5KO3A

Structure of a core papain-like protease of mers coronavirus with utility for structure-based drug design
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
257
structure length
255
Chain Sequence
DETKALKELYGPVDPTFLRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a
publication title X-ray Structure and Enzymatic Activity Profile of a Core Papain-like Protease of MERS Coronavirus with utility for structure-based drug design.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 71
structure length 255
sequence length 257
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5ko3A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ko3A02
4OVZA 4M0WA 4OW0A 4RF1A 5KO3A 4P16A 5E6JA 3MP2A 4OVZB 2FE8A 4PT5A 3E9SA 4REZA 4WURA 4MM3B 4R3DA 4RNAA 4RF0A 3MJ5A
chains in the Genus database with same CATH superfamily
5EP4A 2LVOC 3BB7A 4GIPA 4HWYA 3FUWA 3OISA 4OEMA 3ILKA 3DFZA 1GLNA 4FCTA 3PHUA 2OOBA 1U9WA 1G59A 2KA6B 4MZSA 3PHWA 1IY1A 2QBYA 1N75A 4FIPA 3KSJA 5FSWA 3HKPA 1GJTA 3HZJA 4JI0M 2LHGA 2VIIA 1C7YA 4MGKE 1HNZM 4DR3M 2YJ2A 3KW6A 4IBGA 3LQQA 3U6SA 2MROB 1U9QX 1XNQM 3A42A 2AHMA 3FTEA 3LVWA 1AU4A 1XC8A 1HQYE 2ERCA 1KFXL 3IECA 3A98B 4DV3M 8CATA 1NLJA 2JZ0A 1N34M 1AYWA 2FNAA 4GH9A 4LJ8A 4AXMA 2IPPB 1TU6A 3PNYA 3O0UA 1O0EA 3IFUA 3LCVB 2JQGR 3P5UA 1NO1A 4PADA 2C99A 2DVWB 2BJWA 2GNOA 1IN8A 4CDDB 2XU3A 1NVMA 1EWPA 2D7EA 4QOSA 4BOPA 2C98A 1CJLA 2KZUA 4L8RC 4MSXA 4OELA 3HHAA 2P5TA 1MU5A 4XBOA 4LF8M 1XXHB 1E9SA 4IBKA 1MS6A 3HU3A 1V33A 1HT2E 1G8PA 4YV8A 1J09A 1DKIA 1R4GA 1NB5A 1OTRA 2KHHA 1N36M 3QAUA 2RRUA 1KYIA 4KLNA 3CBJA 4L16A 1KXRA 3SHFA 2R4EA 1QZMA 1QDQA 3SYKA 4DUYM 1L2DA 2L2DA 2HWJA 1CUKA 3IG5A 4KT0F 3OTOM 2DZYA 2G8EA 1OAIA 3K8UA 4P16A 4I81A 1GABA 7CATA 2YJBA 5E6JA 3GO8A 2WSFF 2HD5A 5EQTA 3VKGA 1ITOA 4I4LA 4LRSA 3U60B 2JQFR 2CFOA 3W0LB 3IUTA 3U6OA 2BU3A 1U9VA 3I04M 3SMSA 4G4OA 3TNXA 3N4CA 1A5TA 3I01M 2E02A 3C9PA 3SARA 3OQCA 2NQAA 3MORA 1BY8A 3FUUA 2APLA 4IBCA 4M0DA 3C58A 2AYNA 1IXSB 2VHSA 3KP1E 1QMYA 3KP0E 4NC6A 4XUIA 4EIWA 1OKSA 1NNJA 3GPPA 3RVXA 3GLIA 3PFIA 2DZLA 2GQFA 2ATOA 1U5IA 2LH0A 1KFVA 2P86A 1QAMA 1QDRA 3MK6A 2DKLA 3RE8A 1CV8A 2HHNA 3TMPA 2DZNB 4QNMA 3KOXE 4JV5M 3THGA 1JB0F 2FS1A 4G4RA 3TWLA 2AS8A 4B7HA 2WZJA 4PP1A 2V1UA 2OPFA 4BOQA 2DAMA 3GLGB 1EE8A 2M60A 1UFZA 2L6OA 5FTLA 3RVVA 2WSCF 2F5QA 4MGHA 4K7CA 2FOIC 5EP2A 1HJPA 3BC3A 4JI7M 3ZNHA 4HEOA 3I51A 5EXTA 2G8LA 2HXZA 4QBBA 4BB9A 2K9DA 3BCNA 5FTJA 2JTCA 1IQPA 3FRHA 3BOSA 1NY6A 4L15A 3SAUA 4G3OA 3FYCA 1UM8A 2R6FA 2DAGA 1PE6A 3F92A 3GLFB 4GITA 3OF8A 2Y21A 1W5SA 1PRBA 3GLHB 2XH9A 1ORYB 2ARYA 2P0RA 3K8ZA 2JUJA 5ITXE 2XGNA 2KEBA 2BTWB 2VF7A 2AIMA 1HNWM 1A6RA 2AVWA 2KZSA 1AYVA 4DV6M 4OX9M 1QUTA 4DV5M 4Z6YA 3W0FA 4S12A 1GJSA 2G5GX 3GLIE 3D8LA 4NSRA 5FPWA 4DMYA 3QJ3A 4BOUA 2XU5A 3B79A 2OOAA 2DHRA 4GUAA 1PM5A 2K6BA 5PADA 4X66M 2CE7A 2QCUA 3UMMA 1AYUA 2QQ8A 3PDFA 2MR9A 1BGOA 4I07A 5A24A 3R8FA 4LJ6A 1GKIA 2KNAA 1NY5A 2XZFA 1QUSA 3A45A 1CPJA 3GRUA 1EWOA 4PDIA 1V34A 4NSOB 4X6IA 2XFSA 1TH3A 5FLXS 1ME3A 3SATA 1L2BA 3TRKA 1TTEA 2DWZB 1KHPA 1OAOC 3AJIB 2UXBM 3U6DA 4QRGA 1S4VA 3QYEA 1U9XA 2DCCA 3HHXA 5FTKA 2AGAA 2KDLA 4BLCA 4LFAM 3C0RA 2LXEA 2ZBKB 1KFUL 1VJVA 1R2YA 3PNRA 2C5RA 3W68A 3CTWB 1MIRA 1HUCB 1IY2A 2DZOB 3KVWA 3U6QA 2FUDA 4KLBA 2GFOA 2Z4SA 1IN6A 3QSDA 2YJ8A 4GMQA 4L78A 3U5ZA 1QXPA 2KRUA 4NL4H 5L8RF 2PADA 1T6OA 2Z4RA 3L29A 2DWNA 2Z7JA 4XZXA 2DJGB 3BBAA 3N3GA 2AYOA 2O5RA 2LWXA 1PJSA 4RF0A 2F5OA 5KPTA 1TF0B 4I5SA 1IBKM 2Y0TA 1F2AA 4GHAA 5CHTA 2DNAA 4B3SM 4LRTA 1HT1E 4W4UA 4YVAA 2R6NA 4YYQA 3KOZE 2PBHA 4YYUA 1YT7A 3WHKA 1NB3A 4PI3A 2C9CA 4XK8F 3WXEA 1AECA 5ITUA 1XKGA 1DGGA 4D8BA 3WHLA 2UU9M 1YZBA 4DV4M 3KFUG 5A2QS 9PAPA 4D80A 3CGWA 2DCBA 4CZWA 1F2CA 3TE6A 3MMPA 3CF0A 2EKFA 3M0EA 2Y6EA 1XB2B 3JR5A 4RNAA 2XF3A 2DZZA 7PCKA 3MTVA 8PCHA 4BPVA 3T1YM 2ZM6M 3QT4A 3CF6E 3W30A 3B7NA 2JZ1A 2XU1A 4B3MM 3U6PA 3MHHA 2DOSA 2JY7A 2CIOA 1R2ZA 2DHYA 1Q02A 1R6BX 1GCBA 3KOYE 1BP4A 2RGOA 5JI3E 2WBFX 2NQ8C 3EIEA 4OVZB 4XGIA 2XSZD 1D2NA 2GHUA 2CRUA 1OFIA 1H6UA 1D0KA 2PREA 4AG6A 2PNSA 5CVMA 1F2BA 3ZUAA 2UZJA 4RKXA 3T15A 1IBMM 3DZDA 3BY4A 4IP3A 4IJFA 5LMUM 3J7BA 5H37D 3J27B 2LHCA 2YR0A 1STFE 2F4VM 3GQ3A 1OJLA 2XFTA 4CJ6A 1WJ7A 1DGBA 2HWKA 2FQ9A 4IIWA 3HD3A 4MGYE 3ZCBB 3WXGA 1FNNA 4L4UA 2JNHA 4AG5A 3I4YA 4FWGA 4AKIA 3M99A 2BWBA 2R46A 1GMYA 3VDUA 3U61A 4LGYA 4X62M 2O6XA 1ATKA 3C3DA 3MHSA 2YQZA 1QDTA 3M6AA 3AOEC 1YALA 1GO5A 3RNVA 4DR2M 1SXJB 4CDFB 3GPUA 2FO5A 1NJFA 4M9ZA 1AU3A 2F1GA 3KSXA 3H4JA 1PPOA 3U8EA 4CGYB 4FWHA 4JXJA 3H7DA 1EWMA 5EZSA 4LF9M 2DC7A 1CTEA 4M9SA 