5KO3A

Structure of a core papain-like protease of mers coronavirus with utility for structure-based drug design
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
257
structure length
255
Chain Sequence
b'DETKALKELYGPVDPTFLRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a
publication title X-ray Structure and Enzymatic Activity Profile of a Core Papain-like Protease of MERS Coronavirus with utility for structure-based drug design.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 71
structure length 255
sequence length 257
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5ko3A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ko3A02
4M0WA 3E9SA 4MM3B 4P16A 2FE8A 3MJ5A 4PT5A 4WURA 4R3DA 5E6JA 4RNAA 4OVZA 4REZA 4OW0A 3MP2A 4RF0A 5KO3A 4RF1A 4OVZB
chains in the Genus database with same CATH superfamily
1QMYA 1G41A 1XC8A 4P16A 4LJ6A 2DWNA 4IJFA 3GPUA 2XU4A 2Z7JA 3J27B 3E1ZB 4QNRA 1R5LA 2CRUA 2P5TA 3WXEA 3RE8A 1SXJB 2F5OA 3ZNHA 5IZ7D 1HQYE 4DUZM 3K8UA 2WZJA 3L27A 1EE8A 1DO2A 3HY5A 4TUWA 3GP1A 3OISA 3L29A 3GLFA 2AS8A 2R46A 4IBEA 1AYWA 1Z59A 1X9YA 3MTNA 4JI6M 4Y28F 4CGYB 2DC9A 4CJ6A 2DCAA 1PCIA 1CTEA 1YUBA 1L1TA 1FNNA 2C9CA 3AL0C 4GRIA 4N8WA 1ZQ9A 3S3RA 5IT9S 2EKFA 4MZOA 1KHPA 5JZEA 5EXSA 2DWZB 3F92A 3V6EA 1NVMA 4QHSA 1YLAA 1MDWA 4JN6A 3VDPA 1QUSA 1IBLM 4YYWA 2VQFM 3PSEA 1R2YA 1MHWA 2DAGA 3ZUAA 1MX0A 1TR8A 1YK7A 1RU3A 1GL7A 1TH2A 3JR4A 2HHHM 4I04A 1YVBA 4X64M 2ZBKB 2JRIA 3CBJA 2KA6B 1PBHA 2R62A 1PE6A 3LVWA 5C18A 2OULA 1EWMA 4NRVA 2PBHA 3LXSA 1R4GA 1H6UA 2FQ9A 5FTKA 3GPYA 4D8IA 2WBFX 1MU5A 4IBIA 3GO8A 1D2NA 2K47A 3PHUA 1VDDA 2OQ4A 2BWBA 4A3VB 1SNKA 3M7GA 5EJCA 4MGKE 4MGHA 2Y20A 3PXGA 2DWLA 4K0KM 2WSEF 2KXEA 2LHGA 1GJTA 2J7QC 3PT2A 1IY2A 1TH4A 2HWKA 4DV7M 1TDZA 3FKEA 1AU3A 1NY5A 4KT0F 2R6FA 1XHBA 5ITRA 4DV5M 1OKSA 2CHQA 2DJFB 4II7A 2YJCA 3B7NA 2CFOA 1AECA 2V6ZM 4AW4A 4GC5A 1WXQA 4LRTA 4FW9A 4GH9A 3P5VA 3TQSA 1VDLA 2E01A 1NJFA 8PCHA 2KNZA 2ZAOA 2LVOC 1NHGC 3QSDA 4JI3M 4LG2A 5EP3A 3IG8A 4YYSA 3PNVA 2O5RA 1T6OA 2CHGA 4NC6A 3HHWA 4ZUXU 2NQAA 3T1HM 3BBZA 3I51A 2R0IA 3UJNA 4JI5M 1K3XA 3K9OA 3VDUA 1BGOA 3D8BA 4R3DA 3K9MA 3F5VA 1GO5A 2L09A 4XGIA 1IN5A 5ITQA 3VKGA 2L6OA 3AKZA 3GQ4A 2QQ8A 1CQDA 4XBOA 3VK7A 3Q8GA 4GKKM 1EIJA 5PADA 2FTDA 3BWKA 4PP2E 2CP8A 1ITOA 4DV6M 2VHSA 1Z5BA 3J7BA 4G4QA 4B3MM 3RGSA 3AV0A 4B08A 4LF7M 2XF3A 3BPFA 5CHVA 3VKHA 2XGNA 3DFZA 3SC3A 3SBJA 3E4RA 4X65M 5ITXA 3P5UA 4R7GA 1VEJA 1NL6A 5EZQA 2DNAA 2HAKA 2JTCA 1U9WA 1ZCMA 3B7ZA 3HJ8A 4AKGA 2HL7A 3JR5A 3IHPA 1A6RA 3BBAA 3P5WA 1PRBA 2YJBA 1L1ZA 1QOLA 5FLXS 1JR3E 1MIRA 3FYDA 4M9SA 2QBYA 2FT2A 4PT5A 3S3QA 1D0LA 1IXSA 2V1CA 3PNYA 4G54A 3H4JA 4I8OA 3GLGA 1VJVA 2G5GX 4LJ8A 1F2BA 3BC3A 5A24A 1QQWA 1PJIA 4IBFA 3H6SA 3U6MA 5EGWA 2FRAA 2R9CA 1G8PA 2QP9X 2H5XA 3AFHA 2J7OA 4MH0E 3KOYE 1GKIA 3W67A 1D0KA 4CIZA 4OVZA 5DYGA 2CIOA 2HXZA 2LVPC 3MHVC 1TTEA 4NSOB 3FUTA 3IG5A 1MN3A 3PW3A 1Q02A 1ZMWA 4IBJA 4W4UA 3CTWB 1STFE 2PADA 1XWIA 2JUJA 2K0BX 2BNKA 2HCBA 3U60A 4M9ZA 1T3TA 3WXGA 1Q6KA 1XXHB 1QDQA 5LMNM 3BY4A 2AIMA 2WSFF 2JZ1A 3U6LA 4G4RA 5EP1A 3KXEC 2G6DA 4LF5M 1WHCA 2ZTCA 1SXJC 3BB7A 3HHIA 1PJSA 4AZFA 1TDHA 4LJ9A 2X4AA 1OFHA 4A5UA 3C58A 2KEBA 3U6EA 1MEMA 1DGFA 3L25A 3W30A 3KFQA 5JH3A 3HHZA 1AYVA 2JY8A 1WGLA 3PDFA 3THGA 1QDTA 5JI3E 1ZAEA 1POPA 3SHGB 1E94E 1YK8A 4BQVA 3FRIA 3MHSA 2DC6A 1Y08A 2LWXA 1O0EA 1DV0A 3B21A 1HT2E 2KRUA 2AVWA 4DV3M 5KO3A 3HU3A 2AGAA 4MM3B 3LCVB 2ZAMA 3HHXA 2O6XA 2HKJA 2UU9M 1QUTA 1DKIA 2P0RA 1YSYA 1QXPA 3N3KA 2CUZA 4W5CA 3FTFA 1KYIA 3J2PB 2DAEA 1CV8A 4B7FA 4GUAA 3IEJA 3GLFE 4DR2M 1NB3A 2EA0A 1P3QQ 2G8LA 2F5QA 2BDZA 3T6PA 4FJCA 4PDIA 2YNMD 2PREA 3CF6E 1NHWC 1OIZA 2BTWB 1WIVA 2R44A 3O1GA 5FPWA 2E00A 2CB5A 3JAMS 2M5ZA 2RKOA 2HWJA 4DV1M 4DR1M 3C3DA 5FSWA 4I5SA 1NB5A 2YFQA 4IBDA 1NY6A 3B9PA 1C7YA 4CDEB 1QDRA 4N79A 2MH8A 4S12A 5C1BA 3U6PA 2C0YA 3F75A 4DR7M 4P6GA 4LJ4A 2V1UA 4Q8HA 4DV2M 3A46A 3U6CA 2RRUA 5EXXA 2N35A 2DZYA 2QPAA 4CDDB 4HXDB 3I06A 3E9SA 3EIEA 3HHYA 2DJGB 3IOQA 2M60A 2LXEA 4XZXA 2LH0A 5CVNB 1EWOA 2L7IA 3FUXA 3CGWA 2O25A 1SXJD 2DCCA 2DC8A 3VLFB 1G3IA 4FK5A 4I07A 3U5ZA 3ILKA 3U8EA 1T43A 2H1RA 2KNAA 4M0WA 2QENA 2OOAA 4LY6A 3LMMA 3KWZA 1R7RA 3KOXE 4BOZA 2JZ0A 3DOAA 3H4MA 3ZH9B 2JNHA 4FD2A 4IJEA 4RKXA 1DO0A 3B79A 2DCDA 1ZV1A 3DZDA 1Q39A 3OTOM 3UZUA 1CVZA 5FTJA 4I81A 3SATA 4YVAA 2P86A 1QZEA 3D8LA 4D81A 3IFUA 2LNHC 4BSQA 3USVA 4OEMA 3U61B 6PADA 4IBGA 4B3SM 1XMOM 4GIPA 4JI8M 3GLHA 2BWEA 2E5LM 3W0FA 3GRYA 3GLIA 1HR0M 4L6V6 2EKKA 1C1KA 3TWMA 1XMQM 4LFBM 3L2AA 2C98A 1TGUA 2FRQA 1JB0F 1SP4B 2Y5BA 4NOOB 1XXHE 4WW0A 