5KO3A

Structure of a core papain-like protease of mers coronavirus with utility for structure-based drug design
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
257
structure length
255
Chain Sequence
DETKALKELYGPVDPTFLRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1a
publication title X-ray Structure and Enzymatic Activity Profile of a Core Papain-like Protease of MERS Coronavirus with utility for structure-based drug design.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
total genus 71
structure length 255
sequence length 257
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5ko3A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ko3A02
4RF0A 4OVZA 4M0WA 4PT5A 4R3DA 3MP2A 4P16A 5E6JA 4OVZB 4RNAA 4WURA 4REZA 4OW0A 5KO3A 4RF1A 3E9SA 2FE8A 4MM3B 3MJ5A
chains in the Genus database with same CATH superfamily
4IIWA 3U61B 2DAIA 3F75A 1YLAA 1CUKA 2KRUA 4G4RA 4AZFA 4JI7M 1W5SA 2FOIC 5BR8M 1E32A 2DZNB 3M7GA 4CZWA 1MX0A 2L2DA 3BBZA 3GLHB 2B1NA 3GRVA 2EA0A 2XF3A 3L29A 1QQWA 4HXDB 4GEWA 3SBJA 1TH2A 1OQYA 2R9MA 4GC9A 4YYQA 4RNAA 2Y20A 2LBCA 1WJ7A 4R71A 3KWBX 4P6GA 4FIPA 2C99A 3BPMA 1NNUC 3PFIA 1L1ZA 3N4CA 4XUIA 4L4UA 1PBHA 2FQ9A 4DR7M 4JV5M 1GKIA 3B89A 1X9YA 3IMAA 2GHUA 1NVMA 3HHYA 2XFSA 4K7CA 2CHVA 5EP2A 1QAQA 1PIPA 1W5TA 1DF0A 1Q02A 4B3TM 2DENA 2L7IA 1XNQM 3GQ4A 1YK8A 4YVAA 1D0MA 3CF0A 3SHFA 2BTWA 1IBMM 2WZJA 3KOZE 2JA2A 2HKJA 2C9OA 1XHBA 5DNYA 3QWLA 4LF5M 3B7QA 1QOLA 3N3GA 3M99A 3ZC7B 2Y21A 2YFQA 3MTNA 2F4VM 5JI2E 1MS6A 2X49A 4CGYB 2V1CA 2G8LA 3RVXA 3SATA 1Q3CA 3HJQA 4Z6YA 5EP1A 2R46A 3GP1A 4KO8A 1C1KA 2FRAA 4IUMA 4IBJA 3ZQJA 4JI8M 3CGWA 2UXBM 1P3QQ 1OAIA 1V34A 3E4RA 2CEAA 1PPOA 1KFUL 1PJTA 4LJAA 2DZZA 2XH9A 4HWYA 3TWKA 3W0FA 3OQCA 2AUZA 2DNAA 4B7HA 2DKLA 1GLOA 1H6UA 5IT9S 4B3MM 2XZFA 1YT7A 3RGSA 4FVMA 3CH3X 2G3QA 4BOQA 1QAMA 3SAWA 3MP2A 2JUJA 3UJNA 4LG2A 4FW9A 3BOSA 2M60A 1PADA 2O5RA 2NQ8C 1ATKA 2EJSA 3C3EA 2BU3A 4DMYA 5IZ7D 3CF6E 3GLFB 3VKHA 4DR1M 3PRPA 4QOSA 4AG6A 5FTJA 4N4ZA 2AVWA 2YQZA 5FSWA 2QCUA 1M6DA 4Q8HA 2YJBA 3L27A 1U9XA 1SXJC 4DR4M 2DC8A 2BDLA 4BSQA 1PJQA 4RY2A 4KLNA 5CHTA 3D8BA 2CV1A 1CVZA 3S3QA 2LXEA 4NL4H 1LV7A 2QBYB 4I05A 1QMYA 3KOWE 3A45A 2CWBA 4DV7M 2XU1A 1SG9A 1MIRA 5ITYA 2OULA 4LY6A 3AI8A 3GPXA 4LF7M 3W0LB 3P5WA 5ITTA 1IXZA 1OIPA 2ZTCA 3BOWA 2K0BX 3FRIA 4DR5M 2L6OA 1NQCA 3GQ3A 