1HR0M 3R9XB 4KHPM 4A3VB 3B7ZA 3W67A 1VEGA 3LXSA 4DR1M 4N8WA 2HKJA 4NRWA 4R3DA 2YJCA 4GRIA 4FW9A 3HHIA 1L2CA 2EO2A 1NL6A 1KSFX 2DWLA 1FH0A 3CF2A 2KNVA 3SAVA 5EP1A 3JR4A 3IV2A 2LNHC 4N4ZA 4W5CA 2DC8A 1YSYA 3D8BA 3PHXA 1TGUA 3PRPA 4ANRA 2YNMD 5ITXA 5FTNA 4LJ5A 2HAKA 3HU1A 5IREB 4DR6M 2R9CA 3K92A 4OW0A 2D7GA 4LG2A 2BNKA 1JR3D 1LV7A 3VFDA 4WA6A 3J2PB 2L4FA 3GPYA 4MGZE 3BWKA 3ZH9B 2ZAOA 1GLOA 1PPPA 3SFZA 1QVRA 3GCBA 1Z5BA 3SBJA 4R71A 1ZIVA 1ZAEA 5ITTA 3KWBX 3E9SA 1TH4A 3TWMA 1KHQA 3K24A 2UUCM 1IY0A 2DI0A 2C96A 3J7AS 2DC9A 4MGIE 1J5EM 3LQRA 1R7RA 3E46A 3SMPA 1PCIA 2EKKA 2R9MA 3BXWA 2XSZA 1MJGM 2QZ4A 4JI2M 3BBZA 1P3QQ 4AW4A 5C1BA 1IM2A 3BPFA 1NSFA 2DXIA 3D6SA 2C9OA 2JXNA 1CSBB 4RKUF 2OQ4A 1QAOA 3HWNA 5EGWA 2E01A 3AOEA 4X6JA 2V1CA 1IXZA 2FRQA 3OF9A 1NNUC 5DYIA 3HJQA 3H6SA 4AI6A 1BVSA 3GQ5A 1DGHB 2Y5BA 2VF8A 3U5ZB 2V6ZM 4GHLA 3PNVA 3U60A 1VQ1A 1Z5AA 1EF7A 3K9MA 3VLFB 2JP7A 4AZFA 1PIPA 2LBCA 3KXEC 2FRAA 3I4VA 4D8IA 1TL9A 4RF1A 2CHGA 4QHSA 5EF4A 1WHCA 4AKHA 4MI7A 2LTUA 4DUZM 3FE3A 4IBJA 4B7FA 2R18A 2CV2A 1ZMWA 1CVZA 3RFWA 4P17A 3PVSA 4HLQA 3B7QA 4LJ9A 1XXHE 2HCBA 2B1NA 5KQDA 3KOWE 1PADA 3CH2X 2XZUA 2YFQA 4MH0E 1XWIA 1F29A 2CHQA 1GVNA 2UUAM 2JY8A 1AIPC 5CHVA 2X8AA 3HU2A 2NQGA 1XMOM 5FTMA 4LJAA 3B21A 2I7PA 3NBXX 4YYVA 3U6MA 1IN7A 2KRKA 3CBKA 3DOAA 4OU7A 1VG5A 4QH6A 3GLGA 1QQWA 4PT5A 5BR8M 2K0BX 1OFHA 2R0IA 3C9EA 2HL7A 1XMQM 4G4QA 4YYSA 4ZTBA 5IZ7D 2CV1A 1UKFA 5CVNB 2DENA 4R7GA 2LVPC 2G7YA 4LGMA 4I05A 1IWDA 2DJFB 1DF0A 2OULA 4LZZA 2YJ9A 3W31A 1NV8A 2P7UA 2QBYB 1G71A 1JR3A 2UXDM 4W5BA 5EJCA 3V6EA 3GLHA 2B3TA 4ZPXA 3KDSE 2BTWA 4M9XA 3GPXA 1WGNA 4AXLA 1DGFA 4GEWA 1IFYA 1E32A 2E5LM 3FD9A 4AKGA 1Z59A 1YE9A 1WXQA 3P5VA 4Q8GA 1GL7A 4LJ4A 4WW0A 4HL4A 3VDPA 4HXDB 3FUTA 3K2LA 3AKZA 2QHOB 2BDLA 3HX3A 1ZMVA 4FCWA 1Q39A 2AU1A 1E94E 3UJNA 5ITYA 3UGJA 1PJIA 2EUCA 2AUXA 3GLGE 2G6DA 3GQ4A 2B1MA 1TLOA 4D8EA 1YLAA 1N78A 4WP2A 4NXNM 1QAQA 5LMNM 3TL4X 1MHWA 1QZEA 4NXMM 4ZUXU 3CH3X 1IN5A 1MEGA 1J7KA 1HQCA 3IEJA 2KW0A 2QPAA 4NRVA 3C3EA 3E4RA 1JR3E 2F7DA 4II7A 1L8QA 5JI2E 4FWDA 1MDWA 3GLHE 1N77A 1YVBA 1DO0A 3RVWA 3TQSA 2IBIA 3MJ5A 5K16A 3F75A 2VHFA 3VKHA 4B7GA 3ZC7B 2JA2A 3GRRA 4G54A 4L6V6 5KPRA 1VEJA 3TWKA 4X65M 4CISA 1XHBA 1I4WA 4YYWA 3HJ8A 2DCAA 2JWSA 2F5PA 1EWLA 1SXJD 1QANA 1K82A 2HHHM 1T43A 5JA7A 5DFLA 2J7QC 4DBGB 3RGPA 1Q3CA 4REZA 3TPZA 4I8OA 4JN6A 3K1JA 3SC3A 2I7NA 3V6CA 3FUXA 3T6PA 6PADA 3HGIA 5J94A 4GKKM 2DC6A 3RGSA 3LW5F 4LF5M 3IMAA 1WGLA 3KKUA 4QNRA 3I3TA 4FD2A 4BQVA 3IHPA 2QP9X 3AI8A 3E21A 2EA0A 2J7OA 1Z6TA 4X6HA 4LJ7A 1IXRC 3MTNA 1POPA 1Q3BA 4JI5M 4YYRA 3GLIB 1PJQA 2LVAA 3FUVA 1F4IA 1TDHA 1LTMA 3A46A 2UUBM 1SXJC 3PW3A 1L1ZA 1Y8GA 3PBHA 5ITQA 2BWEA 2H5XA 1CB5A 4B08A 2E03A 4UN2B 4MM3B 3S3RA 2R9NA 2L7HA 4DV7M 3HHWA 3B9PA 3O1GA 2OZ2A 1AUAA 1RU3A 2MGWA 1GECE 1MN3A 2D7HA 2ZTCA 3HHZA 3L2AA 3NHEA 4F1IA 4IBFA 3AL0C 4JI4M 3FTDA 3DA1A 3P5XA 3OVXA 2NQIA 3HJSA 4GKJM 3GRVA 2DAIA 3IOQA 3O65A 4BOSA 1PJJA 3L27A 1QOLA 3B74A 2CV0A 3J80S 1DV0A 2R4JA 3B89A 5KQ8A 2R9FA 1S3SA 4N79A 3UZUA 5JH3A 4OVZA 4DR7M 1L1TA 2Y20A 3PT2A 3P5WA 2E00A 2OO9A 3SHGB 5E26A 1NHWC 1PXVA 4IBEA 3K9OA 3VK8A 4WURA 4BS5A 4D81A 5GKNA 3HWSA 2M5ZA 2BJVA 2DAKA 1Q6KA 1GL6A 4LF6M 3FTCA 1TH2A 3MP2A 2DAEA 4IBDA 2AUZA 1W5TA 1AIMA 2J7QA 2W82A 3AFHA 1G41A 3KS4A 1BQIA 3PXGA 4FK5A 3KSEA 2CEAA 2OP3A 5C18A 4CHTB 1SNKA 1Z5CA 4JI6M 1PPNA 3L28A 4LFBM 5F02A 3K9PA 1YUBA 1Y08A 4I04A 4DV2M 2JY6B 1XXHA 3FYDA 3Q8GA 1EIJA 2MH8A 3DF0A 2RKOA 4DV1M 1X9YA 3KWZA 2O01F 4LF4M 4Q8HA 3KW9A 3NBIA 1HNXM 1TR8A 1ME4A 5ITRA 4JYAM 3KX1A 3ZQJA 1SXJA 4W5WA 1VEKA 5IT9S 1NJGA 3EIHA 1PBHA 2O25A 2CUZA 2G8JA 1PVJA 3KS8A 4BSQA 2A5YB 4CIZA 1AU0A 4QRVA 4IJEA 4MB7A 4GC5A 4Y28F 4B3TM 2MJ5B 2HH5A 2JRIA 2R44A 2VQEM 1IN4A 2ZANA 4LY6A 3JAMS 2Z84A 2XU4A 4NOOB 1ZQ9A 4XR7A 4IUMA 3USVA 1TDZA 1N32M 1NHGC 1XNRM 3LCUA 4AQYM 2X49A 5EP3A 1E9RA 2DWMA 4QOZC 1NV9A 1NPZA 4CDCB 2C0YA 3LFYA 2L7IA 4BBAA 1T3TA 4BS6A 1M6DA 3H8CA 1SG9A 1QYRA 1Y4HA 2ACTA 1CS8A 1VDLA 1IXSA 3QWLA 4G6ZA 1K3XA 3SAWA 2FFJA 4D82A 1WIVA 4FVMA 1EFUB 2JY5A 4QHTA 2VQFM 1SP4B 1ZMUA 2QENA 2NQDB 4LZJA 2FH0A 1D0MA 4YY3M 4B3RM 1DO2A 1C1KA 3WXFA 3MHVC 2DCDA 1SXJE 5EXPA 3S3QA 1YK7A 4DV0M 2WSEF 1ZCMA 2BDZA 2F5NA 5DNYA 3BPMA 2CB5A 3H89A 3Q8XA 2H7JA 2CHVA 3AOGA 3BOWA 4DR4M 1OIPA 1ZV1A 2H1RA 2R45A 4LCBA 4JI3M 1ICFA 1VDDA 3HHYA 1YK8A 3OVZA 3IG8A 1NQCA 2R65A 1R5LA 1VSNA 1PJTA 4FCVA 3NWLA 1N33M 4IBBA 4LF7M 3FKEA 4RY2A 5JZEA 4CDEB 3FTFA 1PGYA 4KODA 2QNJA 4F2LA 3SASA 2F5SA 2FTDA 2Z8YM 4TUWA 3KFQA 1IBLM 2Q2EB 3H8BA 4JI8M 3L26A 4IBIA 3M7GA 2XLJA 3GLFA 2FT2A 4MZOA 1G4AE 2X4AA 