KLB A;  1POP A;  4W4U A;  2ACT A;  2E03 A;  2R9M A;  3NHE A;  2FT2 A;  3PDF A;  1ICF A;  2E01 A;  4CZW A;  2G6D A;  3D6S A;  4B55 A;  4CDC B;  1EF7 A;  4PAD A;  2AU1 A;  3OF8 A;  2DC9 A;  4OEL A;  3LTW A;  2NQG A;  2YJC A;  1DEU A;  2C0Y A;  2DCD A;  2DZY A;  2AS8 A;  3F5V A;  4DMY A;  1BGO A;  2DCA A;  2WBF X;  2GFO A;  2HHN A;  4YVA A;  1DF0 A;  1PAD A;  3IUT A;  4CDD B;  1CB5 A;  2F1G A;  3TNX A;  3KKU A;  3OVX A;  4NV8 A;  2YJ8 A;  4YYS A;  3RVV A;  5A24 A;  3KWB X;  2GHU A;  1ZIV A;  3KW9 A;  2PNS A;  2DCC A;  2XU1 A;  1HUC B;  5CVN B;  3RVW A;  1AU2 A;  2ATO A;  2CB5 A;  1CQD A;  2HXZ A;  2HH5 A;  3MTN A;  5CVO B;  1PPD A;  3H8C A;  4QH6 A;  1MEG A;  1EWP A;  2P7U A;  1TL9 A;  1PBH A;  3F75 A;  1PE6 A;  3V6E A;  2ARY A;  3ERV A;  3B79 A;  3KWZ A;  4CDF B;  4W5B A;  2AIM A;  1QXP A;  2E02 A;  3OIS A;  3H8B A;  1EWM A;  1BY8 A;  4I04 A;  1KFU L;  3H89 A;  1YK7 A;  2R9N A;  4NV7 A;  3CBJ A;  1K3B B;  2VHS A;  1U9V A;  1KHP A;  4I07 A;  3HHI A;  1U9X A;  4Q8H A;  3BPF A;  4BGF A;  2FRA A;  3I06 A;  1AEC A;  5JH3 A;  2JQG R;  1CSB B;  5EF4 A;  3S3Q A;  3I3T A;  2FO5 A;  2XU5 A;  2VHF A;  4BSQ A;  2BDZ A;  2DC8 A;  2FQ9 A;  5CHV A;  1F29 A;  3WXG A;  1XKG A;  3PBH A;  1F2A A;  1Y4H A;  4XR7 A;  2PRE A;  3BC3 A;  3BPM A;  4OEM A;  2PAD A;  2P0R A;  1THE A;  1U9W A;  2G8E A;  2YJ9 A;  1GCB A;  3O0U A;  1U9Q X;  2OP3 A;  3P5U A;  2DJG B;  3IEJ A;  1SP4 B;  1NQC A;  3IV2 A;  4Q8G A;  2OUL A;  3BCN A;  1F2C A;  1CVZ A;  4RY2 A;  1QMY A;  4PI3 A;  3N3G A;  2F7D A;  3USV A;  4YYW A;  1NB5 A;  3HD3 A;  2O6X A;  1YK8 A;  2AYO A;  4YYQ A;  4QRX A;  2VFC A;  1U5I A;  1ITO A;  3MOR A;  2IPP B;  1MHW A;  5CHT A;  1A6R A;  2OZ2 A;  1GX3 A;  5F02 A;  2PBH A;  2B1M A;  2DCB A;  3MHS A;  1AYU A;  1PIP A;  9PAP A;  3LFY A;  2B1N A;  1Q6K A;  2DC6 A;  2YJ2 A;  1PCI A;  3WXF A;  2NQI A;  1EWL A;  4I05 A;  4YYR A;  3CBK A;  3OF9 A;  7PCK A;  1MS6 A;  1VSN A;  4AXM A;  3BWK A;  4C5P A;  1AU4 A;  1YT7 A;  1ME4 A;  5FPW A;  3RVX A;  1SNK A;  3WXE A;  1S4V A;  1VJV A;  5EGW A;  4YV8 A;  1FH0 A;  1GEC E;  2JQF R;  1O0E A;  1NPZ A;  1ME3 A;  2G7Y A;  4MZS A;  1TU6 A;  3OVZ A;  1W4T A;  4QRG A;  2AUZ A;  3HHA A;  3LXS A;  3K9M A;  2FYE A;  1PPP A;  3P5V A;  4WA6 A;  1JQP A;  5CVM A;  4DMX A;  1NB3 A;  2DJF B;  3N3K A;  5PAD A;  4W5C A;  4QRV A;  2R9F A;  4MZO A;  1NL6 A;  2AUX A;  4N79 A;  1CJL A;  2FUD A;  2BSZ A;  3PW3 A;  1X9Y A;  2NQA A;  1EWO A;  3P5W A;  1GLO A;  2G8J A;  2AVW A;  2AYN A;  2DZZ A;  1CV8 A;  3C9E A;  8PCH A;  4ZUX U;  1PXV A;  3P5X A;  4YYV A;  2XU3 A;  1MIR A;  2P86 A;  3KFQ A;  1QOL A;  3O1G A;  1CS8 A;  3K8U A;  4G54 A;  3E1Z B;  4N4Z A;  4PP2 E;  4X6I A;  1ATK A;  2FTD A;  1Y08 A;  3HWN A;  3H6S A;  1PPO A;  4AXL A;  1AIM A;  4PP1 A;  1IWD A;  3CH2 X;  5K16 A;  4CDE B;  3QSD A;  1KFX L;  5JA7 A;  4FJC A;  1MDW A;  2XU4 A;  4YYU A;  1E2T A;  3BOW A;  4FIP A;  3H7D A;  4QBB A;  1ZCM A;  1YAL A;  3D9W A;  3S3R A;  1AYW A;  3M99 A;  1PPN A;  1CTE A;  3CH3 X;  1STF E;  4XUI A;  2DC7 A;  1TLO A;  4BPV A;  2VFB A;  1AU3 A;  1KHQ A;  4K7C A;  1QDQ A;  3ZUA A;  4BS6 A;  2R9C A;  3IMA A;  1BP4 A;  1BQI A;  3PNR A;  3U8E A;  3V6C A;  4GUZ A;  4BQV A;  3QT4 A;  1YVB A;  2Y6E A;  4FK5 A;  4X6J A;  1GMY A;  2IBI A;  3MHH A;  4P6E A;  2E00 A;  4X6H A;  1W5R A;  1KXR A;  1M6D A;  2NQD B;  4HWY A;  1NLJ A;  4N8W A;  3KSE A;  2R9O A;  3IOQ A;  2Y5B A;  4BS5 A;  4P6G A;  2HD5 A;  3K24 A;  3AI8 A;  3QJ3 A;  5J94 A;  1AU0 A;  1W6F A;  6PAD A;  1F2B A;  1CPJ A;  3KX1 A;  2FRQ A;  2H7J A;  2YJB A;  1AYV A;  2BDL A;  3N4C A;  2CIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...