4YYUA 3O0UA 3SC3A 4M0WA 3E1ZB 2JY6B 3HKPA 2FO5A 1PE6A 4GKJM 3RVWA 2XU4A 3JAMS 4IBBA 5DYGA 3HU2A 4NSOB 4B7GA 3HHIA 2E00A 3HJ8A 3KOXE 3SAUA 1KFVA 4B3RM 2DOSA 4X6JA 1MN3A 2BWEA 1D0LA 3PNRA 4P16A 2AYNA 4QNMA 5EXPA 1R6BX 3WXGA 3L26A 5KO3A 2DI0A 4MGIE 4DR2M 2FE8A 1ITOA 3R8FA 2H5XA 1HQYE 3NBIA 4JN6A 1NB3A 1NV9A 4FWGA 4BOPA 1HNXM 2AYOA 1GABA 2CRUA 4LJ7A 4M0DA 1IXSA 4I4LA 1NPZA 1L2DA 2HHHM 2XGNA 5ITQA 1I4WA 1EWMA 1VSNA 1NV8A 1R2YA 1OIZA 1HNWM 4DV5M 5C18A 4AXLA 1NHWC 5EZSA 4X62M 1Y4HA 2A5YB 2OOBA 2JRIA 5E6JA 4KHPM 1QDTA 2QNJA 3U61A 3AJIB 2DWLA 3PXGA 2ERCA 2PREA 1KYIA 1TF0B 3GLHE 5EF4A 2BJVA 2MGWA 3HY5A 2G8JA 1XKGA 2LVPC 1FH0A 3GO8A 2NQAA 3GLHA 1F29A 2FH0A 1V33A 5JA7A 1TU6A 3O65A 2AHMA 3FUUA 4NRWA 3W67A 2I7PA 2NQDB 1Z5CA 2HWJA 1ZIVA 2XZUA 1K82A 2GFOA 3V6CA 4IJFA 4PT5A 5JI3E 2HWKA 1PJIA 5K16A 3PT2A 1QZEA 2E03A 4LF4M 3IEJA 2DHRA 4MB7A 3HX3A 3MHVC 3WHLA 1XMQM 3K9OA 4LJ5A 1FNNA 3H8CA 1EWOA 2C5RA 3GPUA 3KX1A 1NNJA 2UXCM 2OZ2A 2R62A 4CDDB 4YY3M 2C0YA 4WW0A 4REZA 3PHXA 4G6ZA 2L4EA 3EIHA 3E46A 2LHCA 3I4YA 3DF0A 3HU3A 3W30A 1LTMA 7PCKA 1L8QA 4IBFA 3AOGA 2NQIA 3FD9A 3BXWA 1R7RA 3E9SA 1K3BB 1TL9A 4MH0E 4GHLA 1VEJA 3C0RA 3P5UA 3HHXA 4W5CA 2VF8A 3U6OA 3HU1A 1NLJA 3KFUG 1CS8A 3T38A 1IQPA 5F3WA 2OOAA 5EXSA 1IY2A 1E9RA 2QSFX 4IJEA 4NRVA 1PPPA 1YZBA 4AI6A 3JR5A 1A6RA 3F5VA 1MDWA 1Z5AA 2AIMA 2PBHA 3M0EA 4LFCM 3S3RA 1IXSB 2Z4SA 5CHVA 4B7FA 1PVJA 1XC8A 2UUCM 2YNMD 3HWNA 1BGOA 4GUAA 1GMYA 4FJCA 4AQYM 3GLFE 2RKOA 3H89A 4LJ6A 4LRTA 2UU9M 4DMXA 1G41A 2O6XA 1E94E 3FUTA 1OTRA 3MJ5A 2FTDA 4A3VB 1NSFA 1L2CA 3GLFA 3FYCA 3N3KA 4P17A 2YJ2A 2DCBA 4M9SA 4YYRA 1AIMA 3LFYA 2UUAM 4I5SA 1TGUA 4RF1A 1AUAA 3KSEA 1YALA 2MJ5B 4BPVA 1HT2E 4K0KM 1YVBA 1GLNA 3J80S 3VDUA 4I04A 1SXJD 3M6AA 2QBYA 3DA1A 2JTCA 4GMQA 4AKGA 2WSFF 2F1GA 3OVZA 1D0KA 5KPZA 1C7YA 5ITRA 2DZYA 4ANRA 2CP8A 2HH5A 4MGKE 4BQVA 3AKZA 1DGFA 2R4JA 3GRYA 1PGYA 5JH3A 4OELA 1AU2A 4G4OA 1UM8A 2N35A 4LF6M 5LMUM 2RRUA 2W82A 3T1HM 4IBDA 2KA6B 1TH4A 2QENA 4QOZC 2KNAA 3BY4A 2NQGA 1VJVA 2CE7A 2D7GA 5BPVA 1L2BA 2DCDA 3GPYA 4D8EA 1S3SA 3AFHA 1AYVA 5FTMA 3GCBA 2HL7A 1GO5A 1IM2A 4QRVA 1U9VA 3L28A 2ZBKB 3HWSA 2YR0A 3AL0C 4W5BA 5LMNM 1NB5A 5FTNA 4QHSA 4BBAA 4MZSA 2OQ4A 3WHKA 2K6BA 3USVA 4I81A 3SARA 2HXZA 2KXEA 3CH2X 4CDCB 4JI4M 5H37D 1D2NA 1MU5A 2JQGR 3SFZA 1QZMA 3SYLA 1WHCA 3UGJA 1ZMUA 1AU3A 2YJCA 4MI7A 5CVMA 