2J5YA 2FE8A 1DGHA 4PP2E 2L4EA 3U6EA 4DMXA 3L25A 4PDGA 1MEMA 1K3BB 2RGHA 4LFCM 3PRMA 4FJCA 2VDBB 2G3QA 1FJGM 2FYEA 4P6GA 5F3WA 2LVNC 5EZQA 2Y0QA 5CVOB 2Z3XA 1PPDA 1OIZA 4BOZA 4X64M 5DYGA 3SYLA 2ZTDA 3GP1A 4KO8A 4PCZA 2KXEA 2CP8A 1AU2A 3V76A 3E1ZB 3T1HM 4YHHM 4JI1M 1MX0A 5EXSA 4A5UA 4G4NA 4ITQA 3UK6A 2EJSA 1X37A 2N35A 1K3WA 2CWBA 1WR1B 4Z8XA 1CQDA 1JQPA 1THEA 4Q7JA 3AV0A 3I06A 2QSFX 4M0WA 4P6EA 3PSEA 2KNZA 3H4MA 3F5VA 1G3IA 3VK7A 3U6LA 3J81S 2XEPA 3HY5A 2J7NA 2ZAMA 5BPVA 1DEUA 1OQYA 3N3KA 3GRYA 3T38A 3U61B 1V92A 3LVVA 4PD2A 5EXXA 5KO3A 2UXCM 4GC9A 3U6CA 1I94M 2R9OA 5KPZA 3QYBA 2K47A 4DR5M 3GLFE 5IWAM 3ERVA 2L09A 4QRXA 2R62A 1D0LA 3FRIA 3LMMA 4K0KM 2LVQD 1JQJC
chains in the Genus database with same CATH topology
1QAOA 3CTWB 5EP4A 3HJSA 4GKJM 1IY2A 3AOEA 3BB7A 2DZOB 2V1CA 4GIPA 3GRVA 1IXZA 3KVWA 3U6QA 3FUWA 3O65A 2Z4SA 1IN6A 1PJJA 4BOSA 3L27A 2CV0A 1NNUC 5DYIA 3HJQA 3DFZA 1GLNA 3ILKA 4FCTA 3PHUA 1G59A 3J80S 2KA6B 4AI6A 2R4JA 4GMQA 3PHWA 4L78A 5KQ8A 3U5ZA 2KRUA 1IY1A 2QBYA 1S3SA 1N75A 4NL4H 3GQ5A 3KSJA 3UZUA 5FSWA 3HKPA 1DGHB 4JI0M 4OVZA 2Z4RA 3U5ZB 3L29A 2V6ZM 4DR7M 2DWNA 4GHLA 2VIIA 1L1TA 4MGKE 2Z7JA 3PNVA 3U60A 1HNZM 1Z5AA 2Y20A 4DR3M 3PT2A 3KW6A 4IBGA 3LQQA 3U6SA 3SHGB 4XZXA 5E26A 3VLFB 1NHWC 1XNQM 4IBEA 3A42A 2AHMA 3VK8A 3FTEA 3LVWA 4WURA 4AZFA 4D81A 5GKNA 3BBAA 3HWSA 1XC8A 1HQYE 2M5ZA 3KXEC 2BJVA 2O5RA 3I4VA 2LWXA 4RF0A 2F5OA 5KPTA 2ERCA 4I5SA 4D8IA 1IBKM 1GL6A 3A98B 4LF6M 2Y0TA 4DV3M 8CATA 3FTCA 4GHAA 4RF1A 2CHGA 4QHSA 4AKHA 1TH2A 4MI7A 4DUZM 4IBJA 4B7FA 2R18A 3MP2A 1N34M 4IBDA 2CV2A 2FNAA 4GH9A 4LJ8A 4B3SM 1W5TA 3RFWA 4LRTA 3PNYA 2J7QA 1HT1E 2W82A 3AFHA 1G41A 3KS4A 3PXGA 3PVSA 4HLQA 3IFUA 4LJ9A 2CEAA 3KOZE 2C99A 5C18A 2DVWB 2HCBA 4CHTB 3WHKA 5KQDA 2BJWA 1Z5CA 4JI6M 3KOWE 2C9CA 3L28A 4LFBM 2XZUA 2YFQA 1IN8A 5ITUA 1YUBA 1NVMA 2D7EA 4QOSA 4MH0E 4BOPA 1XWIA 1DGGA 4D8BA 3WHLA 2CHQA 1GVNA 2UUAM 2UU9M 2C98A 1YZBA 4DV4M 2KZUA 4DV2M 3KFUG 5A2QS 4L8RC 2X8AA 3HU2A 1XXHA 3FYDA 1XMOM 5FTMA 4LJAA 3B21A 4D80A 2P5TA 2I7PA 1MU5A 4XBOA 3U6MA 2RKOA 4DV1M 1IN7A 2KRKA 4LF8M 1XXHB 3DOAA 4LF4M 1E9SA 4IBKA 4OU7A 3NBIA 3GLGA 1HNXM 3TE6A 3HU3A 5ITRA 4JYAM 1QQWA 1HT2E 3CF0A 4PT5A 3M0EA 5BR8M 1G8PA 1SXJA 4W5WA 1OFHA 1J09A 3JR5A 5IT9S 4RNAA 2HL7A 1DKIA 1NJGA 3EIHA 1XMQM 2XF3A 4G4QA 2CUZA 3MTVA 1PVJA 3KS8A 1N36M 2A5YB 3QAUA 4ZTBA 3T1YM 1KYIA 4KLNA 5IZ7D 2ZM6M 3CF6E 4L16A 2CV1A 1UKFA 3W30A 4IJEA 4MB7A 3SHFA 2R4EA 4GC5A 1QZMA 4R7GA 3SYKA 4B3TM 4LGMA 4DUYM 2JRIA 2VQEM 4B3MM 1IN4A 2ZANA 3U6PA 1L2DA 2DOSA 4LY6A 3JAMS 4LZZA 2Z84A 3W31A 1R2ZA 3IG5A 4NOOB 1ZQ9A 3OTOM 1R6BX 4IUMA 1TDZA 3KOYE 2QBYB 2RGOA 1JR3A 5JI3E 4P16A 1N32M 4I81A 2UXDM 1NHGC 1XNRM 5EJCA 7CATA 2NQ8C 3EIEA 5E6JA 4OVZB 4XGIA 3GLHA 2XSZD 1D2NA 3GO8A 5EQTA 3VKGA 1OFIA 4AQYM 2X49A 4I4LA 4ZPXA 4LRSA 3U60B 3KDSE 2BTWA 5EP3A 4M9XA 3GPXA 1E9RA 1H6UA 1DGFA 2DWMA 2CFOA 3W0LB 3U6OA 4QOZC 1E32A 2E5LM 3FD9A 4AG6A 2BU3A 4AKGA 1Z59A 3SMSA 1YE9A 1WXQA 4G4OA 2L7IA 4BBAA 1T3TA 3T15A 2UZJA 1GL7A 4RKXA 1IBMM 3SARA 3DZDA 4LJ4A 3BY4A 1QYRA 3OQCA 4WW0A 4IP3A 4HL4A 3QWLA 4IJFA 4G6ZA 3FUUA 4IBCA 4M0DA 3VDPA 5LMUM 3J7BA 1K3XA 5H37D 3SAWA 3J27B 2YR0A 2FFJA 4HXDB 3C58A 3FUTA 1IXSB 4D82A 3K2LA 3AKZA 2F4VM 4FVMA 3KP1E 3GQ3A 1OJLA 3KP0E 4QHTA 2XFTA 4EIWA 2VQFM 4FCWA 1Q39A 1NNJA 2QENA 1E94E 3GPPA 3UJNA 5ITYA 3UGJA 1PJIA 1DGBA 4LZJA 2HWKA 2EUCA 3GLIA 4IIWA 3GQ4A 4YY3M 3PFIA 4B3RM 4MGYE 1DO2A 2LH0A 3ZCBB 1C1KA 1KFVA 3MHVC 1FNNA 1SXJE 1QAMA 4L4UA 5EXPA 3MK6A 3RE8A 3TMPA 4AG5A 4D8EA 1N78A 4DV0M 2DZNB 3I4YA 4QNMA 3KOXE 4FWGA 4JV5M 3THGA 4NXNM 1QAQA 4AKIA 2F5NA 5DNYA 5LMNM 4G4RA 3TL4X 2R46A 3TWLA 3VDUA 3Q8XA 4B7HA 2CHVA 3U61A 3AOGA 4LGYA 4X62M 2V1UA 2OPFA 4DR4M 4BOQA 4NXMM 2H1RA 2YQZA 1EE8A 3GLGB 1IN5A 2R45A 3AOEC 3M6AA 4LCBA 2M60A 2L6OA 4JI3M 5FTLA 3RNVA 1VDDA 1SXJB 3HHYA 4DR2M 3GPUA 3IG8A 1J7KA 1HQCA 2F5QA 1NJFA 4M9ZA 3KSXA 2KW0A 4MGHA 2QPAA 4NRVA 2R65A 2FOIC 3E4RA 5EP2A 4CGYB 4FCVA 4II7A 3NWLA 1N33M 4IBBA 4FWHA 1L8QA 4LF7M 5JI2E 4FWDA 3FKEA 4JI7M 3ZNHA 5EXTA 3I51A 5JZEA 2G8LA 4JXJA 4BB9A 3FTFA 1N77A 5EZSA 4KODA 1DO0A 4LF9M 3SASA 3TQSA 5FTJA 3MJ5A 2F5SA 4M9SA 2JTCA 1IQPA 1HR0M 3VKHA 4TUWA 3BOSA 4B7GA 1NY6A 3ZC7B 4L15A 3SAUA 3R9XB 2JA2A 1IBLM 2Q2EB 4KHPM 3FYCA 4A3VB 3GRRA 4JI8M 3L26A 4IBIA 3M7GA 1UM8A 5KPRA 2XLJA 3GLFA 1G4AE 2X4AA 2FE8A 1DGHA 3TWKA 4X65M 4CISA 4DR1M 1XHBA 2HKJA 4NRWA 1I4WA 3HJ8A 4R3DA 2F5PA 3GLFB 1SXJD 4GITA 4GRIA 3U6EA 2Y21A 1W5SA 3L25A 1QANA 1K82A 3GLHB 2XH9A 4PDGA 4FW9A 1L2CA 2EO2A 1ORYB 2RGHA 3K8ZA 5ITXE 4LFCM 2XGNA 3PRMA 1KSFX 2HHHM 2KEBA 2DWLA 3CF2A 2BTWB 1HNWM 