2G8EA 2FE8A 2JY6B 2KHHA 4PADA 4BS6A 4AKHA 3L26A 3I3TA 3GRUA 4G4OA 2DAIA 2QHOB 4AXMA 1YT7A 1FJGM 3UK6A 5DYIA 5CHTA 3I4YA 3NBIA 2HH5A 4QH6A 1JQJC 4EIWA 1TF0B 3IV2A 2DZZA 2XFTA 3C9EA 2DHYA 3AOEC 3SAWA 4G6ZA 2JA2A 2VHFA 3GCBA 3KVWA 3M6AA 4IBCA 4CDCB 2F7DA 2CV0A 2J7QA 3OVZA 4AG5A 2LVNC 1U9VA 1F2AA 1VQ1A 4DR3M 1KFUL 3QAUA 2L4EA 2AUZA 2RGOA 1W5TA 1KFXL 3DA1A 2FOIC 4JI4M 3GLFB 3H8BA 3SASA 5H37D 2LTUA 4FVMA 2XEPA 3SMSA 5ITXE 4DV0M 2F5SA 3R8FA 1ICFA 2DKLA 3HX3A 3CH2X 2R9FA 1S4VA 2AU1A 3CBKA 3RVXA 3SAUA 5L8RF 4K7CA 3WHKA 1GABA 4JI1M 3HU1A 2CEAA 2L7HA 3WHLA 3M0EA 1YZBA 4NXNM 1MS6A 3I01M 3J81S 1QANA 4N4ZA 3FTCA 1EWPA 3HKPA 3KWBX 3GLGE 2B1NA 1CS8A 3KW9A 3RVWA 2DAKA 3NBXX 3HJSA 4YYUA 5ITUA 5DNYA 5CVMA 4FCTA 1TU6A 4YHHM 1BP4A 1XKGA 1NQCA 2Z3XA 2H7JA 4DUYM 4KO8A 4LJ7A 3E21A 3BOSA 4LF9M 3W0LB 1Z5CA 2IBIA 4IBBA 1QYRA 4LF8M 5CVOB 3GQ5A 4W5BA 4IBKA 2BU3A 2XU3A 3W31A 2YJ2A 4LGMA 4DV4M 3UGJA 4HL4A 1N75A 3KX1A 3GRVA 2OZ2A 1UKFA 3FTEA 2W82A 1F4IA 4AXLA 2J7NA 3PHWA 2X8AA 3D6SA 2FUDA 2VF8A 3HU2A 3KS4A 3VK8A 1NV8A 3LCUA 3A45A 1PXVA 1L2BA 2APLA 1G71A 1E9RA 2HD5A 1U9QX 2K9DA 2DC7A 4BS5A 5E26A 3SHFA 4YYRA 2KNVA 3OF8A 4I05A 1UM8A 2LBCA 3QWLA 4RY2A 2FS1A 4QHTA 2R9NA 4R71A 1N32M 1HUCB 1CJLA 3N4CA 4I4LA 2O01F 3KSJA 4FIPA 1QAMA 2VF7A 3BCNA 2I7NA 4BOSA 1VG5A 2HHNA 4YY3M 2QCUA 4KLNA 2FYEA 2R65A 3PNRA 1DGHA 4GHLA 2BTWA 1TL9A 2UUCM 3TL4X 1IY0A 2QZ4A 1DEUA 3A98B 3C0RA 1HNXM 2ATOA 3Q8XA 4JI7M 3VFDA 4W5WA 5LMUM 1BVSA 3KDSE 2QNJA 1NNJA 2MROB 4LJ5A 4X66M 1IN7A 3BXWA 3RFWA 1XNRM 2KW0A 4NL4H 4HLQA 2F4VM 1WR1B 2AYOA 4ZPXA 4XUIA 2PNSA 1ORYB 2KDLA 4F1IA 1SXJA 1IXRC 1JR3A 1N36M 1PVJA 2CWBA 4NRWA 4AI6A 2G3QA 5EZSA 5GKNA 3N3GA 4G4NA 1BY8A 2DHRA 4IUMA 2XU1A 2WSCF 4LRSA 1IBKM 1ME4A 5IREB 4X6JA 1KFVA 1IFYA 3QYEA 4FWGA 1I94M 4L15A 4PP1A 4LZZA 4QRGA 2DZNB 4DBGB 2JP7A 4LZJA 3FUVA 3NWLA 1NSFA 4ANRA 2Y0QA 4KLBA 4LF6M 3K8ZA 1QAQA 2QBYB 1Q3CA 4LJAA 2E02A 3QT4A 3KKUA 4JI2M 4CDFB 2Z4RA 2CV2A 2DXIA 1CUKA 2UUAM 4CISA 1CPJA 1IXSB 1A5TA 5DFLA 2CHVA 2DOSA 1HNZM 3GLGB 3V76A 2OPFA 3MK6A 3CH3X 1AU4A 1OIPA 1LTMA 3WXFA 1IWDA 2OOBA 3OF9A 3FD9A 2J5YA 5JI2E 4B7GA 1G4AE 4PDGA 3PRMA 4OVZB 3OVXA 4JI0M 1PPDA 4D80A 1GECE 2DWMA 4X6HA 1S3SA 1PPNA 1THEA 3BOWA 1QVRA 4GITA 4RNAA 2KZUA 4B3TM 3RVVA 1MEGA 4JXJA 1GCBA 3HHAA 4BPVA 2IPPB 1IN8A 2R4JA 4D82A 3UMMA 1AU0A 2R4EA 3IECA 4BLCA 4GKJM 3CF2A 1V33A 1AU2A 3AJIB 2F5NA 3KW6A 4OW0A 1QAOA 3SMPA 2EO2A 2R9OA 2DENA 4YYVA 2BJVA 3E46A 3HWSA 1F2CA 2L4FA 1WGNA 3HWNA 3AOGA 1XNQM 3OQCA 1OQYA 3H89A 4GC9A 4X62M 5K16A 1JR3D 1YALA 3FE3A 4MZSA 3K2LA 3T38A 2AYNA 4KODA 2AUXA 2BDLA 3GPPA 4NSRA 4MI7A 1SG9A 4GEWA 2DAMA 4DMYA 2Z4SA 5F02A 1IBMM 4QOSA 5EP4A 1IXZA 3ERVA 4L78A 2BJWA 1PPPA 1R2ZA 2NQIA 3FUUA 2UXBM 1PJJA 5ITTA 3TPZA 5EQTA 3LQQA 3SFZA 2E03A 1NJGA 4LF4M 3C3EA 2FFJA 3TE6A 7PCKA 5KPZA 4D8EA 4QRVA 4PD2A 4AQYM 2UZJA 2JY5A 4QRXA 2Z84A 5KQ8A 2D7EA 1DF0A 3RNVA 3A42A 7CATA 1U5IA 2GFOA 1AUAA 4HEOA 4RKUF 4D8BA 1G59A 4IIWA 4OU7A 1L8QA 4JV5M 3LQRA 3FUWA 4L16A 1XB2B 1PJQA 4Q7JA 1TLOA 2C5RA 2XU5A 3AI8A 3CF0A 1J7KA 4BOPA 3KSXA 1D0MA 5J94A 5IWAM 4FCWA 4Q8GA 3J80S 4DR4M 3FYCA 1OAOC 2GQFA 3K9PA 3SYLA 4PI3A 2R6NA 4LFCM 1K3BB 1IY1A 2XFSA 1IN6A 1YE9A 2JQGR 1NV9A 1LV7A 4LGYA 2JY7A 4YV8A 5F3WA 1Y4HA 2B3TA 2DZLA 1HT1E 4IP3A 3AOEA 2NQDB 2CV1A 4FWDA 2VQEM 3H8CA 2MJ5B 1HQCA 3B89A 2UXDM 3U5ZB 2GHUA 4Z8XA 2C96A 1VEGA 2LVQD 2MGWA 4REZA 1K3WA 2R9MA 3QYBA 4GHAA 2F1GA 4Z6YA 4X6IA 3K92A 1L2DA 3PHXA 5EF4A 1ZMVA 1E9SA 1EF7A 5EP2A 5ITYA 3B74A 1XXHA 4WURA 2B1MA 1HNWM 2DI0A 1MJGM 3IUTA 4YYQA 4RF0A 2NQGA 1KHQA 5FTNA 3NHEA 3GLHB 2Y21A 1PIPA 9PAPA 3EIHA 1M6DA 1OJLA 2Z8YM 1ZMUA 4BOUA 2XSZA 3GLIB 1JQPA 2CE7A 3HJQA 3SAVA 4MSXA 2ARYA 2FNAA 4CZWA 4B7HA 4DR6M 1N34M 1Q3BA 1W5SA 1E32A 2DCBA 4DR5M 1J5EM 2VDBB 3SYKA 1FH0A 3KOZE 2KRKA 1EWLA 1Z5AA 4OELA 3HD3A 2XZUA 4GMQA 4LCBA 3LW5F 1BQIA 3KS8A 2LVAA 3GQ3A 1EFUB 3W68A 4MGYE 3U6DA 2EJSA 3GPXA 3U6OA 4B3RM 1NO1A 3O0UA 5EXTA 3TWLA 3FTDA 3IMAA 4L4UA 1V34A 1IM2A 4M9XA 2UXCM 3KSEA 4M0DA 1SXJE 3SARA 4L8RC 4F2LA 1GL6A 4P17A 1N77A 2ACTA 2ZM6M 5BPVA 1ATKA 3C9PA 2YJ9A 1L2CA 3MP2A 4DMXA 1OFIA 4UN2B 3P5XA 2VIIA 1CSBB 2JWSA 2C9OA 5KPRA 1VSNA 5A2QS 5KQDA 3TNXA 2I7PA 1NLJA 1GMYA 5JA7A 5BR8M 1PM5A 4AKIA 4FCVA 4AG6A 1KSFX 1KXRA 3RGPA 2UUBM 1K82A 5FTLA 5FTMA 1Z6TA 3TMPA 1V92A 3MJ5A 1DGGA 2X49A 2OO9A 1GJSA 3MORA 1N78A 2G7YA 4WA6A 1OTRA 3U6SA 4WP2A 1X37A 3MTVA 3O65A 4MB7A 2MR9A 3TRKA 3K1JA 3J7AS 3GRRA 4MGIE 4JYAM 1PADA 1GVNA 1PGYA 2XSZD 3HZJA 8CATA 4QOZC 5E6JA 1WJ7A 4MGZE 1N33M 1NNUC 2D7HA 3I04M 1VEKA 4PCZA 1HJPA 1TH3A 2GNOA 3ZC7B 1ZIVA 3R9XB 3BPMA 3H7DA 