4W5WA 3GLIE 1K3WA 3LW5F 1EF7A 1Y8GA 3IV2A 1MJGM 4PD2A 1GCBA 4IBIA 3OVXA 4QRXA 2J7QA 4BB9A 3RFWA 1L1TA 3LCUA 3TE6A 4OX9M 3K8ZA 1GL7A 4AKIA 3GLIA 4ITQA 1QVRA 3K92A 1G3IA 1R5LA 4LCBA 4OVZB 3T6PA 2QHOB 3B7NA 1KXRA 4GKKM 2UUBM 1IN8A 2MH8A 3I51A 2VDBB 3SASA 3B9PA 1U9QX 3JR4A 1O0EA 3RE8A 2C96A 1CSBB 2CUZA 1KFXL 3SMSA 3MHSA 2R18A 1VDDA 2FT2A 2VF7A 4L16A 3GPPA 2P86A 1TDHA 2JZ0A 3P5XA 2BDZA 3LQRA 2KW0A 1NJGA 2G8EA 3B21A 3B79A 2DXIA 1IWDA 3U60B 3QYBA 1F2AA 4GHAA 2F5OA 1AU4A 4BLCA 1NHGC 4PDGA 2DAGA 3I01M 4NSRA 2R9OA 4YYSA 3KP1E 3OISA 4MGHA 4JXJA 2K47A 4X6IA 1IN4A 1CB5A 3BC3A 2O01F 4MGZE 3WXFA 3I06A 4NOOB 3Q8XA 1ZV1A 4XBOA 1J09A 2DZLA 2P7UA 2Y0TA 4GIPA 5IWAM 1N77A 4YHHM 3QYEA 2VQEM 3PVSA 3SHGB 1Q3BA 3AV0A 4N8WA 3BBAA 1VQ1A 1QANA 2BNKA 1SP4B 4YYWA 3UMMA 3H7DA 3RVVA 4PCZA 1PCIA 3F92A 4ZUXU 3KDSE 4YYVA 4CISA 1ZAEA 3U6EA 2R65A 2APLA 1GL6A 2LVOC 2R0IA 5ITXE 9PAPA 4Y28F 3HZJA 3CTWB 2ARYA 1GVNA 5A24A 5EJCA 1N34M 1CPJA 4LF9M 5EXXA 1U9WA 5ITXA 4DV2M 4X66M 1XB2B 1Z59A 2MR9A 3P5VA 1WGNA 3FUXA 2EUCA 4XK8F 4DV3M 2DAKA 3UK6A 4CDFB 1Z5BA 2CV2A 2V1UA 4FWHA 3U5ZB 2F7DA 3L2AA 4LGYA 4A5UA 3V6EA 4L6V6 3U6PA 4B08A 2C98A 2E02A 1IBLM 3GLIB 1N36M 4MZOA 2Y5BA 3K8UA 1ME4A 3KSXA 4LJ4A 1IY0A 3BWKA 3SAVA 1WIVA 3IHPA 5KPTA 3IECA 1DKIA 2LHGA 1F2BA 3H4MA 2B1MA 4GITA 8PCHA 2ZAMA 1WXQA 2IPPB 1T6OA 3DZDA 3B7ZA 3TL4X 4HLQA 3MORA 1EE8A 3KW9A 1XNRM 5CVOB 3U6LA 3GQ5A 4CIZA 3I04M 2O25A 4NC6A 1G8PA 4OU7A 1SNKA 3EIEA 3A46A 3IG5A 3FTEA 3IG8A 5ITUA 2EO2A 2JZ1A 5JZEA 5EP4A 1EWLA 4PI3A 4CDEB 1ZCMA 1VEGA 4MGYE 3AOEA 3VK7A 2G7YA 1IXRC 3R9XB 3KXEC 1DGBA 2XFTA 4FWDA 3ZCBB 4FCVA 4PP2E 2DCCA 1AYWA 4RF0A 4Q7JA 3ZH9B 2BJWA 2MROB 1PM5A 2XU3A 3LQQA 1CTEA 3RGPA 4LJ8A 1K3XA 3NBXX 1OAOC 3A42A 4F2LA 4LFAM 1OFHA 3J81S 1TDZA 1JR3E 2AS8A 1Z6TA 1ZQ9A 4PP1A 2J7QC 1OFIA 1AECA 3HJSA 2XEPA 1TR8A 3K1JA 1JR3A 2KZUA 3MK6A 1GJTA 4GH9A 4KODA 2IBIA 4HL4A 1N78A 2Z4RA 1PXVA 2R6NA 3OF8A 2OP3A 2EKFA 4P6EA 1DGHB 3ZUAA 1BP4A 2J7NA 2LVAA 1CJLA 4DV0M 5FLXS 4QRGA 2UXDM 2KDLA 1X37A 4OVZA 4TUWA 4G3OA 4D82A 3U6SA 2H1RA 3FUWA 2LNHC 3C3DA 4IP3A 2PADA 1VG5A 2CHQA 1STFE 2FRQA 3FE3A 2R9FA 1UKFA 3UZUA 1IFYA 4S12A 4F1IA 2VIIA 3KOYE 4OEMA 2R6FA 2ZM6M 5E26A 3TWLA 3E21A 2FFJA 1E9SA 1QAOA 3QT4A 3T1YM 4MM3B 1NJFA 2WBFX 4ZPXA 1Q6KA 4L78A 2F5NA 4M9ZA 3U60A 4II7A 3VK8A 1XXHB 2YJ8A 1R2ZA 1EIJA 4AW4A 4CHTB 1G4AE 4JI6M 2FS1A 