1FJGM 2KZSA 3SAVA 2J7QC 5EP1A 4DV6M 4OX9M 5F3WA 3JR4A 2LNHC 4Z6YA 4DV5M 3RGPA 5EZQA 2Y0QA 1Q3CA 3W0FA 4REZA 2Z3XA 3TPZA 4I8OA 4JN6A 4S12A 1YSYA 4BOZA 3D8BA 3PHXA 1TGUA 3K1JA 2G5GX 4X64M 5DYGA 3D8LA 4NSRA 3SC3A 3PRPA 2I7NA 2YNMD 3SYLA 5ITXA 5FTNA 4PCZA 4KO8A 4LJ5A 3GP1A 2KXEA 3HU1A 3FUXA 5IREB 3HGIA 4DR6M 4BOUA 3K92A 4GKKM 4OW0A 3RGSA 4LF5M 3T1HM 4YHHM 2DHRA 4JI1M 2D7GA 1MX0A 4LG2A 4QNRA 4GUAA 2BNKA 4FD2A 5EXSA 1JR3D 4A5UA 2QP9X 4G4NA 4ITQA 3UK6A 1PM5A 1LV7A 2EA0A 3VFDA 4X66M 2J7OA 1Z6TA 2CE7A 2QCUA 3J2PB 3UMMA 3GPYA 1X37A 4LJ7A 4MGZE 1K3WA 1IXRC 3ZH9B 2ZAOA 1Q3BA 4Z8XA 4JI5M 3GLIB 3AV0A 3SFZA 3FUVA 4M0WA 1QVRA 1Z5BA 1TDHA 3SBJA 3PSEA 3A46A 4LJ6A 3R8FA 1GKIA 1NY5A 2UUBM 1SXJC 2XZFA 1ZAEA 3H4MA 3A45A 1L1ZA 5ITTA 1G3IA 3E9SA 3GRUA 1TH4A 3VK7A 5ITQA 3TWMA 3U6LA 4B08A 4PDIA 4MM3B 4NSOB 2XFSA 2UUCM 1TH3A 3J81S 2L7HA 1IY0A 2XEPA 5FLXS 2J7NA 2ZAMA 2C96A 5BPVA 3J7AS 3SATA 4MGIE 3GRYA 4DV7M 3HHWA 1J5EM 3LQRA 3T38A 3U61B 3B9PA 1R7RA 3LVVA 3SMPA 1L2BA 3TRKA 4PD2A 2DWZB 5EXXA 3AJIB 5KO3A 2UXBM 3U6DA 2XSZA 2UXCM 2D7HA 4GC9A 3U6CA 3HHZA 1I94M 3HHXA 2QZ4A 5KPZA 4JI2M 3L2AA 4AW4A 5FTKA 2AGAA 4BLCA 2K47A 4LFAM 5C1BA 1IM2A 4DR5M 5IWAM 4IBFA 3C0RA 2L09A 3AL0C 2LXEA 2R62A 2ZBKB 1NSFA 4JI4M 3LMMA 2DXIA 4K0KM 2C9OA 3FTDA 1R2YA 1JQJC 3DA1A 2OQ4A 2C5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVZ A;  4M0W A;  4OW0 A;  4RF1 A;  5KO3 A;  4P16 A;  5E6J A;  3MP2 A;  4OVZ B;  2FE8 A;  4PT5 A;  3E9S A;  4REZ A;  4WUR A;  4MM3 B;  4R3D A;  4RNA A;  4RF0 A;  3MJ5 A; 
#chains in the Genus database with same CATH topology
 5EP4 A;  2LVO C;  3BB7 A;  4GIP A;  4HWY A;  3FUW A;  3OIS A;  4OEM A;  3ILK A;  3DFZ A;  1GLN A;  4FCT A;  3PHU A;  2OOB A;  1U9W A;  1G59 A;  2KA6 B;  4MZS A;  3PHW A;  1IY1 A;  2QBY A;  1N75 A;  4FIP A;  3KSJ A;  5FSW A;  3HKP A;  1GJT A;  3HZJ A;  4JI0 M;  2LHG A;  2VII A;  1C7Y A;  4MGK E;  1HNZ M;  4DR3 M;  2YJ2 A;  3KW6 A;  4IBG A;  3LQQ A;  3U6S A;  2MRO B;  1U9Q X;  1XNQ M;  3A42 A;  2AHM A;  3FTE A;  3LVW A;  1AU4 A;  1XC8 A;  1HQY E;  2ERC A;  1KFX L;  3IEC A;  3A98 B;  4DV3 M;  8CAT A;  1NLJ A;  2JZ0 A;  1N34 M;  1AYW A;  2FNA A;  4GH9 A;  4LJ8 A;  4AXM A;  2IPP B;  1TU6 A;  3PNY A;  3O0U A;  1O0E A;  3IFU A;  3LCV B;  2JQG R;  3P5U A;  1NO1 A;  4PAD A;  2C99 A;  2DVW B;  2BJW A;  2GNO A;  1IN8 A;  4CDD B;  2XU3 A;  1NVM A;  1EWP A;  2D7E A;  4QOS A;  4BOP A;  2C98 A;  1CJL A;  2KZU A;  4L8R C;  4MSX A;  4OEL A;  3HHA A;  2P5T A;  1MU5 A;  4XBO A;  4LF8 M;  1XXH B;  1E9S A;  4IBK A;  1MS6 A;  3HU3 A;  1V33 A;  1HT2 E;  1G8P A;  4YV8 A;  1J09 A;  1DKI A;  1R4G A;  1NB5 A;  1OTR A;  2KHH A;  1N36 M;  3QAU A;  2RRU A;  1KYI A;  4KLN A;  3CBJ A;  4L16 A;  1KXR A;  3SHF A;  2R4E A;  1QZM A;  1QDQ A;  3SYK A;  4DUY M;  1L2D A;  2L2D A;  2HWJ A;  1CUK A;  3IG5 A;  4KT0 F;  3OTO M;  2DZY A;  2G8E A;  1OAI A;  3K8U A;  4P16 A;  4I81 A;  1GAB A;  7CAT A;  2YJB A;  5E6J A;  3GO8 A;  2WSF F;  2HD5 A;  5EQT A;  3VKG A;  1ITO A;  4I4L A;  4LRS A;  3U60 B;  2JQF R;  2CFO A;  3W0L B;  3IUT A;  3U6O A;  2BU3 A;  1U9V A;  3I04 M;  3SMS A;  4G4O A;  3TNX A;  3N4C A;  1A5T A;  3I01 M;  2E02 A;  3C9P A;  3SAR A;  3OQC A;  2NQA A;  3MOR A;  1BY8 A;  3FUU A;  2APL A;  4IBC A;  4M0D A;  3C58 A;  2AYN A;  1IXS B;  2VHS A;  3KP1 E;  1QMY A;  3KP0 E;  4NC6 A;  4XUI A;  4EIW A;  1OKS A;  1NNJ A;  3GPP A;  3RVX A;  3GLI A;  3PFI A;  2DZL A;  2GQF A;  2ATO A;  1U5I A;  2LH0 A;  1KFV A;  2P86 A;  1QAM A;  1QDR A;  3MK6 A;  2DKL A;  3RE8 A;  1CV8 A;  2HHN A;  3TMP A;  2DZN B;  4QNM A;  3KOX E;  4JV5 M;  3THG A;  1JB0 F;  2FS1 A;  4G4R A;  3TWL A;  2AS8 A;  4B7H A;  2WZJ A;  4PP1 A;  2V1U A;  2OPF A;  4BOQ A;  2DAM A;  3GLG B;  1EE8 A;  2M60 A;  1UFZ A;  2L6O A;  5FTL A;  3RVV A;  2WSC F;  2F5Q A;  4MGH A;  4K7C A;  2FOI C;  5EP2 A;  1HJP A;  3BC3 A;  4JI7 M;  3ZNH A;  4HEO A;  3I51 A;  5EXT A;  2G8L A;  2HXZ A;  4QBB A;  4BB9 A;  2K9D A;  3BCN A;  5FTJ A;  2JTC A;  1IQP A;  3FRH A;  3BOS A;  1NY6 A;  4L15 A;  3SAU A;  4G3O A;  3FYC A;  1UM8 A;  2R6F A;  2DAG A;  1PE6 A;  3F92 A;  3GLF B;  4GIT A;  3OF8 A;  2Y21 A;  1W5S A;  1PRB A;  3GLH B;  2XH9 A;  1ORY B;  2ARY A;  2P0R A;  3K8Z A;  2JUJ A;  5ITX E;  2XGN A;  2KEB A;  2BTW B;  2VF7 A;  2AIM A;  1HNW M;  1A6R A;  2AVW A;  2KZS A;  1AYV A;  4DV6 M;  4OX9 M;  1QUT A;  4DV5 M;  4Z6Y A;  3W0F A;  4S12 A;  1GJS A;  2G5G X;  3GLI E;  3D8L A;  4NSR A;  5FPW A;  4DMY A;  3QJ3 A;  4BOU A;  2XU5 A;  3B79 A;  2OOA A;  2DHR A;  4GUA A;  1PM5 A;  2K6B A;  5PAD A;  4X66 