3HGIA 2LHCA 2K6BA 1PPOA 3ZQJA 3B7QA 2KZSA 3FRHA 3U6QA 2FO5A 2Y0TA 2G8JA 2R18A 1CB5A 1U9XA 4G3OA 1NPZA 4FWHA 4P6EA 2YQZA 3T1YM 2NQ8C 3DF0A 2P7UA 3PVSA 3KP1E 5EXPA 3KFUG 1F29A 1IN4A 2DVWB 1AIMA 4LFAM 3TWKA 1I4WA 2A5YB 3MMPA 2ZANA 4ZTBA 4KHPM 1QZMA 1UFZA 4ITQA 1GLOA 2XLJA 3PFIA 2FH0A 1AYUA 2YJ8A 1OAIA 1IQPA 2Q2EB 2RGHA 2R45A 3U61A 3V6CA 2OP3A 2AHMA 2ERCA 3ZCBB 3M99A 4BOQA 4OX9M 4RF1A 3PBHA 2Y6EA 4BB9A 3K24A 2EUCA 2YR0A 1Y8GA 4NXMM 2DZOB 3L28A 2C99A 3I4VA 3KP0E 1ME3A 4HWYA 1PJTA 3U60B 5KPTA 1DGHB 3QJ3A 4QNMA 3T15A 3MHHA 4XR7A 2L2DA 4BBAA 4XK8F 2JQFR 2ZTDA 2XZFA 2D7GA 2JXNA 2QSFX 3KOWE 3LFYA 2XH9A 2F5PA 1GLNA 1AIPC 3GLHE 1R6BX 3LVVA 4CHTB 3PRPA 4QBBA 3GLIE 1J09A 1DGBA
chains in the Genus database with same CATH topology
2BU3A 1OFHA 4A5UA 3C58A 2KEBA 3U6EA 5IWAM 3W31A 1G41A 4FCWA 4LGMA 1DGFA 3J80S 1XC8A 4DR4M 3FYCA 3L25A 4P16A 3W30A 4DV4M 3SYLA 3UGJA 4HL4A 1N75A 4LJ6A 3GRVA 2DWNA 1UKFA 4IJFA 3GPUA 2Z7JA 3J27B 4QNRA 3HHZA 2P5TA 2W82A 3FTEA 3RE8A 4LFCM 1SXJB 3THGA 2F5OA 3ZNHA 1IY1A 2XFSA 1IN6A 5IZ7D 1YE9A 2J7NA 5JI3E 1HQYE 4DUZM 1ZAEA 1LV7A 3PHWA 2X8AA 3SHGB 1E94E 4LGYA 3L27A 5F3WA 1EE8A 1DO2A 2LWXA 4TUWA 3GP1A 1HT1E 3HU2A 3KS4A 3L29A 4IP3A 3GLFA 3VK8A 3B21A 1HT2E 3A45A 3AOEA 2KRUA 1L2BA 2CV1A 2R46A 4FWDA 4IBEA 1E9RA 2VQEM 1Z59A 5KO3A 4DV3M 1HQCA 3HU3A 2AGAA 5E26A 3SHFA 4JI6M 4CGYB 2UXDM 4MM3B 3U5ZB 2ZAMA 3HHXA 1UM8A 1YUBA 1L1TA 2HKJA 3QWLA 1FNNA 2C9CA 4Z8XA 3AL0C 4GRIA 2C96A 2UU9M 4QHTA 1ZQ9A 1DKIA 1N32M 1YSYA 5IT9S 4REZA 1K3WA 4I4LA 3KSJA 2CUZA 4GHAA 1QAMA 5JZEA 5EXSA 2I7NA 2DWZB 4Z6YA 3FTFA 1KYIA 3J2PB 3K92A 1L2DA 3PHXA 1NVMA 4BOSA 1E9SA 4B7FA 4GUAA 4QHSA 5EP2A 5ITYA 4DR2M 4YY3M 2QCUA 4KLNA 2R65A 2EA0A 1XXHA 4JN6A 2G8LA 4WURA 2F5QA 1DGHA 4GHLA 2BTWA 1HNWM 3VDPA 4PDIA 1IBLM 2YNMD 2VQFM 2UUCM 3CF6E 3PSEA 1R2YA 1NHWC 4RF0A 2BTWB 3TL4X 1IY0A 2QZ4A 5FTNA 1MX0A 3A98B 3C0RA 1HNXM 3GLHB 1GL7A 1TH2A 2Y21A 3Q8XA 3JR4A 2HHHM 4JI7M 3VFDA 4X64M 2ZBKB 2JRIA 3EIHA 4W5WA 1OJLA 2KA6B 5LMUM 3KDSE 2XSZA 4BOUA 2R62A 3GLIB 1NNJA 3LVWA 2CE7A 3HJQA 3JAMS 2M5ZA 4LJ5A 5C18A 2RKOA 3SAVA 4X66M 4DV1M 4DR1M 1IN7A 2FNAA 4NRVA 5FSWA 4B7HA 1H6UA 4I5SA 3RFWA 4DR6M 1N34M 1Q3BA 2YFQA 4IBDA 2KW0A 4NL4H 1W5SA 1XNRM 4HLQA 2F4VM 5FTKA 1E32A 3GPYA 4D8IA 1NY6A 4DR5M 3B9PA 4ZPXA 1J5EM 3SYKA 1MU5A 3KOZE 4IBIA 3GO8A 1D2NA 1ORYB 2K47A 2KRKA 3PHUA 1VDDA 4S12A 2OQ4A 5C1BA 3U6PA 1SXJA 1IXRC 1JR3A 1Z5AA 4A3VB 1N36M 1PVJA 3M7GA 2XZUA 4NRWA 4DR7M 4GMQA 4AI6A 4LCBA 4LJ4A 5EJCA 4MGKE 2V1UA 4MGHA 4DV2M 3A46A 3U6CA 2Y20A 5EXXA 3PXGA 2DWLA 4K0KM 5EZSA 2QPAA 5GKNA 4G4NA 4HXDB 3KS8A 2KXEA 2DHRA 3E9SA 3GQ3A 4IUMA 3EIEA 3HHYA 2J7QC 3PT2A 1IY2A 2M60A 2LXEA 4XZXA 4LRSA 1TH4A 4MGYE 3U6DA 3GPXA 3U6OA 2LH0A 1IBKM 4B3RM 2HWKA 4DV7M 1TDZA 3FKEA 5IREB 5EXTA 1NY5A 3TWLA 1KFVA 2L7IA 3FUXA 1XHBA 3FTDA 4L4UA 5ITRA 1SXJD 4DV5M 4FWGA 2CHQA 1IM2A 1G3IA 3VLFB 4L15A 1I94M 4II7A 4LZZA 2DZNB 3U5ZA 3ILKA 2CFOA 4M9XA 2H1RA 4M0WA 2UXCM 2QENA 4LZJA 4LY6A 4M0DA 2V6ZM 1SXJE 3FUVA 3LMMA 3SARA 1R7RA 3KOXE 4BOZA 3NWLA 4AW4A 4GC5A 1NSFA 3DOAA 4L8RC 2Y0QA 3H4MA 3ZH9B 1WXQA 4LRTA 1GL6A 1N77A 2ZM6M 4FD2A 4FW9A 4IJEA 3K8ZA 4GH9A 1QAQA 5BPVA 2QBYB 4LF6M 1Q3CA 1DO0A 4LJAA 4RKXA 3TQSA 4JI2M 2Z4RA 2CV2A 2DXIA 1L2CA 3MP2A 2UUAM 1NJFA 3DZDA 4CISA 1IXSB 1OFIA 1Q39A 2CHVA 1HNZM 3OTOM 3UZUA 2ZAOA 3GLGB 2DOSA 1NHGC 5FTJA 2OPFA 4I81A 2VIIA 3SATA 3MK6A 4JI3M 4LG2A 5EP3A 2C9OA 5KPRA 3IG8A 3D8LA 3PNVA 4D81A 2O5RA 2CHGA 3FD9A 3IFUA 5JI2E 2LNHC 3HHWA 5A2QS 4B7GA 5KQDA 1G4AE 2I7PA 3U61B 4IBGA 4PDGA 4B3SM 1XMOM 4GIPA 4JI8M 3PRMA 3GLHA 2E5LM 5BR8M 1PM5A 4AKIA 4OVZB 3T1HM 4FCVA 4AG6A 3W0FA 1KSFX 4JI0M 3RGPA 2UUBM 3GRYA 3I51A 4D80A 5FTLA 1K82A 5FTMA 1Z6TA 3GLIA 3UJNA 4JI5M 3TMPA 1HR0M 1K3XA 3VDUA 3MJ5A 2DWMA 3D8BA 1C1KA 3TWMA 1S3SA 1DGGA 2X49A 1XMQM 4LFBM 4R3DA 1QVRA 1N78A 4GITA 4RNAA 2L09A 2KZUA 3U6SA 3L2AA 4B3TM 4XGIA 2C98A 1TGUA 1IN5A 1X37A 4JXJA 5ITQA 3MTVA 3VKGA 3O65A 4MB7A 2L6OA 3AKZA 3GQ4A 3TRKA 4XBOA 3K1JA 3VK7A 3J7AS 4GKKM 4NOOB 3GRRA 4WW0A 4MGIE 1IN8A 4JYAM 2R4JA 4D82A 1GVNA 2FE8A 4DV6M 3UMMA 1Z5BA 2R4EA 4BLCA 2XSZD 8CATA 4GKJM 3J7BA 3CF2A 4QOZC 5E6JA 4AKHA 4G4QA 4B3MM 3AJIB 4MGZE 2F5NA 1N33M 3KW6A 4OW0A 3RGSA 3L26A 3AV0A 1QAOA 3GRUA 3SMPA 1NNUC 2D7HA 2EO2A 4G4OA 4B08A 4PCZA 4LF7M 2XF3A 1TH3A 3ZC7B 3R9XB 3VKHA 1FJGM 2BJVA 2XGNA 3UK6A 3DFZA 3SC3A 5DYIA 3SBJA 3HWSA 3I4YA 3E4RA 3NBIA 3HGIA 4X65M 1JQJC 5ITXA 4EIWA 3AOGA 2XFTA 1XNQM 2KZSA 3OQCA 4R7GA 3U6QA 5EZQA 3AOEC 2Y0TA 4GC9A 4G6ZA 2JA2A 4X62M 3SAWA 2JTCA 1JR3D 2R18A 3HJ8A 4AKGA 3KVWA 2HL7A 3M6AA 3JR5A 4IBCA 3K2LA 3T38A 3BBAA 4FWHA 2YQZA 4KODA 