2UZJA 1G71A 1G59A 3BPFA 4DV1M 1HUCB 2JXNA 4NXNM 3U6QA 1HT1E 3PRMA 3QJ3A 3C58A 4DR3M 2DZOB 1F2CA 3U8EA 3NWLA 2ZANA 2DC7A 1JQPA 1AYUA 2P5TA 1NL6A 1OKSA 2DCAA 4WA6A 4X65M 5FTKA 2R9CA 1S4VA 1KHQA 2CIOA 3FUVA 3IOQA 3BB7A 2JQFR 3W31A 2Z84A 1SXJB 3T15A 4KLBA 3DOAA 4DUZM 2HCBA 1YSYA 2LTUA 1N33M 4R7GA 2E5LM 2R9NA 4AG5A 2Z7JA 2YJ9A 3J27B 2LVNC 2JY7A 1JR3D 4JI2M 3J7BA 3BCNA 2R4EA 2KZSA 4I07A 4LRSA 3HGIA 3H6SA 3KKUA 1JB0F 4DV6M 5EZQA 1DV0A 2OO9A 4QBBA 4DV4M 2CV0A 3H4JA 1IN6A 1YK7A 1WR1B 4HEOA 1JQJC 1BVSA 1QDQA 2Y6EA 3V76A 1DEUA 2ATOA 1KSFX 3ERVA 5CVNB 2R45A 4LZJA 1R4GA 1UFZA 4FCWA 3PDFA 3GRUA 4RKXA 3IUTA 2ACTA 3K24A 2QZ4A 4DR6M 1TTEA 2X4AA 3U5ZA 3OF9A 4UN2B 1XWIA 2X8AA 2KNVA 5EGWA 3KSJA 1EWPA 2FYEA 3U6CA 1GECE 1ZMWA 4IBEA 2E01A 1YE9A 3GLGE 4L8RC 3CF2A 3K2LA 4OW0A 4RKUF 2Y0QA 4GRIA 2CFOA 1J7KA 2KEBA 3C9EA 5J94A 1XMOM 4LF8M 2Z8YM 8CATA 3QSDA 4BOSA 2F5QA 3TNXA 2KRKA 3J7AS 4W4UA 4N79A 5DFLA 3GLGA 2CHGA 2DC6A 1Q39A 3DFZA 1HR0M 1PJSA 3KW6A 2XU5A 2G5GX 5FPWA 2P0RA 2VHFA 2ZTDA 4X6HA 3AOEC 2AUXA 2G6DA 3VLFB 4X64M 1IN5A 4WP2A 4MSXA 1TH3A 2B3TA 4JI1M 3GRRA 2V6ZM 5IREB 2J7OA 2DVWB 1FJGM 5EXTA 4LZZA 5EP3A 2GNOA 7CATA 4I8OA 5KQDA 1U5IA 1DO0A 4IBGA 4IBKA 3KVWA 2F5PA 5GKNA 3MTVA 2FNAA 2K9DA 3D6SA 2DAMA 4BOZA 2CB5A 4KT0F 1OJLA 1AIPC 3LVWA 4JI0M 2HD5A 2JWSA 4FCTA 5PADA 2D7HA 2D7EA 3CBJA 2M5ZA 3LMMA 5DYIA 2BTWB 4FD2A 4CJ6A 1QUTA 3B74A 4XR7A 2AU1A 3VKGA 3QAUA 2DWMA 1ORYB 2L4FA 3PNYA 3FTDA 1HJPA 1PJJA 5F02A 4XGIA 1AU0A 2DJGB 3MHHA 1EFUB 1QXPA 4G54A 2F5SA 1I94M 4D81A 2C9CA 1YUBA 5C1BA 2FUDA 1IY1A 2XSZA 1WGLA 4IBCA 4G4NA 4ZTBA 1DGHA 2RGOA 4BS6A 1PPNA 4XZXA 1NY5A 4BOUA 3FYDA 4LFBM 3HHZA 3FKEA 3TRKA 2J5YA 1J5EM 2R44A 4LGMA 2Z3XA 2DJFB 4R3DA 3VDPA 3L25A 3HHAA 3FTFA 2HHNA 2DHYA 3RNVA 3O1GA 1THEA 4QNRA 1PRBA 1A5TA 1BQIA 1ZMVA 5KQ8A 1KHPA 2DC9A 2QPAA 1XXHE 1VEKA 3CBKA 4Z8XA 2Q2EB 3I4VA 3IFUA 4AXMA 5FTLA 3GLGB 3TQSA 4JYAM 4EIWA 1HQCA 4QH6A 2OPFA 3NHEA 3PHWA 2L7HA 3TWMA 2BWBA 1XXHA 3C9PA 1Y08A 2WSCF 3TMPA 2AGAA 3D8LA 3W68A 3U6MA 2L09A 1NO1A 4DUYM 2PNSA 3PNVA 2VHSA 5L8RF 2JY8A 3SMPA 1SXJE 2RGHA 1CV8A 4D8BA 3PHUA 2GQFA 4JI5M 4D80A 4GC5A 1QUSA 3H8BA 2QQ8A 1SXJA 1N75A 4L15A 2DWNA 1ICFA 4G4QA 3I3TA 3THGA 3KFQA 5A2QS 2HAKA 1BY8A 2KNZA 2XLJA 2LWXA 3VFDA 3J2PB 1ME3A 1PPDA 4YV8A 3MMPA 4DBGB 2ZAOA 5KPRA 4QHTA 2XSZD 2KHHA 3KS8A 3K9MA 3HD3A 3LCVB 4PDIA 1VDLA 3SYKA 