M;  2CE7 A;  2QCU A;  3UMM A;  1AYU A;  2QQ8 A;  3PDF A;  2MR9 A;  1BGO A;  4I07 A;  5A24 A;  3R8F A;  4LJ6 A;  1GKI A;  2KNA A;  1NY5 A;  2XZF A;  1QUS A;  3A45 A;  1CPJ A;  3GRU A;  1EWO A;  4PDI A;  1V34 A;  4NSO B;  4X6I A;  2XFS A;  1TH3 A;  5FLX S;  1ME3 A;  3SAT A;  1L2B A;  3TRK A;  1TTE A;  2DWZ B;  1KHP A;  1OAO C;  3AJI B;  2UXB M;  3U6D A;  4QRG A;  1S4V A;  3QYE A;  1U9X A;  2DCC A;  3HHX A;  5FTK A;  2AGA A;  2KDL A;  4BLC A;  4LFA M;  3C0R A;  2LXE A;  2ZBK B;  1KFU L;  1VJV A;  1R2Y A;  3PNR A;  2C5R A;  3W68 A;  3CTW B;  1MIR A;  1HUC B;  1IY2 A;  2DZO B;  3KVW A;  3U6Q A;  2FUD A;  4KLB A;  2GFO A;  2Z4S A;  1IN6 A;  3QSD A;  2YJ8 A;  4GMQ A;  4L78 A;  3U5Z A;  1QXP A;  2KRU A;  4NL4 H;  5L8R F;  2PAD A;  1T6O A;  2Z4R A;  3L29 A;  2DWN A;  2Z7J A;  4XZX A;  2DJG B;  3BBA A;  3N3G A;  2AYO A;  2O5R A;  2LWX A;  1PJS A;  4RF0 A;  2F5O A;  5KPT A;  1TF0 B;  4I5S A;  1IBK M;  2Y0T A;  1F2A A;  4GHA A;  5CHT A;  2DNA A;  4B3S M;  4LRT A;  1HT1 E;  4W4U A;  4YVA A;  2R6N A;  4YYQ A;  3KOZ E;  2PBH A;  4YYU A;  1YT7 A;  3WHK A;  1NB3 A;  4PI3 A;  2C9C A;  4XK8 F;  3WXE A;  1AEC A;  5ITU A;  1XKG A;  1DGG A;  4D8B A;  3WHL A;  2UU9 M;  1YZB A;  4DV4 M;  3KFU G;  5A2Q S;  9PAP A;  4D80 A;  3CGW A;  2DCB A;  4CZW A;  1F2C A;  3TE6 A;  3MMP A;  3CF0 A;  2EKF A;  3M0E A;  2Y6E A;  1XB2 B;  3JR5 A;  4RNA A;  2XF3 A;  2DZZ A;  7PCK A;  3MTV A;  8PCH A;  4BPV A;  3T1Y M;  2ZM6 M;  3QT4 A;  3CF6 E;  3W30 A;  3B7N A;  2JZ1 A;  2XU1 A;  4B3M M;  3U6P A;  3MHH A;  2DOS A;  2JY7 A;  2CIO A;  1R2Z A;  2DHY A;  1Q02 A;  1R6B X;  1GCB A;  3KOY E;  1BP4 A;  2RGO A;  5JI3 E;  2WBF X;  2NQ8 C;  3EIE A;  4OVZ B;  4XGI A;  2XSZ D;  1D2N A;  2GHU A;  2CRU A;  1OFI A;  1H6U A;  1D0K A;  2PRE A;  4AG6 A;  2PNS A;  5CVM A;  1F2B A;  3ZUA A;  2UZJ A;  4RKX A;  3T15 A;  1IBM M;  3DZD A;  3BY4 A;  4IP3 A;  4IJF A;  5LMU M;  3J7B A;  5H37 D;  3J27 B;  2LHC A;  2YR0 A;  1STF E;  2F4V M;  3GQ3 A;  1OJL A;  2XFT A;  4CJ6 A;  1WJ7 A;  1DGB A;  2HWK A;  2FQ9 A;  4IIW A;  3HD3 A;  4MGY E;  3ZCB B;  3WXG A;  1FNN A;  4L4U A;  2JNH A;  4AG5 A;  3I4Y A;  4FWG A;  4AKI A;  3M99 A;  2BWB A;  2R46 A;  1GMY A;  3VDU A;  3U61 A;  4LGY A;  4X62 M;  2O6X A;  1ATK A;  3C3D A;  3MHS A;  2YQZ A;  1QDT A;  3M6A A;  3AOE C;  1YAL A;  1GO5 A;  3RNV A;  4DR2 M;  1SXJ B;  4CDF B;  3GPU A;  2FO5 A;  1NJF A;  4M9Z A;  1AU3 A;  2F1G A;  3KSX A;  3H4J A;  1PPO A;  3U8E A;  4CGY B;  4FWH A;  4JXJ A;  3H7D A;  1EWM A;  5EZS A;  4LF9 M;  2DC7 A;  1CTE A;  4M9S A;  1HR0 M;  3R9X B;  4KHP M;  4A3V B;  3B7Z A;  3W67 A;  1VEG A;  3LXS A;  4DR1 M;  4N8W A;  2HKJ A;  4NRW A;  4R3D A;  2YJC A;  4GRI A;  4FW9 A;  3HHI A;  1L2C A;  2EO2 A;  1NL6 A;  1KSF X;  2DWL A;  1FH0 A;  3CF2 A;  2KNV A;  3SAV A;  5EP1 A;  3JR4 A;  3IV2 A;  2LNH C;  4N4Z A;  4W5C A;  2DC8 A;  1YSY A;  3D8B A;  3PHX A;  1TGU A;  3PRP A;  4ANR A;  2YNM D;  5ITX A;  5FTN A;  4LJ5 A;  2HAK A;  3HU1 A;  5IRE B;  4DR6 M;  2R9C A;  3K92 A;  4OW0 A;  2D7G A;  4LG2 A;  2BNK A;  1JR3 D;  1LV7 A;  3VFD A;  4WA6 A;  3J2P B;  2L4F A;  3GPY A;  4MGZ E;  3BWK A;  3ZH9 B;  2ZAO A;  1GLO A;  1PPP A;  3SFZ A;  1QVR A;  3GCB A;  1Z5B A;  3SBJ A;  4R71 A;  1ZIV A;  1ZAE A;  5ITT A;  3KWB X;  3E9S A;  1TH4 A;  3TWM A;  1KHQ A;  3K24 A;  2UUC M;  1IY0 A;  2DI0 A;  2C96 A;  3J7A S;  2DC9 A;  4MGI E;  1J5E M;  3LQR A;  1R7R A;  3E46 A;  3SMP A;  1PCI A;  2EKK A;  2R9M A;  3BXW A;  2XSZ A;  1MJG M;  2QZ4 A;  4JI2 M;  3BBZ A;  1P3Q Q;  4AW4 A;  5C1B A;  1IM2 A;  3BPF A;  1NSF A;  2DXI A;  3D6S A;  2C9O A;  2JXN A;  1CSB B;  4RKU F;  2OQ4 A;  1QAO A;  3HWN A;  5EGW A;  2E01 A;  3AOE A;  4X6J A;  2V1C A;  1IXZ A;  2FRQ A;  3OF9 A;  1NNU C;  5DYI A;  3HJQ A;  3H6S A;  4AI6 A;  1BVS A;  3GQ5 A;  1DGH B;  2Y5B A;  2VF8 A;  3U5Z B;  2V6Z M;  4GHL A;  3PNV A;  3U60 A;  1VQ1 A;  1Z5A A;  1EF7 A;  3K9M A;  3VLF B;  2JP7 A;  4AZF A;  1PIP A;  2LBC A;  3KXE C;  2FRA A;  3I4V A;  4D8I A;  1TL9 A;  4RF1 A;  2CHG A;  4QHS A;  5EF4 A;  1WHC A;  4AKH A;  4MI7 A;  2LTU A;  4DUZ M;  3FE3 A;  4IBJ A;  4B7F A;  2R18 A;  2CV2 A;  1ZMW A;  1CVZ A;  3RFW A;  4P17 A;  3PVS A;  4HLQ A;  3B7Q A;  4LJ9 A;  1XXH E;  2HCB A;  2B1N A;  5KQD A;  3KOW E;  1PAD A;  3CH2 X;  2XZU A;  2YFQ A;  4MH0 E;  1XWI A;  1F29 A;  2CHQ A;  1GVN A;  2UUA M;  2JY8 A;  1AIP C;  5CHV A;  2X8A A;  3HU2 A;  2NQG A;  1XMO M;  5FTM A;  4LJA A;  3B21 A;  2I7P A;  3NBX X;  4YYV A;  3U6M A;  1IN7 A;  2KRK A;  3CBK A;  3DOA A;  4OU7 A;  1VG5 A;  