2CV0A 2J7QA 3T1YM 4LJ9A 1L1ZA 2NQ8C 5FLXS 3GPPA 4AG5A 3PVSA 3FYDA 3KP1E 4M9SA 2QBYA 4NSRA 4PT5A 5EXPA 4MI7A 3KFUG 1IN4A 2DVWB 4DR3M 3QAUA 4LFAM 2RGOA 3TWKA 1I4WA 1W5TA 2V1CA 2A5YB 3DA1A 3PNYA 2FOIC 4I8OA 3GLGA 2ZANA 2G5GX 4LJ8A 4JI4M 4ZTBA 4KHPM 1QQWA 2Z4SA 3GLFB 1PJIA 4IBFA 3SASA 5H37D 4FVMA 1QZMA 3U6MA 1IBMM 4ITQA 2XEPA 4QOSA 3SMSA 5EP4A 1IXZA 4L78A 5ITXE 2BJWA 2XLJA 3PFIA 1G8PA 4DV0M 1R2ZA 3R8FA 2F5SA 2QP9X 3AFHA 3FUUA 1IQPA 2Q2EB 2RGHA 2UXBM 1PJJA 2J7OA 5ITTA 2R45A 3SAUA 3U61A 3TPZA 5EQTA 4MH0E 3KOYE 3LQQA 2AHMA 1GKIA 2ERCA 3WHKA 4JI1M 3SFZA 3HU1A 2CEAA 4OVZA 3ZCBB 2L7HA 3WHLA 4BOQA 5DYGA 4OX9M 4RF1A 3MHVC 3M0EA 1NJGA 4BB9A 4NSOB 2EUCA 3FUTA 4NXNM 4LF4M 1YZBA 3IG5A 3J81S 1QANA 3FTCA 4IBJA 2FFJA 3TE6A 5KPZA 4D8EA 3CTWB 3HKPA 2YR0A 4NXMM 1XWIA 2DZOB 3L28A 2C99A 4PD2A 2BNKA 2HCBA 4AQYM 3I4VA 3U60A 4M9ZA 3KP0E 1T3TA 2UZJA 2Z84A 5KQ8A 1XXHB 2D7EA 3HJSA 3RNVA 3A42A 7CATA 3U60B 5KPTA 1DGHB 4QNMA 3T15A 5ITUA 5DNYA 5LMNM 3BY4A 4D8BA 1G59A 4IIWA 4OU7A 4FCTA 3U6LA 4BBAA 1L8QA 4YHHM 3LQRA 4G4RA 5EP1A 4JV5M 3FUWA 4L16A 2XZFA 2D7GA 2Z3XA 4DUYM 3KXEC 4KO8A 4LJ7A 3KOWE 2XH9A 2F5PA 3BOSA 4LF5M 4LF9M 1GLNA 2C5RA 1SXJC 3W0LB 1R6BX 3LVVA 1Z5CA 3BB7A 4CHTB 3CF0A 1J7KA 3PRPA 4BOPA 4IBBA 1QYRA 4LF8M 3KSXA 3GQ5A 4AZFA 1J09A 1DGBA 1TDHA 4IBKA 2X4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0W A;  3E9S A;  4MM3 B;  4P16 A;  2FE8 A;  3MJ5 A;  4PT5 A;  4WUR A;  4R3D A;  5E6J A;  4RNA A;  4OVZ A;  4REZ A;  4OW0 A;  3MP2 A;  4RF0 A;  5KO3 A;  4RF1 A;  4OVZ B; 
#chains in the Genus database with same CATH topology
 1QMY A;  1G41 A;  1XC8 A;  4P16 A;  4LJ6 A;  2DWN A;  4IJF A;  3GPU A;  2XU4 A;  2Z7J A;  3J27 B;  3E1Z B;  4QNR A;  1R5L A;  2CRU A;  2P5T A;  3WXE A;  3RE8 A;  1SXJ B;  2F5O A;  3ZNH A;  5IZ7 D;  1HQY E;  4DUZ M;  3K8U A;  2WZJ A;  3L27 A;  1EE8 A;  1DO2 A;  3HY5 A;  4TUW A;  3GP1 A;  3OIS A;  3L29 A;  3GLF A;  2AS8 A;  2R46 A;  4IBE A;  1AYW A;  1Z59 A;  1X9Y A;  3MTN A;  4JI6 M;  4Y28 F;  4CGY B;  2DC9 A;  4CJ6 A;  2DCA A;  1PCI A;  1CTE A;  1YUB A;  1L1T A;  1FNN A;  2C9C A;  3AL0 C;  4GRI A;  4N8W A;  1ZQ9 A;  3S3R A;  5IT9 S;  2EKF A;  4MZO A;  1KHP A;  5JZE A;  5EXS A;  2DWZ B;  3F92 A;  3V6E A;  1NVM A;  4QHS A;  1YLA A;  1MDW A;  4JN6 A;  3VDP A;  1QUS A;  1IBL M;  4YYW A;  2VQF M;  3PSE A;  1R2Y A;  1MHW A;  2DAG A;  3ZUA A;  1MX0 A;  1TR8 A;  1YK7 A;  1RU3 A;  1GL7 A;  1TH2 A;  3JR4 A;  2HHH M;  4I04 A;  1YVB A;  4X64 M;  2ZBK B;  2JRI A;  3CBJ A;  2KA6 B;  1PBH A;  2R62 A;  1PE6 A;  3LVW A;  5C18 A;  2OUL A;  1EWM A;  4NRV A;  2PBH A;  3LXS A;  1R4G A;  1H6U A;  2FQ9 A;  5FTK A;  3GPY A;  4D8I A;  2WBF X;  1MU5 A;  4IBI A;  3GO8 A;  1D2N A;  2K47 A;  3PHU A;  1VDD A;  2OQ4 A;  2BWB A;  4A3V B;  1SNK A;  3M7G A;  5EJC A;  4MGK E;  4MGH A;  2Y20 A;  3PXG A;  2DWL A;  4K0K M;  2WSE F;  2KXE A;  2LHG A;  1GJT A;  2J7Q C;  3PT2 A;  1IY2 A;  1TH4 A;  2HWK A;  4DV7 M;  1TDZ A;  3FKE A;  1AU3 A;  1NY5 A;  4KT0 F;  2R6F A;  1XHB A;  5ITR A;  4DV5 M;  1OKS A;  2CHQ A;  2DJF B;  4II7 A;  2YJC A;  3B7N A;  2CFO A;  1AEC A;  2V6Z M;  4AW4 A;  4GC5 A;  1WXQ A;  4LRT A;  4FW9 A;  4GH9 A;  3P5V A;  3TQS A;  1VDL A;  2E01 A;  1NJF A;  8PCH A;  2KNZ A;  2ZAO A;  2LVO C;  1NHG C;  3QSD A;  4JI3 M;  4LG2 A;  5EP3 A;  3IG8 A;  4YYS A;  3PNV A;  2O5R A;  1T6O A;  2CHG A;  4NC6 A;  3HHW A;  4ZUX U;  2NQA A;  3T1H M;  3BBZ A;  3I51 A;  2R0I A;  3UJN A;  4JI5 M;  1K3X A;  3K9O A;  3VDU A;  1BGO A;  3D8B A;  4R3D A;  3K9M A;  3F5V A;  1GO5 A;  2L09 A;  4XGI A;  1IN5 A;  5ITQ A;  3VKG A;  2L6O A;  3AKZ A;  3GQ4 A;  2QQ8 A;  1CQD A;  4XBO A;  3VK7 A;  3Q8G A;  4GKK M;  1EIJ A;  5PAD A;  2FTD A;  3BWK A;  4PP2 E;  2CP8 A;  1ITO A;  4DV6 M;  2VHS A;  1Z5B A;  3J7B A;  4G4Q A;  4B3M M;  3RGS A;  3AV0 A;  4B08 A;  4LF7 M;  2XF3 A;  3BPF A;  5CHV A;  3VKH A;  2XGN A;  3DFZ A;  3SC3 A;  3SBJ A;  3E4R A;  4X65 M;  5ITX A;  3P5U A;  4R7G A;  1VEJ A;  1NL6 A;  5EZQ A;  2DNA A;  2HAK A;  2JTC A;  1U9W A;  1ZCM A;  3B7Z A;  3HJ8 A;  4AKG A;  2HL7 A;  3JR5 A;  3IHP A;  1A6R A;  3BBA A;  3P5W A;  1PRB A;  2YJB A;  1L1Z A;  1QOL A;  5FLX S;  1JR3 E;  1MIR A;  3FYD A;  4M9S A;  2QBY A;  2FT2 A;  4PT5 A;  3S3Q A;  1D0L A;  1IXS A;  2V1C A;  3PNY A;  4G54 A;  3H4J A;  4I8O A;  3GLG A;  1VJV A;  2G5G X;  4LJ8 A;  1F2B A;  3BC3 A;  5A24 A;  1QQW A;  1PJI A;  4IBF A;  3H6S A;  3U6M A;  5EGW A;  2FRA A;  2R9C A;  1G8P A;  2QP9 X;  2H5X A;  3AFH A;  2J7O A;  4MH0 E;  3KOY E;  1GKI A;  3W67 A;  1D0K A;  4CIZ A;  4OVZ A;  