2VQFM 4LJ9A 1IN7A 2EKKA 3OTOM 4PADA 2I7NA 3KS4A 1MHWA 3LVVA 3FTCA 3PSEA 2LVQD 3U6DA 1GJSA 4M9XA 3PW3A 3WXEA 2JNHA 3PBHA 3LXSA 1N32M 3TPZA 3KP0E 1V92A 3Q8GA 1T3TA 4D8IA 3ILKA 4Q8GA 1QYRA 2DAEA 2QP9X 4WURA 4B3SM 3A98B 1MEGA 5EQTA 1NY6A 1F4IA 1T43A 2DWZB 2LH0A 4NXMM 1MEMA 4BS5A 4JI3M 3K9PA 4AKHA 1TLOA 3HHWA 6PADA 2H7JA 1CQDA 1DO2A 1HNZM 2JY5A 2WSEF 1RU3A 1IBKM 3FRHA 4FK5A 1POPA 1DGGA 3KWZA 3ZNHA 1QDRA 2JP7A
chains in the Genus database with same CATH topology
4IIWA 3U61B 4GIPA 5IWAM 1FNNA 4YHHM 1N77A 4FCWA 2VQEM 2C5RA 3PVSA 2KRUA 3GRUA 4G4RA 4AZFA 3GPUA 4RKXA 3SHGB 1NNJA 1Q3BA 4JI7M 1W5SA 2UXCM 2R62A 2FOIC 3AV0A 5BR8M 4YY3M 4WW0A 3BBAA 2QZ4A 4REZA 4DR6M 2X4AA 1QANA 1E32A 2BNKA 3U5ZA 3PHXA 1XWIA 3UMMA 2X8AA 2DZNB 3M7GA 1MX0A 4G6ZA 3GLHB 4PCZA 3GRVA 3KSJA 2EA0A 2XF3A 3EIHA 3L29A 1QQWA 3U6CA 4HXDB 3SBJA 1TH2A 3KDSE 4CISA 3I4YA 1ZAEA 4IBEA 3U6EA 2R65A 4GC9A 1YE9A 3HU3A 1GL6A 3W30A 4RNAA 1L8QA 4IBFA 4L8RC 2Y20A 3AOGA 3CF2A 3K2LA 4OW0A 5ITXE 3FD9A 2Y0QA 4GRIA 1R7RA 2CFOA 3E9SA 1J7KA 2KEBA 1XMOM 4LF8M 8CATA 4BOSA 2F5QA 4MH0E 2KRKA 3J7AS 2C99A 3CTWB 4GHLA 1GVNA 3C0RA 1NNUC 3HHXA 3U6OA 3PFIA 5EJCA 1N34M 1L1ZA 4L4UA 3HU1A 3GLGA 4LF9M 5EXXA 2CHGA 5ITXA 4DR7M 4DV2M 4X66M 4JV5M 1Z59A 1GKIA 1Q39A 3KFUG 3DFZA 1HR0M 3FUXA 2EUCA 4DV3M 3KW6A 1NVMA 3HHYA 2XFSA 2G5GX 3T38A 1IQPA 3UK6A 2CHVA 5F3WA 1Z5BA 5EP2A 2CV2A 1QAQA 2V1UA 4FWHA 3U5ZB 1W5TA 5EXSA 4B3TM 1IY2A 1E9RA 3L2AA 4IJEA 4NRVA 2L7IA 3AOEC 1YZBA 4AI6A 4LGYA 3VLFB 3JR5A 1XNQM 4A5UA 4X64M 1IN5A 3U6PA 3GQ4A 4B08A 1TH3A 2C98A 1Z5AA 3CF0A 4JI1M 3SHFA 3GRRA 3GLIB 1IBLM 2V6ZM 1N36M 2BTWA 1IBMM 3M0EA 3KOZE 5IREB 2JA2A 4LFCM 2HKJA 3KSXA 2C9OA 4LJ4A 1IY0A 1XHBA 2J7OA 5DNYA 2DVWB 3QWLA 3SAVA 1FJGM 1IXSB 4LF5M 2Z4SA 4B7FA 5KPTA 1PVJA 1XC8A 1DKIA 3ZC7B 2Y21A 3H4MA 2UUCM 4GITA 2YFQA 2F4VM 2YNMD 5EXTA 5JI2E 2ZAMA 1WXQA 4LZZA 5EP3A 4GUAA 2X49A 7CATA 4CGYB 2V1CA 2G8LA 3DZDA 4AQYM 2RKOA 3TL4X 4LJ6A 4LRTA 4HLQA 2UU9M 4I8OA 5KQDA 3SATA 1DO0A 1Q3CA 3HJQA 4IBGA 4IBKA 4Z6YA 1EE8A 3KVWA 2F5PA 5EP1A 2R46A 5GKNA 3GP1A 4KO8A 1C1KA 3MTVA 2FNAA 1G41A 1XNRM 4IUMA 1E94E 4IBJA 3U6LA 3FUTA 3MJ5A 3GQ5A 4JI8M 4BOZA 4A3VB 1NSFA 1L2CA 3GLFA 3FYCA 2UXBM 1OJLA 1G8PA 4OU7A 3LVWA 3E4RA 3EIEA 4JI0M 3A46A 2CEAA 3IG5A 4M9SA 4FCTA 2D7HA 2UUAM 4I5SA 4LJAA 2D7EA 1TGUA 4RF1A 3FTEA 2M5ZA 2XH9A 3LMMA 5DYIA 3TWKA 3W0FA 2BTWB 