4QH6 A;  3GLG A;  1QQW A;  4PT5 A;  5BR8 M;  2K0B X;  1OFH A;  2R0I A;  3C9E A;  2HL7 A;  1XMQ M;  4G4Q A;  4YYS A;  4ZTB A;  5IZ7 D;  2CV1 A;  1UKF A;  5CVN B;  2DEN A;  4R7G A;  2LVP C;  2G7Y A;  4LGM A;  4I05 A;  1IWD A;  2DJF B;  1DF0 A;  2OUL A;  4LZZ A;  2YJ9 A;  3W31 A;  1NV8 A;  2P7U A;  2QBY B;  1G71 A;  1JR3 A;  2UXD M;  4W5B A;  5EJC A;  3V6E A;  3GLH A;  2B3T A;  4ZPX A;  3KDS E;  2BTW A;  4M9X A;  3GPX A;  1WGN A;  4AXL A;  1DGF A;  4GEW A;  1IFY A;  1E32 A;  2E5L M;  3FD9 A;  4AKG A;  1Z59 A;  1YE9 A;  1WXQ A;  3P5V A;  4Q8G A;  1GL7 A;  4LJ4 A;  4WW0 A;  4HL4 A;  3VDP A;  4HXD B;  3FUT A;  3K2L A;  3AKZ A;  2QHO B;  2BDL A;  3HX3 A;  1ZMV A;  4FCW A;  1Q39 A;  2AU1 A;  1E94 E;  3UJN A;  5ITY A;  3UGJ A;  1PJI A;  2EUC A;  2AUX A;  3GLG E;  2G6D A;  3GQ4 A;  2B1M A;  1TLO A;  4D8E A;  1YLA A;  1N78 A;  4WP2 A;  4NXN M;  1QAQ A;  5LMN M;  3TL4 X;  1MHW A;  1QZE A;  4NXM M;  4ZUX U;  3CH3 X;  1IN5 A;  1MEG A;  1J7K A;  1HQC A;  3IEJ A;  2KW0 A;  2QPA A;  4NRV A;  3C3E A;  3E4R A;  1JR3 E;  2F7D A;  4II7 A;  1L8Q A;  5JI2 E;  4FWD A;  1MDW A;  3GLH E;  1N77 A;  1YVB A;  1DO0 A;  3RVW A;  3TQS A;  2IBI A;  3MJ5 A;  5K16 A;  3F75 A;  2VHF A;  3VKH A;  4B7G A;  3ZC7 B;  2JA2 A;  3GRR A;  4G54 A;  4L6V 6;  5KPR A;  1VEJ A;  3TWK A;  4X65 M;  4CIS A;  1XHB A;  1I4W A;  4YYW A;  3HJ8 A;  2DCA A;  2JWS A;  2F5P A;  1EWL A;  1SXJ D;  1QAN A;  1K82 A;  2HHH M;  1T43 A;  5JA7 A;  5DFL A;  2J7Q C;  4DBG B;  3RGP A;  1Q3C A;  4REZ A;  3TPZ A;  4I8O A;  4JN6 A;  3K1J A;  3SC3 A;  2I7N A;  3V6C A;  3FUX A;  3T6P A;  6PAD A;  3HGI A;  5J94 A;  4GKK M;  2DC6 A;  3RGS A;  3LW5 F;  4LF5 M;  3IMA A;  1WGL A;  3KKU A;  4QNR A;  3I3T A;  4FD2 A;  4BQV A;  3IHP A;  2QP9 X;  3AI8 A;  3E21 A;  2EA0 A;  2J7O A;  1Z6T A;  4X6H A;  4LJ7 A;  1IXR C;  3MTN A;  1POP A;  1Q3B A;  4JI5 M;  4YYR A;  3GLI B;  1PJQ A;  2LVA A;  3FUV A;  1F4I A;  1TDH A;  1LTM A;  3A46 A;  2UUB M;  1SXJ C;  3PW3 A;  1L1Z A;  1Y8G A;  3PBH A;  5ITQ A;  2BWE A;  2H5X A;  1CB5 A;  4B08 A;  2E03 A;  4UN2 B;  4MM3 B;  3S3R A;  2R9N A;  2L7H A;  4DV7 M;  3HHW A;  3B9P A;  3O1G A;  2OZ2 A;  1AUA A;  1RU3 A;  2MGW A;  1GEC E;  1MN3 A;  2D7H A;  2ZTC A;  3HHZ A;  3L2A A;  3NHE A;  4F1I A;  4IBF A;  3AL0 C;  4JI4 M;  3FTD A;  3DA1 A;  3P5X A;  3OVX A;  2NQI A;  3HJS A;  4GKJ M;  3GRV A;  2DAI A;  3IOQ A;  3O65 A;  4BOS A;  1PJJ A;  3L27 A;  1QOL A;  3B74 A;  2CV0 A;  3J80 S;  1DV0 A;  2R4J A;  3B89 A;  5KQ8 A;  2R9F A;  1S3S A;  4N79 A;  3UZU A;  5JH3 A;  4OVZ A;  4DR7 M;  1L1T A;  2Y20 A;  3PT2 A;  3P5W A;  2E00 A;  2OO9 A;  3SHG B;  5E26 A;  1NHW C;  1PXV A;  4IBE A;  3K9O A;  3VK8 A;  4WUR A;  4BS5 A;  4D81 A;  5GKN A;  3HWS A;  2M5Z A;  2BJV A;  2DAK A;  1Q6K A;  1GL6 A;  4LF6 M;  3FTC A;  1TH2 A;  3MP2 A;  2DAE A;  4IBD A;  2AUZ A;  1W5T A;  1AIM A;  2J7Q A;  2W82 A;  3AFH A;  1G41 A;  3KS4 A;  1BQI A;  3PXG A;  4FK5 A;  3KSE A;  2CEA A;  2OP3 A;  5C18 A;  4CHT B;  1SNK A;  1Z5C A;  4JI6 M;  1PPN A;  3L28 A;  4LFB M;  5F02 A;  3K9P A;  1YUB A;  1Y08 A;  4I04 A;  4DV2 M;  2JY6 B;  1XXH A;  3FYD A;  3Q8G A;  1EIJ A;  2MH8 A;  3DF0 A;  2RKO A;  4DV1 M;  1X9Y A;  3KWZ A;  2O01 F;  4LF4 M;  4Q8H A;  3KW9 A;  3NBI A;  1HNX M;  1TR8 A;  1ME4 A;  5ITR A;  4JYA M;  3KX1 A;  3ZQJ A;  1SXJ A;  4W5W A;  1VEK A;  5IT9 S;  1NJG A;  3EIH A;  1PBH A;  2O25 A;  2CUZ A;  2G8J A;  1PVJ A;  3KS8 A;  4BSQ A;  2A5Y B;  4CIZ A;  1AU0 A;  4QRV A;  4IJE A;  4MB7 A;  4GC5 A;  4Y28 F;  4B3T M;  2MJ5 B;  2HH5 A;  2JRI A;  2R44 A;  2VQE M;  1IN4 A;  2ZAN A;  4LY6 A;  3JAM S;  2Z84 A;  2XU4 A;  4NOO B;  1ZQ9 A;  4XR7 A;  4IUM A;  3USV A;  1TDZ A;  1N32 M;  1NHG C;  1XNR M;  3LCU A;  4AQY M;  2X49 A;  5EP3 A;  1E9R A;  2DWM A;  4QOZ C;  1NV9 A;  1NPZ A;  4CDC B;  2C0Y A;  3LFY A;  2L7I A;  4BBA A;  1T3T A;  4BS6 A;  1M6D A;  3H8C A;  1SG9 A;  1QYR A;  1Y4H A;  2ACT A;  1CS8 A;  1VDL A;  1IXS A;  3QWL A;  4G6Z A;  1K3X A;  3SAW A;  2FFJ A;  4D82 A;  1WIV A;  4FVM A;  1EFU B;  2JY5 A;  4QHT A;  2VQF M;  1SP4 B;  1ZMU A;  2QEN A;  2NQD B;  4LZJ A;  2FH0 A;  1D0M A;  4YY3 M;  4B3R M;  1DO2 A;  1C1K A;  3WXF A;  3MHV C;  2DCD A;  1SXJ E;  5EXP A;  3S3Q A;  1YK7 A;  4DV0 M;  2WSE F;  1ZCM A;  2BDZ A;  2F5N A;  5DNY A;  3BPM A;  2CB5 A;  3H89 A;  3Q8X A;  2H7J A;  2CHV A;  3AOG A;  3BOW A;  4DR4 M;  1OIP A;  1ZV1 A;  2H1R A;  2R45 A;  4LCB A;  4JI3 M;  1ICF A;  1VDD A;  3HHY A;  1YK8 A;  3OVZ A;  3IG8 A;  1NQC A;  2R65 A;  1R5L A;  1VSN A;  1PJT A;  4FCV A;  3NWL