5DYG A;  2CIO A;  2HXZ A;  2LVP C;  3MHV C;  1TTE A;  4NSO B;  3FUT A;  3IG5 A;  1MN3 A;  3PW3 A;  1Q02 A;  1ZMW A;  4IBJ A;  4W4U A;  3CTW B;  1STF E;  2PAD A;  1XWI A;  2JUJ A;  2K0B X;  2BNK A;  2HCB A;  3U60 A;  4M9Z A;  1T3T A;  3WXG A;  1Q6K A;  1XXH B;  1QDQ A;  5LMN M;  3BY4 A;  2AIM A;  2WSF F;  2JZ1 A;  3U6L A;  4G4R A;  5EP1 A;  3KXE C;  2G6D A;  4LF5 M;  1WHC A;  2ZTC A;  1SXJ C;  3BB7 A;  3HHI A;  1PJS A;  4AZF A;  1TDH A;  4LJ9 A;  2X4A A;  1OFH A;  4A5U A;  3C58 A;  2KEB A;  3U6E A;  1MEM A;  1DGF A;  3L25 A;  3W30 A;  3KFQ A;  5JH3 A;  3HHZ A;  1AYV A;  2JY8 A;  1WGL A;  3PDF A;  3THG A;  1QDT A;  5JI3 E;  1ZAE A;  1POP A;  3SHG B;  1E94 E;  1YK8 A;  4BQV A;  3FRI A;  3MHS A;  2DC6 A;  1Y08 A;  2LWX A;  1O0E A;  1DV0 A;  3B21 A;  1HT2 E;  2KRU A;  2AVW A;  4DV3 M;  5KO3 A;  3HU3 A;  2AGA A;  4MM3 B;  3LCV B;  2ZAM A;  3HHX A;  2O6X A;  2HKJ A;  2UU9 M;  1QUT A;  1DKI A;  2P0R A;  1YSY A;  1QXP A;  3N3K A;  2CUZ A;  4W5C A;  3FTF A;  1KYI A;  3J2P B;  2DAE A;  1CV8 A;  4B7F A;  4GUA A;  3IEJ A;  3GLF E;  4DR2 M;  1NB3 A;  2EA0 A;  1P3Q Q;  2G8L A;  2F5Q A;  2BDZ A;  3T6P A;  4FJC A;  4PDI A;  2YNM D;  2PRE A;  3CF6 E;  1NHW C;  1OIZ A;  2BTW B;  1WIV A;  2R44 A;  3O1G A;  5FPW A;  2E00 A;  2CB5 A;  3JAM S;  2M5Z A;  2RKO A;  2HWJ A;  4DV1 M;  4DR1 M;  3C3D A;  5FSW A;  4I5S A;  1NB5 A;  2YFQ A;  4IBD A;  1NY6 A;  3B9P A;  1C7Y A;  4CDE B;  1QDR A;  4N79 A;  2MH8 A;  4S12 A;  5C1B A;  3U6P A;  2C0Y A;  3F75 A;  4DR7 M;  4P6G A;  4LJ4 A;  2V1U A;  4Q8H A;  4DV2 M;  3A46 A;  3U6C A;  2RRU A;  5EXX A;  2N35 A;  2DZY A;  2QPA A;  4CDD B;  4HXD B;  3I06 A;  3E9S A;  3EIE A;  3HHY A;  2DJG B;  3IOQ A;  2M60 A;  2LXE A;  4XZX A;  2LH0 A;  5CVN B;  1EWO A;  2L7I A;  3FUX A;  3CGW A;  2O25 A;  1SXJ D;  2DCC A;  2DC8 A;  3VLF B;  1G3I A;  4FK5 A;  4I07 A;  3U5Z A;  3ILK A;  3U8E A;  1T43 A;  2H1R A;  2KNA A;  4M0W A;  2QEN A;  2OOA A;  4LY6 A;  3LMM A;  3KWZ A;  1R7R A;  3KOX E;  4BOZ A;  2JZ0 A;  3DOA A;  3H4M A;  3ZH9 B;  2JNH A;  4FD2 A;  4IJE A;  4RKX A;  1DO0 A;  3B79 A;  2DCD A;  1ZV1 A;  3DZD A;  1Q39 A;  3OTO M;  3UZU A;  1CVZ A;  5FTJ A;  4I81 A;  3SAT A;  4YVA A;  2P86 A;  1QZE A;  3D8L A;  4D81 A;  3IFU A;  2LNH C;  4BSQ A;  3USV A;  4OEM A;  3U61 B;  6PAD A;  4IBG A;  4B3S M;  1XMO M;  4GIP A;  4JI8 M;  3GLH A;  2BWE A;  2E5L M;  3W0F A;  3GRY A;  3GLI A;  1HR0 M;  4L6V 6;  2EKK A;  1C1K A;  3TWM A;  1XMQ M;  4LFB M;  3L2A A;  2C98 A;  1TGU A;  2FRQ A;  1JB0 F;  1SP4 B;  2Y5B A;  4NOO B;  1XXH E;  4WW0 A;  2G8E A;  2FE8 A;  2JY6 B;  2KHH A;  4PAD A;  4BS6 A;  4AKH A;  3L26 A;  3I3T A;  3GRU A;  4G4O A;  2DAI A;  2QHO B;  4AXM A;  1YT7 A;  1FJG M;  3UK6 A;  5DYI A;  5CHT A;  3I4Y A;  3NBI A;  2HH5 A;  4QH6 A;  1JQJ C;  4EIW A;  1TF0 B;  3IV2 A;  2DZZ A;  2XFT A;  3C9E A;  2DHY A;  3AOE C;  3SAW A;  4G6Z A;  2JA2 A;  2VHF A;  3GCB A;  3KVW A;  3M6A A;  4IBC A;  4CDC B;  2F7D A;  2CV0 A;  2J7Q A;  3OVZ A;  4AG5 A;  2LVN C;  1U9V A;  1F2A A;  1VQ1 A;  4DR3 M;  1KFU L;  3QAU A;  2L4E A;  2AUZ A;  2RGO A;  1W5T A;  1KFX L;  3DA1 A;  2FOI C;  4JI4 M;  3GLF B;  3H8B A;  3SAS A;  5H37 D;  2LTU A;  4FVM A;  2XEP A;  3SMS A;  5ITX E;  4DV0 M;  2F5S A;  3R8F A;  1ICF A;  2DKL A;  3HX3 A;  3CH2 X;  2R9F A;  1S4V A;  2AU1 A;  3CBK A;  3RVX A;  3SAU A;  5L8R F;  4K7C A;  3WHK A;  1GAB A;  4JI1 M;  3HU1 A;  2CEA A;  2L7H A;  3WHL A;  3M0E A;  1YZB A;  4NXN M;  1MS6 A;  3I01 M;  3J81 S;  1QAN A;  4N4Z A;  3FTC A;  1EWP A;  3HKP A;  3KWB X;  3GLG E;  2B1N A;  1CS8 A;  3KW9 A;  3RVW A;  2DAK A;  3NBX X;  3HJS A;  4YYU A;  5ITU A;  5DNY A;  5CVM A;  4FCT A;  1TU6 A;  4YHH M;  1BP4 A;  1XKG A;  1NQC A;  2Z3X A;  2H7J A;  4DUY M;  4KO8 A;  4LJ7 A;  3E21 A;  3BOS A;  4LF9 M;  3W0L B;  1Z5C A;  2IBI A;  4IBB A;  1QYR A;  4LF8 M;  5CVO B;  3GQ5 A;  4W5B A;  4IBK A;  2BU3 A;  2XU3 A;  3W31 A;  2YJ2 A;  4LGM A;  4DV4 M;  3UGJ A;  4HL4 A;  1N75 A;  3KX1 A;  3GRV A;  2OZ2 A;  1UKF A;  3FTE A;  2W82 A;  1F4I A;  4AXL A;  2J7N A;  3PHW A;  2X8A A;  3D6S A;  2FUD A;  2VF8 A;  3HU2 A;  3KS4 A;  3VK8 A;  1NV8 A;  3LCU A;  3A45 A;  1PXV A;  1L2B A;  2APL A;  1G71 A;  1E9R A;  2HD5 A;  1U9Q X;  2K9D A;  2DC7 A;  4BS5 A;  5E26 A;  3SHF A;  4YYR A;  2KNV A;  3OF8 A;  4I05 A;  1UM8 A;  2LBC A;  3QWL A;  4RY2 A;  2FS1 A;  4QHT A;  2R9N A;  4R71 A;  1N32 M;  1HUC B;  1CJL A;  3N4C A;  4I4L A;  2O01 F;  3KSJ A;  4FIP A;  1QAM A;  2VF7 A;  3BCN A;  2I7N A;  4BOS A;  1VG5 A;  2HHN A;  4YY3 M;  2QCU A;  4KLN A;  