3OQCA 4FD2A 4B7HA 3IG8A 1H6UA 5IT9S 4B3MM 2XZFA 1HT2E 3RGSA 5ITUA 2EO2A 3VKGA 3QAUA 4K0KM 4FVMA 1GLNA 5JZEA 3J80S 3VDUA 5EP4A 4BOQA 1QAMA 2DWMA 1ORYB 3SAWA 3PNYA 3FTDA 1SXJD 3MP2A 1PJJA 3M6AA 4MGYE 3UJNA 4XGIA 4LG2A 2QBYA 3AOEA 3VK7A 1IXRC 3DA1A 4FW9A 3BOSA 3R9XB 2JTCA 4GMQA 2F5SA 1I94M 4AKGA 2M60A 3KXEC 4D81A 2O5RA 5KPZA 1DGBA 2NQ8C 2C9CA 1YUBA 5C1BA 2XFTA 4FWDA 2BU3A 5ITRA 3ZCBB 4FCVA 1IY1A 4RF0A 5IZ7D 2XSZA 3CF6E 4MGKE 4IBCA 4G4NA 4ZTBA 3ZH9B 2BJWA 3GLFB 1DGHA 4DR1M 3AKZA 3VKHA 3PRPA 1DGFA 2RGOA 4QOSA 2R4JA 3GRYA 1PM5A 4AG6A 4XZXA 5FTJA 3LQQA 1NY5A 2YQZA 4BOUA 3RGPA 3FYDA 5FSWA 1UM8A 4G4OA 4LJ8A 1K3XA 3HHZA 4LFBM 2QCUA 4LF6M 5LMUM 3L27A 3A42A 3FKEA 3TRKA 1J5EM 2W82A 4LFAM 1OFHA 1SXJC 3J81S 3T1HM 1TDZA 4IBDA 4LGMA 4DR4M 1Z6TA 2KA6B 1TH4A 1ZQ9A 2Z3XA 2QENA 4QOZC 2J7QC 1OFIA 3BY4A 4KLNA 4R3DA 3VDPA 3D8BA 3L25A 2CV1A 3HJSA 2XEPA 2CE7A 2D7GA 3FTFA 5BPVA 1L2BA 2LXEA 3GPYA 3K1JA 3RNVA 1JR3A 4NL4H 2KZUA 1LV7A 4D8EA 1S3SA 3AFHA 2QBYB 3KOWE 4QNRA 3A45A 5FTMA 3MK6A 4DV7M 2HL7A 5ITYA 5KQ8A 4GH9A 2QPAA 4KODA 4Z8XA 2Q2EB 1IM2A 3I4VA 4HL4A 3IFUA 1N78A 2Z4RA 3L28A 2ZBKB 4LY6A 3HWSA 3GPXA 4LF7M 3W0LB 5ITTA 1IXZA 5FTLA 3GLGB 3TQSA 4JYAM 4EIWA 1HQCA 2YR0A 2OPFA 3PHWA 1DGHB 2L7HA 3AL0C 3TWMA 5LMNM 1XXHA 2J7NA 5FTNA 4QHSA 4DR5M 4BBAA 4DV0M 2OQ4A 3WHKA 2L6OA 5FLXS 4I81A 3GQ3A 3SARA 3TMPA 2AGAA 3D8LA 2UXDM 1X37A 4OVZA 3SC3A 3U6MA 4TUWA 2L09A 4M0WA 4DUYM 4D82A 2KXEA 3U6SA 3HKPA 3PNVA 4GKJM 2H1RA 4JI4M 3FUWA 2LNHC 5H37D 3SMPA 4IP3A 3JAMS 2CHQA 1SXJE 2RGHA 4IBBA 1D2NA 1MU5A 1UKFA 3SFZA 1QZMA 3SYLA 5DYGA 3HU2A 4NSOB 4B7GA 4D8BA 3UZUA 4S12A 3UGJA 2VIIA 3KOYE 3HJ8A 3KOXE 3PHUA 3SAUA 4JI5M 4D80A 1KFVA 2ZM6M 5E26A 4B3RM 2DOSA 3TWLA 4MI7A 4GC5A 4W5WA 4P16A 2FFJA 1K3WA 1SXJA 1E9SA 4QNMA 1QAOA 1N75A 3T1YM 5EXPA 1R6BX 3L26A 4L15A 4PD2A 5KO3A 2DWNA 4IBIA 4MGIE 2J7QA 4DR2M 2FE8A 4MM3B 1NJFA 4G4QA 4ZPXA 4BB9A 3RFWA 4L78A 3THGA 1L1TA 3R8FA 2F5NA 4M9ZA 3U60A 1HQYE 4II7A 3VK8A 3TE6A 4OX9M 3K8ZA 3NBIA 1GL7A 5A2QS 4AKIA 4JN6A 1XXHB 4FWGA 3GLIA 1R2ZA 4ITQA 4AW4A 1QVRA 3K92A 4CHTB 1HNXM 4BOPA 1G3IA 1G4AE 4JI6M 2UZJA 1G59A 2XLJA 4LCBA 4LJ7A 4DV1M 2LWXA 3VFDA 4OVZB 4M0DA 4NXNM 3J2PB 1HT1E 3U6QA 3PRMA 4I4LA 3C58A 4DR3M 2DZOB 1L2DA 4GKKM 2UUBM 3NWLA 2ZANA 1IN8A 2HHHM 2XGNA 5ITQA 1I4WA 3I51A 3SASA 3B9PA 2P5TA 1R2YA 2ZAOA 5KPRA 4QHTA 3JR4A 2XSZD 1HNWM 3RE8A 