A;  1N33 M;  4IBB A;  4LF7 M;  3FKE A;  4RY2 A;  5JZE A;  4CDE B;  3FTF A;  1PGY A;  4KOD A;  2QNJ A;  4F2L A;  3SAS A;  2F5S A;  2FTD A;  2Z8Y M;  4TUW A;  3KFQ A;  1IBL M;  2Q2E B;  3H8B A;  4JI8 M;  3L26 A;  4IBI A;  3M7G A;  2XLJ A;  3GLF A;  2FT2 A;  4MZO A;  1G4A E;  2X4A A;  2J5Y A;  2FE8 A;  1DGH A;  4PP2 E;  2L4E A;  3U6E A;  4DMX A;  3L25 A;  4PDG A;  1MEM A;  1K3B B;  2RGH A;  4LFC M;  3PRM A;  4FJC A;  2VDB B;  2G3Q A;  1FJG M;  2FYE A;  4P6G A;  5F3W A;  2LVN C;  5EZQ A;  2Y0Q A;  5CVO B;  2Z3X A;  1PPD A;  1OIZ A;  4BOZ A;  4X64 M;  5DYG A;  3SYL A;  2ZTD A;  3GP1 A;  4KO8 A;  4PCZ A;  2KXE A;  2CP8 A;  1AU2 A;  3V76 A;  3E1Z B;  3T1H M;  4YHH M;  4JI1 M;  1MX0 A;  5EXS A;  4A5U A;  4G4N A;  4ITQ A;  3UK6 A;  2EJS A;  1X37 A;  2N35 A;  1K3W A;  2CWB A;  1WR1 B;  4Z8X A;  1CQD A;  1JQP A;  1THE A;  4Q7J A;  3AV0 A;  3I06 A;  2QSF X;  4M0W A;  4P6E A;  3PSE A;  2KNZ A;  3H4M A;  3F5V A;  1G3I A;  3VK7 A;  3U6L A;  3J81 S;  2XEP A;  3HY5 A;  2J7N A;  2ZAM A;  5BPV A;  1DEU A;  1OQY A;  3N3K A;  3GRY A;  3T38 A;  3U61 B;  1V92 A;  3LVV A;  4PD2 A;  5EXX A;  5KO3 A;  2UXC M;  4GC9 A;  3U6C A;  1I94 M;  2R9O A;  5KPZ A;  3QYB A;  2K47 A;  4DR5 M;  3GLF E;  5IWA M;  3ERV A;  2L09 A;  4QRX A;  2R62 A;  1D0L A;  3FRI A;  3LMM A;  4K0K M;  2LVQ D;  1JQJ C; 
#chains in the Genus database with same CATH homology
 1QAO A;  3CTW B;  5EP4 A;  3HJS A;  4GKJ M;  1IY2 A;  3AOE A;  3BB7 A;  2DZO B;  2V1C A;  4GIP A;  3GRV A;  1IXZ A;  3KVW A;  3U6Q A;  3FUW A;  3O65 A;  2Z4S A;  1IN6 A;  1PJJ A;  4BOS A;  3L27 A;  2CV0 A;  1NNU C;  5DYI A;  3HJQ A;  3DFZ A;  1GLN A;  3ILK A;  4FCT A;  3PHU A;  1G59 A;  3J80 S;  2KA6 B;  4AI6 A;  2R4J A;  4GMQ A;  3PHW A;  4L78 A;  5KQ8 A;  3U5Z A;  2KRU A;  1IY1 A;  2QBY A;  1S3S A;  1N75 A;  4NL4 H;  3GQ5 A;  3KSJ A;  3UZU A;  5FSW A;  3HKP A;  1DGH B;  4JI0 M;  4OVZ A;  2Z4R A;  3U5Z B;  3L29 A;  2V6Z M;  4DR7 M;  2DWN A;  4GHL A;  2VII A;  1L1T A;  4MGK E;  2Z7J A;  3PNV A;  3U60 A;  1HNZ M;  1Z5A A;  2Y20 A;  4DR3 M;  3PT2 A;  3KW6 A;  4IBG A;  3LQQ A;  3U6S A;  3SHG B;  4XZX A;  5E26 A;  3VLF B;  1NHW C;  1XNQ M;  4IBE A;  3A42 A;  2AHM A;  3VK8 A;  3FTE A;  3LVW A;  4WUR A;  4AZF A;  4D81 A;  5GKN A;  3BBA A;  3HWS A;  1XC8 A;  1HQY E;  2M5Z A;  3KXE C;  2BJV A;  2O5R A;  3I4V A;  2LWX A;  4RF0 A;  2F5O A;  5KPT A;  2ERC A;  4I5S A;  4D8I A;  1IBK M;  1GL6 A;  3A98 B;  4LF6 M;  2Y0T A;  4DV3 M;  8CAT A;  3FTC A;  4GHA A;  4RF1 A;  2CHG A;  4QHS A;  4AKH A;  1TH2 A;  4MI7 A;  4DUZ M;  4IBJ A;  4B7F A;  2R18 A;  3MP2 A;  1N34 M;  4IBD A;  2CV2 A;  2FNA A;  4GH9 A;  4LJ8 A;  4B3S M;  1W5T A;  3RFW A;  4LRT A;  3PNY A;  2J7Q A;  1HT1 E;  2W82 A;  3AFH A;  1G41 A;  3KS4 A;  3PXG A;  3PVS A;  4HLQ A;  3IFU A;  4LJ9 A;  2CEA A;  3KOZ E;  2C99 A;  5C18 A;  2DVW B;  2HCB A;  4CHT B;  3WHK A;  5KQD A;  2BJW A;  1Z5C A;  4JI6 M;  3KOW E;  2C9C A;  3L28 A;  4LFB M;  2XZU A;  2YFQ A;  1IN8 A;  5ITU A;  1YUB A;  1NVM A;  2D7E A;  4QOS A;  4MH0 E;  4BOP A;  1XWI A;  1DGG A;  4D8B A;  3WHL A;  2CHQ A;  1GVN A;  2UUA M;  2UU9 M;  2C98 A;  1YZB A;  4DV4 M;  2KZU A;  4DV2 M;  3KFU G;  5A2Q S;  4L8R C;  2X8A A;  3HU2 A;  1XXH A;  3FYD A;  1XMO M;  5FTM A;  4LJA A;  3B21 A;  4D80 A;  2P5T A;  2I7P A;  1MU5 A;  4XBO A;  3U6M A;  2RKO A;  4DV1 M;  1IN7 A;  2KRK A;  4LF8 M;  1XXH B;  3DOA A;  4LF4 M;  1E9S A;  4IBK A;  4OU7 A;  3NBI A;  3GLG A;  1HNX M;  3TE6 A;  3HU3 A;  5ITR A;  4JYA M;  1QQW A;  1HT2 E;  3CF0 A;  4PT5 A;  3M0E A;  5BR8 M;  1G8P A;  1SXJ A;  4W5W A;  1OFH A;  1J09 A;  3JR5 A;  5IT9 S;  4RNA A;  2HL7 A;  1DKI A;  1NJG A;  3EIH A;  1XMQ M;  2XF3 A;  4G4Q A;  2CUZ A;  3MTV A;  1PVJ A;  3KS8 A;  1N36 M;  2A5Y B;  3QAU A;  4ZTB A;  3T1Y M;  1KYI A;  4KLN A;  5IZ7 D;  2ZM6 M;  3CF6 E;  4L16 A;  2CV1 A;  1UKF A;  3W30 A;  4IJE A;  4MB7 A;  3SHF A;  2R4E A;  4GC5 A;  1QZM A;  4R7G A;  3SYK A;  4B3T M;  4LGM A;  4DUY M;  2JRI A;  2VQE M;  4B3M M;  1IN4 A;  2ZAN A;  3U6P A;  1L2D A;  2DOS A;  4LY6 A;  3JAM S;  4LZZ A;  2Z84 A;  3W31 A;  1R2Z A;  3IG5 A;  4NOO B;  1ZQ9 A;  3OTO M;  1R6B X;  4IUM A;  1TDZ A;  3KOY E;  2QBY B;  2RGO A;  1JR3 A;  5JI3 E;  4P16 A;  1N32 M;  4I81 A;  2UXD M;  1NHG C;  1XNR M;  5EJC A;  7CAT A;  2NQ8 C;  3EIE A;  5E6J A;  4OVZ B;  4XGI A;  3GLH A;  2XSZ D;  1D2N A;  3GO8 A;  5EQT A;  3VKG A;  1OFI A;  4AQY M;  2X49 A;  4I4L A;  4ZPX A;  4LRS A;  3U60 B;  3KDS E;  2BTW A;  5EP3 A;  4M9X A;  3GPX A;  1E9R A;  1H6U A;  1DGF A;  2DWM A;  