2FYE A;  2R65 A;  3PNR A;  1DGH A;  4GHL A;  2BTW A;  1TL9 A;  2UUC M;  3TL4 X;  1IY0 A;  2QZ4 A;  1DEU A;  3A98 B;  3C0R A;  1HNX M;  2ATO A;  3Q8X A;  4JI7 M;  3VFD A;  4W5W A;  5LMU M;  1BVS A;  3KDS E;  2QNJ A;  1NNJ A;  2MRO B;  4LJ5 A;  4X66 M;  1IN7 A;  3BXW A;  3RFW A;  1XNR M;  2KW0 A;  4NL4 H;  4HLQ A;  2F4V M;  1WR1 B;  2AYO A;  4ZPX A;  4XUI A;  2PNS A;  1ORY B;  2KDL A;  4F1I A;  1SXJ A;  1IXR C;  1JR3 A;  1N36 M;  1PVJ A;  2CWB A;  4NRW A;  4AI6 A;  2G3Q A;  5EZS A;  5GKN A;  3N3G A;  4G4N A;  1BY8 A;  2DHR A;  4IUM A;  2XU1 A;  2WSC F;  4LRS A;  1IBK M;  1ME4 A;  5IRE B;  4X6J A;  1KFV A;  1IFY A;  3QYE A;  4FWG A;  1I94 M;  4L15 A;  4PP1 A;  4LZZ A;  4QRG A;  2DZN B;  4DBG B;  2JP7 A;  4LZJ A;  3FUV A;  3NWL A;  1NSF A;  4ANR A;  2Y0Q A;  4KLB A;  4LF6 M;  3K8Z A;  1QAQ A;  2QBY B;  1Q3C A;  4LJA A;  2E02 A;  3QT4 A;  3KKU A;  4JI2 M;  4CDF B;  2Z4R A;  2CV2 A;  2DXI A;  1CUK A;  2UUA M;  4CIS A;  1CPJ A;  1IXS B;  1A5T A;  5DFL A;  2CHV A;  2DOS A;  1HNZ M;  3GLG B;  3V76 A;  2OPF A;  3MK6 A;  3CH3 X;  1AU4 A;  1OIP A;  1LTM A;  3WXF A;  1IWD A;  2OOB A;  3OF9 A;  3FD9 A;  2J5Y A;  5JI2 E;  4B7G A;  1G4A E;  4PDG A;  3PRM A;  4OVZ B;  3OVX A;  4JI0 M;  1PPD A;  4D80 A;  1GEC E;  2DWM A;  4X6H A;  1S3S A;  1PPN A;  1THE A;  3BOW A;  1QVR A;  4GIT A;  4RNA A;  2KZU A;  4B3T M;  3RVV A;  1MEG A;  4JXJ A;  1GCB A;  3HHA A;  4BPV A;  2IPP B;  1IN8 A;  2R4J A;  4D82 A;  3UMM A;  1AU0 A;  2R4E A;  3IEC A;  4BLC A;  4GKJ M;  3CF2 A;  1V33 A;  1AU2 A;  3AJI B;  2F5N A;  3KW6 A;  4OW0 A;  1QAO A;  3SMP A;  2EO2 A;  2R9O A;  2DEN A;  4YYV A;  2BJV A;  3E46 A;  3HWS A;  1F2C A;  2L4F A;  1WGN A;  3HWN A;  3AOG A;  1XNQ M;  3OQC A;  1OQY A;  3H89 A;  4GC9 A;  4X62 M;  5K16 A;  1JR3 D;  1YAL A;  3FE3 A;  4MZS A;  3K2L A;  3T38 A;  2AYN A;  4KOD A;  2AUX A;  2BDL A;  3GPP A;  4NSR A;  4MI7 A;  1SG9 A;  4GEW A;  2DAM A;  4DMY A;  2Z4S A;  5F02 A;  1IBM M;  4QOS A;  5EP4 A;  1IXZ A;  3ERV A;  4L78 A;  2BJW A;  1PPP A;  1R2Z A;  2NQI A;  3FUU A;  2UXB M;  1PJJ A;  5ITT A;  3TPZ A;  5EQT A;  3LQQ A;  3SFZ A;  2E03 A;  1NJG A;  4LF4 M;  3C3E A;  2FFJ A;  3TE6 A;  7PCK A;  5KPZ A;  4D8E A;  4QRV A;  4PD2 A;  4AQY M;  2UZJ A;  2JY5 A;  4QRX A;  2Z84 A;  5KQ8 A;  2D7E A;  1DF0 A;  3RNV A;  3A42 A;  7CAT A;  1U5I A;  2GFO A;  1AUA A;  4HEO A;  4RKU F;  4D8B A;  1G59 A;  4IIW A;  4OU7 A;  1L8Q A;  4JV5 M;  3LQR A;  3FUW A;  4L16 A;  1XB2 B;  1PJQ A;  4Q7J A;  1TLO A;  2C5R A;  2XU5 A;  3AI8 A;  3CF0 A;  1J7K A;  4BOP A;  3KSX A;  1D0M A;  5J94 A;  5IWA M;  4FCW A;  4Q8G A;  3J80 S;  4DR4 M;  3FYC A;  1OAO C;  2GQF A;  3K9P A;  3SYL A;  4PI3 A;  2R6N A;  4LFC M;  1K3B B;  1IY1 A;  2XFS A;  1IN6 A;  1YE9 A;  2JQG R;  1NV9 A;  1LV7 A;  4LGY A;  2JY7 A;  4YV8 A;  5F3W A;  1Y4H A;  2B3T A;  2DZL A;  1HT1 E;  4IP3 A;  3AOE A;  2NQD B;  2CV1 A;  4FWD A;  2VQE M;  3H8C A;  2MJ5 B;  1HQC A;  3B89 A;  2UXD M;  3U5Z B;  2GHU A;  4Z8X A;  2C96 A;  1VEG A;  2LVQ D;  2MGW A;  4REZ A;  1K3W A;  2R9M A;  3QYB A;  4GHA A;  2F1G A;  4Z6Y A;  4X6I A;  3K92 A;  1L2D A;  3PHX A;  5EF4 A;  1ZMV A;  1E9S A;  1EF7 A;  5EP2 A;  5ITY A;  3B74 A;  1XXH A;  4WUR A;  2B1M A;  1HNW M;  2DI0 A;  1MJG M;  3IUT A;  4YYQ A;  4RF0 A;  2NQG A;  1KHQ A;  5FTN A;  3NHE A;  3GLH B;  2Y21 A;  1PIP A;  9PAP A;  3EIH A;  1M6D A;  1OJL A;  2Z8Y M;  1ZMU A;  4BOU A;  2XSZ A;  3GLI B;  1JQP A;  2CE7 A;  3HJQ A;  3SAV A;  4MSX A;  2ARY A;  2FNA A;  4CZW A;  4B7H A;  4DR6 M;  1N34 M;  1Q3B A;  1W5S A;  1E32 A;  2DCB A;  4DR5 M;  1J5E M;  2VDB B;  3SYK A;  1FH0 A;  3KOZ E;  2KRK A;  1EWL A;  1Z5A A;  4OEL A;  3HD3 A;  2XZU A;  4GMQ A;  4LCB A;  3LW5 F;  1BQI A;  3KS8 A;  2LVA A;  3GQ3 A;  1EFU B;  3W68 A;  4MGY E;  3U6D A;  2EJS A;  3GPX A;  3U6O A;  4B3R M;  1NO1 A;  3O0U A;  5EXT A;  3TWL A;  3FTD A;  3IMA A;  4L4U A;  1V34 A;  1IM2 A;  4M9X A;  2UXC M;  3KSE A;  4M0D A;  1SXJ E;  3SAR A;  4L8R C;  4F2L A;  1GL6 A;  4P17 A;  1N77 A;  2ACT A;  2ZM6 M;  5BPV A;  1ATK A;  3C9P A;  2YJ9 A;  1L2C A;  3MP2 A;  4DMX A;  1OFI A;  4UN2 B;  3P5X A;  2VII A;  1CSB B;  2JWS A;  2C9O A;  5KPR A;  1VSN A;  5A2Q S;  5KQD A;  3TNX A;  2I7P A;  1NLJ A;  1GMY A;  5JA7 A;  5BR8 M;  1PM5 A;  4AKI A;  4FCV A;  4AG6 A;  1KSF X;  1KXR A;  3RGP A;  2UUB M;  1K82 A;  5FTL A;  5FTM A;  1Z6T A;  3TMP A;  1V92 A;  3MJ5 A;  1DGG A;  2X49 A;  2OO9 A;  1GJS A;  3MOR A;  1N78 A;  2G7Y A;  4WA6 A;  1OTR A;  3U6S A;  4WP2 A;  1X37 A;  3MTV A;  3O65 A;  4MB7 A;  2MR9 