4DV5M 2C96A 3KS8A 5C18A 4PDIA 1NHWC 5EZSA 3SYKA 4X65M 4X62M 2A5YB 4LJ9A 1IN7A 2VQFM 2CUZA 2JRIA 3SMSA 3OTOM 5E6JA 5FTKA 2I7NA 3KS4A 2R18A 1VDDA 3FUVA 4L16A 3BB7A 3LVVA 3GPPA 4KHPM 3W31A 3FTCA 3PSEA 3U61A 3U6DA 3AJIB 2Z84A 1TDHA 1SXJB 3T15A 2DWLA 3LQRA 2ERCA 3DOAA 4M9XA 3PXGA 2KW0A 1NJGA 1KYIA 4DUZM 2HCBA 3B21A 1YSYA 1N33M 2BJVA 1N32M 4R7GA 2DXIA 3TPZA 2E5LM 3KP0E 3U60B 4AG5A 2Z7JA 1T3TA 4D8IA 3ILKA 3J27B 1QYRA 4GHAA 2QP9X 4WURA 2F5OA 3GO8A 4BLCA 1NHGC 1JR3D 3GLHA 4B3SM 3A98B 4PDGA 4JI2M 3J7BA 5EQTA 3O65A 1NY6A 2AHMA 2KZSA 2R4EA 3FUUA 4NRWA 4LRSA 3HGIA 2I7PA 4NSRA 2DWZB 1Z5CA 4DV6M 3KP1E 2LH0A 5EZQA 4NXMM 2XZUA 1K82A 4JI3M 4MGHA 4JXJA 2K47A 4DV4M 2CV0A 4AKHA 1IN4A 3HHWA 1IN6A 4IJFA 4PT5A 1DO2A 1HNZM 5JI3E 2HWKA 4MGZE 1PJIA 1JQJC 3PT2A 1IBKM 4LF4M 4NOOB 3Q8XA 2DHRA 1DGGA 4MB7A 3ZNHA 4XBOA 1J09A 1KSFX 3MHVC 3WHLA 1XMQM 2R45A 4LZJA 4LJ5A 2Y0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RF0 A;  4OVZ A;  4M0W A;  4PT5 A;  4R3D A;  3MP2 A;  4P16 A;  5E6J A;  4OVZ B;  4RNA A;  4WUR A;  4REZ A;  4OW0 A;  5KO3 A;  4RF1 A;  3E9S A;  2FE8 A;  4MM3 B;  3MJ5 A; 
#chains in the Genus database with same CATH topology
 4IIW A;  3U61 B;  2DAI A;  3F75 A;  1YLA A;  1CUK A;  2KRU A;  4G4R A;  4AZF A;  4JI7 M;  1W5S A;  2FOI C;  5BR8 M;  1E32 A;  2DZN B;  3M7G A;  4CZW A;  1MX0 A;  2L2D A;  3BBZ A;  3GLH B;  2B1N A;  3GRV A;  2EA0 A;  2XF3 A;  3L29 A;  1QQW A;  4HXD B;  4GEW A;  3SBJ A;  1TH2 A;  1OQY A;  2R9M A;  4GC9 A;  4YYQ A;  4RNA A;  2Y20 A;  2LBC A;  1WJ7 A;  4R71 A;  3KWB X;  4P6G A;  4FIP A;  2C99 A;  3BPM A;  1NNU C;  3PFI A;  1L1Z A;  3N4C A;  4XUI A;  4L4U A;  1PBH A;  2FQ9 A;  4DR7 M;  4JV5 M;  1GKI A;  3B89 A;  1X9Y A;  3IMA A;  2GHU A;  1NVM A;  3HHY A;  2XFS A;  4K7C A;  2CHV A;  5EP2 A;  1QAQ A;  1PIP A;  1W5T A;  1DF0 A;  1Q02 A;  4B3T M;  2DEN A;  2L7I A;  1XNQ M;  3GQ4 A;  1YK8 A;  4YVA A;  1D0M A;  3CF0 A;  3SHF A;  2BTW A;  1IBM M;  2WZJ A;  3KOZ E;  2JA2 A;  2HKJ A;  2C9O A;  1XHB A;  5DNY A;  3QWL A;  4LF5 M;  3B7Q A;  1QOL A;  3N3G A;  3M99 A;  3ZC7 B;  2Y21 A;  2YFQ A;  3MTN A;  2F4V M;  5JI2 E;  1MS6 A;  2X49 A;  4CGY B;  2V1C A;  2G8L A;  3RVX A;  3SAT A;  1Q3C A;  3HJQ A;  4Z6Y A;  5EP1 A;  2R46 A;  3GP1 A;  4KO8 A;  1C1K A;  2FRA A;  4IUM A;  4IBJ A;  3ZQJ A;  4JI8 M;  3CGW A;  2UXB M;  1P3Q