2CFO A;  3W0L B;  3U6O A;  4QOZ C;  1E32 A;  2E5L M;  3FD9 A;  4AG6 A;  2BU3 A;  4AKG A;  1Z59 A;  3SMS A;  1YE9 A;  1WXQ A;  4G4O A;  2L7I A;  4BBA A;  1T3T A;  3T15 A;  2UZJ A;  1GL7 A;  4RKX A;  1IBM M;  3SAR A;  3DZD A;  4LJ4 A;  3BY4 A;  1QYR A;  3OQC A;  4WW0 A;  4IP3 A;  4HL4 A;  3QWL A;  4IJF A;  4G6Z A;  3FUU A;  4IBC A;  4M0D A;  3VDP A;  5LMU M;  3J7B A;  1K3X A;  5H37 D;  3SAW A;  3J27 B;  2YR0 A;  2FFJ A;  4HXD B;  3C58 A;  3FUT A;  1IXS B;  4D82 A;  3K2L A;  3AKZ A;  2F4V M;  4FVM A;  3KP1 E;  3GQ3 A;  1OJL A;  3KP0 E;  4QHT A;  2XFT A;  4EIW A;  2VQF M;  4FCW A;  1Q39 A;  1NNJ A;  2QEN A;  1E94 E;  3GPP A;  3UJN A;  5ITY A;  3UGJ A;  1PJI A;  1DGB A;  4LZJ A;  2HWK A;  2EUC A;  3GLI A;  4IIW A;  3GQ4 A;  4YY3 M;  3PFI A;  4B3R M;  4MGY E;  1DO2 A;  2LH0 A;  3ZCB B;  1C1K A;  1KFV A;  3MHV C;  1FNN A;  1SXJ E;  1QAM A;  4L4U A;  5EXP A;  3MK6 A;  3RE8 A;  3TMP A;  4AG5 A;  4D8E A;  1N78 A;  4DV0 M;  2DZN B;  3I4Y A;  4QNM A;  3KOX E;  4FWG A;  4JV5 M;  3THG A;  4NXN M;  1QAQ A;  4AKI A;  2F5N A;  5DNY A;  5LMN M;  4G4R A;  3TL4 X;  2R46 A;  3TWL A;  3VDU A;  3Q8X A;  4B7H A;  2CHV A;  3U61 A;  3AOG A;  4LGY A;  4X62 M;  2V1U A;  2OPF A;  4DR4 M;  4BOQ A;  4NXM M;  2H1R A;  2YQZ A;  1EE8 A;  3GLG B;  1IN5 A;  2R45 A;  3AOE C;  3M6A A;  4LCB A;  2M60 A;  2L6O A;  4JI3 M;  5FTL A;  3RNV A;  1VDD A;  1SXJ B;  3HHY A;  4DR2 M;  3GPU A;  3IG8 A;  1J7K A;  1HQC A;  2F5Q A;  1NJF A;  4M9Z A;  3KSX A;  2KW0 A;  4MGH A;  2QPA A;  4NRV A;  2R65 A;  2FOI C;  3E4R A;  5EP2 A;  4CGY B;  4FCV A;  4II7 A;  3NWL A;  1N33 M;  4IBB A;  4FWH A;  1L8Q A;  4LF7 M;  5JI2 E;  4FWD A;  3FKE A;  4JI7 M;  3ZNH A;  5EXT A;  3I51 A;  5JZE A;  2G8L A;  4JXJ A;  4BB9 A;  3FTF A;  1N77 A;  5EZS A;  4KOD A;  1DO0 A;  4LF9 M;  3SAS A;  3TQS A;  5FTJ A;  3MJ5 A;  2F5S A;  4M9S A;  2JTC A;  1IQP A;  1HR0 M;  3VKH A;  4TUW A;  3BOS A;  4B7G A;  1NY6 A;  3ZC7 B;  4L15 A;  3SAU A;  3R9X B;  2JA2 A;  1IBL M;  2Q2E B;  4KHP M;  3FYC A;  4A3V B;  3GRR A;  4JI8 M;  3L26 A;  4IBI A;  3M7G A;  1UM8 A;  5KPR A;  2XLJ A;  3GLF A;  1G4A E;  2X4A A;  2FE8 A;  1DGH A;  3TWK A;  4X65 M;  4CIS A;  4DR1 M;  1XHB A;  2HKJ A;  4NRW A;  1I4W A;  3HJ8 A;  4R3D A;  2F5P A;  3GLF B;  1SXJ D;  4GIT A;  4GRI A;  3U6E A;  2Y21 A;  1W5S A;  3L25 A;  1QAN A;  1K82 A;  3GLH B;  2XH9 A;  4PDG A;  4FW9 A;  1L2C A;  2EO2 A;  1ORY B;  2RGH A;  3K8Z A;  5ITX E;  4LFC M;  2XGN A;  3PRM A;  1KSF X;  2HHH M;  2KEB A;  2DWL A;  3CF2 A;  2BTW B;  1HNW M;  1FJG M;  2KZS A;  3SAV A;  2J7Q C;  5EP1 A;  4DV6 M;  4OX9 M;  5F3W A;  3JR4 A;  2LNH C;  4Z6Y A;  4DV5 M;  3RGP A;  5EZQ A;  2Y0Q A;  1Q3C A;  3W0F A;  4REZ A;  2Z3X A;  3TPZ A;  4I8O A;  4JN6 A;  4S12 A;  1YSY A;  4BOZ A;  3D8B A;  3PHX A;  1TGU A;  3K1J A;  2G5G X;  4X64 M;  5DYG A;  3D8L A;  4NSR A;  3SC3 A;  3PRP A;  2I7N A;  2YNM D;  3SYL A;  5ITX A;  5FTN A;  4PCZ A;  4KO8 A;  4LJ5 A;  3GP1 A;  2KXE A;  3HU1 A;  3FUX A;  5IRE B;  3HGI A;  4DR6 M;  4BOU A;  3K92 A;  4GKK M;  4OW0 A;  3RGS A;  4LF5 M;  3T1H M;  4YHH M;  2DHR A;  4JI1 M;  2D7G A;  1MX0 A;  4LG2 A;  4QNR A;  4GUA A;  2BNK A;  4FD2 A;  5EXS A;  1JR3 D;  4A5U A;  2QP9 X;  4G4N A;  4ITQ A;  3UK6 A;  1PM5 A;  1LV7 A;  2EA0 A;  3VFD A;  4X66 M;  2J7O A;  1Z6T A;  2CE7 A;  2QCU A;  3J2P B;  3UMM A;  3GPY A;  1X37 A;  4LJ7 A;  4MGZ E;  1K3W A;  1IXR C;  3ZH9 B;  2ZAO A;  1Q3B A;  4Z8X A;  4JI5 M;  3GLI B;  3AV0 A;  3SFZ A;  3FUV A;  4M0W A;  1QVR A;  1Z5B A;  1TDH A;  3SBJ A;  3PSE A;  3A46 A;  4LJ6 A;  3R8F A;  1GKI A;  1NY5 A;  2UUB M;  1SXJ C;  2XZF A;  1ZAE A;  3H4M A;  3A45 A;  1L1Z A;  5ITT A;  1G3I A;  3E9S A;  3GRU A;  1TH4 A;  3VK7 A;  5ITQ A;  3TWM A;  3U6L A;  4B08 A;  4PDI A;  4MM3 B;  4NSO B;  2XFS A;  2UUC M;  1TH3 A;  3J81 S;  2L7H A;  1IY0 A;  2XEP A;  5FLX S;  2J7N A;  2ZAM A;  2C96 A;  5BPV A;  3J7A S;  3SAT A;  4MGI E;  3GRY A;  4DV7 M;  3HHW A;  1J5E M;  3LQR A;  3T38 A;  3U61 B;  3B9P A;  1R7R A;  3LVV A;  3SMP A;  1L2B A;  3TRK A;  4PD2 A;  2DWZ B;  5EXX A;  3AJI B;  5KO3 A;  2UXB M;  3U6D A;  2XSZ A;  2UXC M;  2D7H A;  4GC9 A;  3U6C A;  3HHZ A;  1I94 M;  3HHX A;  2QZ4 A;  5KPZ A;  4JI2 M;  3L2A A;  4AW4 A;  5FTK A;  2AGA A;  4BLC A;  2K47 A;  4LFA M;  5C1B A;  1IM2 A;  4DR5 M;  5IWA M;  4IBF A;  3C0R A;  2L09 A;  3AL0 C;  2LXE A;  2R62 A;  2ZBK B;  1NSF A;  4JI4 M;  3LMM A;  2DXI A;  4K0K M;  2C9O A;  3FTD A;  1R2Y A;  1JQJ C;  3DA1 A;  2OQ4 A;  2C5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...