A;  3TRK A;  3K1J A;  3J7A S;  3GRR A;  4MGI E;  4JYA M;  1PAD A;  1GVN A;  1PGY A;  2XSZ D;  3HZJ A;  8CAT A;  4QOZ C;  5E6J A;  1WJ7 A;  4MGZ E;  1N33 M;  1NNU C;  2D7H A;  3I04 M;  1VEK A;  4PCZ A;  1HJP A;  1TH3 A;  2GNO A;  3ZC7 B;  1ZIV A;  3R9X B;  3BPM A;  3H7D A;  3HGI A;  2LHC A;  2K6B A;  1PPO A;  3ZQJ A;  3B7Q A;  2KZS A;  3FRH A;  3U6Q A;  2FO5 A;  2Y0T A;  2G8J A;  2R18 A;  1CB5 A;  1U9X A;  4G3O A;  1NPZ A;  4FWH A;  4P6E A;  2YQZ A;  3T1Y M;  2NQ8 C;  3DF0 A;  2P7U A;  3PVS A;  3KP1 E;  5EXP A;  3KFU G;  1F29 A;  1IN4 A;  2DVW B;  1AIM A;  4LFA M;  3TWK A;  1I4W A;  2A5Y B;  3MMP A;  2ZAN A;  4ZTB A;  4KHP M;  1QZM A;  1UFZ A;  4ITQ A;  1GLO A;  2XLJ A;  3PFI A;  2FH0 A;  1AYU A;  2YJ8 A;  1OAI A;  1IQP A;  2Q2E B;  2RGH A;  2R45 A;  3U61 A;  3V6C A;  2OP3 A;  2AHM A;  2ERC A;  3ZCB B;  3M99 A;  4BOQ A;  4OX9 M;  4RF1 A;  3PBH A;  2Y6E A;  4BB9 A;  3K24 A;  2EUC A;  2YR0 A;  1Y8G A;  4NXM M;  2DZO B;  3L28 A;  2C99 A;  3I4V A;  3KP0 E;  1ME3 A;  4HWY A;  1PJT A;  3U60 B;  5KPT A;  1DGH B;  3QJ3 A;  4QNM A;  3T15 A;  3MHH A;  4XR7 A;  2L2D A;  4BBA A;  4XK8 F;  2JQF R;  2ZTD A;  2XZF A;  2D7G A;  2JXN A;  2QSF X;  3KOW E;  3LFY A;  2XH9 A;  2F5P A;  1GLN A;  1AIP C;  3GLH E;  1R6B X;  3LVV A;  4CHT B;  3PRP A;  4QBB A;  3GLI E;  1J09 A;  1DGB A; 
#chains in the Genus database with same CATH homology
 2BU3 A;  1OFH A;  4A5U A;  3C58 A;  2KEB A;  3U6E A;  5IWA M;  3W31 A;  1G41 A;  4FCW A;  4LGM A;  1DGF A;  3J80 S;  1XC8 A;  4DR4 M;  3FYC A;  3L25 A;  4P16 A;  3W30 A;  4DV4 M;  3SYL A;  3UGJ A;  4HL4 A;  1N75 A;  4LJ6 A;  3GRV A;  2DWN A;  1UKF A;  4IJF A;  3GPU A;  2Z7J A;  3J27 B;  4QNR A;  3HHZ A;  2P5T A;  2W82 A;  3FTE A;  3RE8 A;  4LFC M;  1SXJ B;  3THG A;  2F5O A;  3ZNH A;  1IY1 A;  2XFS A;  1IN6 A;  5IZ7 D;  1YE9 A;  2J7N A;  5JI3 E;  1HQY E;  4DUZ M;  1ZAE A;  1LV7 A;  3PHW A;  2X8A A;  3SHG B;  1E94 E;  4LGY A;  3L27 A;  5F3W A;  1EE8 A;  1DO2 A;  2LWX A;  4TUW A;  3GP1 A;  1HT1 E;  3HU2 A;  3KS4 A;  3L29 A;  4IP3 A;  3GLF A;  3VK8 A;  3B21 A;  1HT2 E;  3A45 A;  3AOE A;  2KRU A;  1L2B A;  2CV1 A;  2R46 A;  4FWD A;  4IBE A;  1E9R A;  2VQE M;  1Z59 A;  5KO3 A;  4DV3 M;  1HQC A;  3HU3 A;  2AGA A;  5E26 A;  3SHF A;  4JI6 M;  4CGY B;  2UXD M;  4MM3 B;  3U5Z B;  2ZAM A;  3HHX A;  1UM8 A;  1YUB A;  1L1T A;  2HKJ A;  3QWL A;  1FNN A;  2C9C A;  4Z8X A;  3AL0 C;  4GRI A;  2C96 A;  2UU9 M;  4QHT A;  1ZQ9 A;  1DKI A;  1N32 M;  1YSY A;  5IT9 S;  4REZ A;  1K3W A;  4I4L A;  3KSJ A;  2CUZ A;  4GHA A;  1QAM A;  5JZE A;  5EXS A;  2I7N A;  2DWZ B;  4Z6Y A;  3FTF A;  1KYI A;  3J2P B;  3K92 A;  1L2D A;  3PHX A;  1NVM A;  4BOS A;  1E9S A;  4B7F A;  4GUA A;  4QHS A;  5EP2 A;  5ITY A;  4DR2 M;  4YY3 M;  2QCU A;  4KLN A;  2R65 A;  2EA0 A;  1XXH A;  4JN6 A;  2G8L A;  4WUR A;  2F5Q A;  1DGH A;  4GHL A;  2BTW A;  1HNW M;  3VDP A;  4PDI A;  1IBL M;  2YNM D;  2VQF M;  2UUC M;  3CF6 E;  3PSE A;  1R2Y A;  1NHW C;  4RF0 A;  2BTW B;  3TL4 X;  1IY0 A;  2QZ4 A;  5FTN A;  1MX0 A;  3A98 B;  3C0R A;  1HNX M;  3GLH B;  1GL7 A;  1TH2 A;  2Y21 A;  3Q8X A;  3JR4 A;  2HHH M;  4JI7 M;  3VFD A;  4X64 M;  2ZBK B;  2JRI A;  3EIH A;  4W5W A;  1OJL A;  2KA6 B;  5LMU M;  3KDS E;  2XSZ A;  4BOU A;  2R62 A;  3GLI B;  1NNJ A;  3LVW A;  2CE7 A;  3HJQ A;  3JAM S;  2M5Z A;  4LJ5 A;  5C18 A;  2RKO A;  3SAV A;  4X66 M;  4DV1 M;  4DR1 M;  1IN7 A;  2FNA A;  4NRV A;  5FSW A;  4B7H A;  1H6U A;  4I5S A;  3RFW A;  4DR6 M;  1N34 M;  1Q3B A;  2YFQ A;  4IBD A;  2KW0 A;  4NL4 H;  1W5S A;  1XNR M;  4HLQ A;  2F4V M;  5FTK A;  1E32 A;  3GPY A;  4D8I A;  1NY6 A;  4DR5 M;  3B9P A;  4ZPX A;  1J5E M;  3SYK A;  1MU5 A;  3KOZ E;  4IBI A;  3GO8 A;  1D2N A;  1ORY B;  2K47 A;  2KRK A;  3PHU A;  1VDD A;  4S12 A;  2OQ4 A;  5C1B A;  3U6P A;  1SXJ A;  1IXR C;  1JR3 A;  1Z5A A;  4A3V B;  1N36 M;  1PVJ A;  3M7G A;  2XZU A;  4NRW A;  4DR7 M;  4GMQ A;  4AI6 A;  4LCB A;  4LJ4 A;  5EJC A;  4MGK E;  2V1U A;  4MGH A;  4DV2 M;  3A46 A;  3U6C A;  2Y20 A;  5EXX A;  3PXG A;  2DWL A;  4K0K M;  5EZS A;  2QPA A;  5GKN A;  4G4N A;  4HXD B;  3KS8 A;  2KXE A;  2DHR A;  3E9S A;  3GQ3 A;  4IUM A;  3EIE A;  3HHY A;  2J7Q C;  3PT2 A;  1IY2 A;  2M60 A;  2LXE A;  4XZX A;  4LRS A;  1TH4 A;  4MGY E;  3U6D A;  3GPX A;  3U6O A;  2LH0 A;  1IBK M;  4B3R M;  2HWK A;  4DV7 M;  1TDZ A;  3FKE A;  5IRE B;  5EXT A;  1NY5 A;  3TWL A;  1KFV A;  2L7I A;  3FUX A;  1XHB A;  3FTD A;  4L4U A;  5ITR A;  1SXJ D;  4DV5 M;  4FWG A;  2CHQ A;  1IM2 A;  1G3I A;  3VLF B;  4L15 A;  1I94 M;  4II7 A;  4LZZ A;  2DZN B;  3U5Z A;  3ILK A;  2CFO A;  4M9X A;  2H1R A;  4M0W A;  2UXC M;  2QEN A;  4LZJ A;  4LY6 A;  4M0D A;  2V6Z M;  1SXJ E;  3FUV A;  3LMM A;  3SAR A;  1R7R A;  3KOX E;  4BOZ A;  3NWL A;  4AW4 A;  4GC5 A;  1NSF A;  3DOA A;  4L8R C;  2Y0Q A;  3H4M A;  3ZH9 B;  1WXQ A;  4LRT A;  1GL6 A;  1N77 A;  2ZM6 M;  4FD2 A;  4FW9 A;  4IJE A;  3K8Z A;  4GH9 A;  1QAQ A;  5BPV A;  2QBY B;  4LF6 M;  1Q3C A;  1DO0 A;  4LJA A;  4RKX A;  3TQS A;  4JI2 M;  2Z4R A;  2CV2 A;  2DXI A;  1L2C A;  3MP2 A;  2UUA M;  1NJF A;  3DZD A;  4CIS A;  1IXS B;  1OFI A;  1Q39 A;  2CHV A;  1HNZ M;  3OTO M;  3UZU A;  2ZAO A;  3GLG B;  2DOS A;  1NHG C;  5FTJ A;  2OPF A;  4I81 A;  2VII A;  3SAT A;  3MK6 A;  4JI3 M;  4LG2 A;  5EP3 A;  2C9O A;  5KPR A;  3IG8 A;  3D8L A;  3PNV A;  4D81 A;  2O5R A;  2CHG A;  3FD9 A;  3IFU A;  5JI2 E;  2LNH C;  3HHW A;  5A2Q S;  4B7G A;  5KQD A;  1G4A E;  2I7P A;  3U61 B;  4IBG A;  4PDG A;  4B3S M;  1XMO M;  4GIP A;  4JI8 M;  3PRM A;  3GLH A;  2E5L M;  5BR8 M;  1PM5 A;  4AKI A;  4OVZ B;  3T1H M;  4FCV A;  4AG6 A;  3W0F A;  1KSF X;  4JI0 M;  3RGP A;  2UUB M;  3GRY A;  3I51 A;  4D80 A;  5FTL A;  1K82 A;  5FTM A;  1Z6T A;  3GLI A;  3UJN A;  4JI5 M;  3TMP A;  1HR0 M;  1K3X A;  3VDU A;  3MJ5 A;  2DWM A;  3D8B A;  1C1K A;  3TWM A;  1S3S A;  1DGG A;  2X49 A;  1XMQ M;  4LFB M;  4R3D A;  1QVR A;  1N78 A;  4GIT A;  4RNA A;  2L09 A;  2KZU A;  3U6S A;  3L2A A;  4B3T M;  4XGI A;  2C98 A;  1TGU A;  1IN5 A;  1X37 A;  4JXJ A;  5ITQ A;  3MTV A;  3VKG A;  3O65 A;  4MB7 A;  2L6O A;  3AKZ A;  3GQ4 A;  3TRK A;  4XBO A;  3K1J A;  3VK7 A;  3J7A S;  4GKK M;  4NOO B;  3GRR A;  4WW0 A;  4MGI E;  1IN8 A;  4JYA M;  2R4J A;  4D82 A;  1GVN A;  2FE8 A;  4DV6 M;  3UMM A;  1Z5B A;  2R4E A;  4BLC A;  2XSZ D;  8CAT A;  4GKJ M;  3J7B A;  3CF2 A;  4QOZ C;  5E6J A;  4AKH A;  4G4Q A;  4B3M M;  3AJI B;  4MGZ E;  2F5N A;  1N33 M;  3KW6 A;  4OW0 A;  3RGS A;  3L26 A;  3AV0 A;  1QAO A;  3GRU A;  3SMP A;  1NNU C;  2D7H A;  2EO2 A;  4G4O A;  4B08 A;  4PCZ A;  4LF7 M;  2XF3 A;  1TH3 A;  3ZC7 B;  3R9X B;  3VKH A;  1FJG M;  2BJV A;  2XGN A;  3UK6 A;  3DFZ A;  3SC3 A;  5DYI A;  3SBJ A;  3HWS A;  3I4Y A;  3E4R A;  3NBI A;  3HGI A;  4X65 M;  1JQJ C;  5ITX A;  4EIW A;  3AOG A;  2XFT A;  1XNQ M;  2KZS A;  3OQC A;  4R7G A;  3U6Q A;  5EZQ A;  3AOE C;  2Y0T A;  4GC9 A;  4G6Z A;  2JA2 A;  4X62 M;  3SAW A;  2JTC A;  1JR3 D;  2R18 A;  3HJ8 A;  4AKG A;  3KVW A;  2HL7 A;  3M6A A;  3JR5 A;  4IBC A;  3K2L A;  3T38 A;  3BBA A;  4FWH A;  2YQZ A;  4KOD A;  2CV0 A;  2J7Q A;  3T1Y M;  4LJ9 A;  1L1Z A;  2NQ8 C;  5FLX S;  3GPP A;  4AG5 A;  3PVS A;  3FYD A;  3KP1 E;  4M9S A;  2QBY A;  4NSR A;  4PT5 A;  5EXP A;  4MI7 A;  3KFU G;  1IN4 A;  2DVW B;  4DR3 M;  3QAU A;  4LFA M;  2RGO A;  3TWK A;  1I4W A;  1W5T A;  2V1C A;  2A5Y B;  3DA1 A;  3PNY A;  2FOI C;  4I8O A;  3GLG A;  2ZAN A;  2G5G X;  4LJ8 A;  4JI4 M;  4ZTB A;  4KHP M;  1QQW A;  2Z4S A;  3GLF B;  1PJI A;  4IBF A;  3SAS A;  5H37 D;  4FVM A;  1QZM A;  3U6M A;  1IBM M;  4ITQ A;  2XEP A;  4QOS A;  3SMS A;  5EP4 A;  1IXZ A;  4L78 A;  5ITX E;  2BJW A;  2XLJ A;  3PFI A;  1G8P A;  4DV0 M;  1R2Z A;  3R8F A;  2F5S A;  2QP9 X;  3AFH A;  3FUU A;  1IQP A;  2Q2E B;  2RGH A;  2UXB M;  1PJJ A;  2J7O A;  5ITT A;  2R45 A;  3SAU A;  3U61 A;  3TPZ A;  5EQT A;  4MH0 E;  3KOY E;  3LQQ A;  2AHM A;  1GKI A;  2ERC A;  3WHK A;  4JI1 M;  3SFZ A;  3HU1 A;  2CEA A;  4OVZ A;  3ZCB B;  2L7H A;  3WHL A;  4BOQ A;  5DYG A;  4OX9 M;  4RF1 A;  3MHV C;  3M0E A;  1NJG A;  4BB9 A;  4NSO B;  2EUC A;  3FUT A;  4NXN M;  4LF4 M;  1YZB A;  3IG5 A;  3J81 S;  1QAN A;  3FTC A;  4IBJ A;  2FFJ A;  3TE6 A;  5KPZ A;  4D8E A;  3CTW B;  3HKP A;  2YR0 A;  4NXM M;  1XWI A;  2DZO B;  3L28 A;  2C99 A;  4PD2 A;  2BNK A;  2HCB A;  4AQY M;  3I4V A;  3U60 A;  4M9Z A;  3KP0 E;  1T3T A;  2UZJ A;  2Z84 A;  5KQ8 A;  1XXH B;  2D7E A;  3HJS A;  3RNV A;  3A42 A;  7CAT A;  3U60 B;  5KPT A;  1DGH B;  4QNM A;  3T15 A;  5ITU A;  5DNY A;  5LMN M;  3BY4 A;  4D8B A;  1G59 A;  4IIW A;  4OU7 A;  4FCT A;  3U6L A;  4BBA A;  1L8Q A;  4YHH M;  3LQR A;  4G4R A;  5EP1 A;  4JV5 M;  3FUW A;  4L16 A;  2XZF A;  2D7G A;  2Z3X A;  4DUY M;  3KXE C;  4KO8 A;  4LJ7 A;  3KOW E;  2XH9 A;  2F5P A;  3BOS A;  4LF5 M;  4LF9 M;  1GLN A;  2C5R A;  1SXJ C;  3W0L B;  1R6B X;  3LVV A;  1Z5C A;  3BB7 A;  4CHT B;  3CF0 A;  1J7K A;  3PRP A;  4BOP A;  4IBB A;  1QYR A;  4LF8 M;  3KSX A;  3GQ5 A;  4AZF A;  1J09 A;  1DGB A;  1TDH A;  4IBK A;  2X4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...