Q;  1OAI A;  1V34 A;  3E4R A;  2CEA A;  1PPO A;  1KFU L;  1PJT A;  4LJA A;  2DZZ A;  2XH9 A;  4HWY A;  3TWK A;  3W0F A;  3OQC A;  2AUZ A;  2DNA A;  4B7H A;  2DKL A;  1GLO A;  1H6U A;  5IT9 S;  4B3M M;  2XZF A;  1YT7 A;  3RGS A;  4FVM A;  3CH3 X;  2G3Q A;  4BOQ A;  1QAM A;  3SAW A;  3MP2 A;  2JUJ A;  3UJN A;  4LG2 A;  4FW9 A;  3BOS A;  2M60 A;  1PAD A;  2O5R A;  2NQ8 C;  1ATK A;  2EJS A;  3C3E A;  2BU3 A;  4DMY A;  5IZ7 D;  3CF6 E;  3GLF B;  3VKH A;  4DR1 M;  3PRP A;  4QOS A;  4AG6 A;  5FTJ A;  4N4Z A;  2AVW A;  2YQZ A;  5FSW A;  2QCU A;  1M6D A;  4Q8H A;  2YJB A;  3L27 A;  1U9X A;  1SXJ C;  4DR4 M;  2DC8 A;  2BDL A;  4BSQ A;  1PJQ A;  4RY2 A;  4KLN A;  5CHT A;  3D8B A;  2CV1 A;  1CVZ A;  3S3Q A;  2LXE A;  4NL4 H;  1LV7 A;  2QBY B;  4I05 A;  1QMY A;  3KOW E;  3A45 A;  2CWB A;  4DV7 M;  2XU1 A;  1SG9 A;  1MIR A;  5ITY A;  2OUL A;  4LY6 A;  3AI8 A;  3GPX A;  4LF7 M;  3W0L B;  3P5W A;  5ITT A;  1IXZ A;  1OIP A;  2ZTC A;  3BOW A;  2K0B X;  3FRI A;  4DR5 M;  2L6O A;  1NQC A;  3GQ3 A;  4YYU A;  3O0U A;  3SC3 A;  4M0W A;  3E1Z B;  2JY6 B;  3HKP A;  2FO5 A;  1PE6 A;  4GKJ M;  3RVW A;  2XU4 A;  3JAM S;  4IBB A;  5DYG A;  3HU2 A;  4NSO B;  4B7G A;  3HHI A;  2E00 A;  3HJ8 A;  3KOX E;  3SAU A;  1KFV A;  4B3R M;  2DOS A;  4X6J A;  1MN3 A;  2BWE A;  1D0L A;  3PNR A;  4P16 A;  2AYN A;  4QNM A;  5EXP A;  1R6B X;  3WXG A;  3L26 A;  5KO3 A;  2DI0 A;  4MGI E;  4DR2 M;  2FE8 A;  1ITO A;  3R8F A;  2H5X A;  1HQY E;  3NBI A;  4JN6 A;  1NB3 A;  1NV9 A;  4FWG A;  4BOP A;  1HNX M;  2AYO A;  1GAB A;  2CRU A;  4LJ7 A;  4M0D A;  1IXS A;  4I4L A;  1NPZ A;  1L2D A;  2HHH M;  2XGN A;  5ITQ A;  1I4W A;  1EWM A;  1VSN A;  1NV8 A;  1R2Y A;  1OIZ A;  1HNW M;  4DV5 M;  5C18 A;  4AXL A;  1NHW C;  5EZS A;  4X62 M;  1Y4H A;  2A5Y B;  2OOB A;  2JRI A;  5E6J A;  4KHP M;  1QDT A;  2QNJ A;  3U61 A;  3AJI B;  2DWL A;  3PXG A;  2ERC A;  2PRE A;  1KYI A;  1TF0 B;  3GLH E;  5EF4 A;  2BJV A;  2MGW A;  3HY5 A;  2G8J A;  1XKG A;  2LVP C;  1FH0 A;  3GO8 A;  2NQA A;  3GLH A;  1F29 A;  2FH0 A;  1V33 A;  5JA7 A;  1TU6 A;  3O65 A;  2AHM A;  3FUU A;  4NRW A;  3W67 A;  2I7P A;  2NQD B;  1Z5C A;  2HWJ A;  1ZIV A;  2XZU A;  1K82 A;  2GFO A;  3V6C A;  4IJF A;  4PT5 A;  5JI3 E;  2HWK A;  1PJI A;  5K16 A;  3PT2 A;  1QZE A;  2E03 A;  4LF4 M;  3IEJ A;  2DHR A;  4MB7 A;  3HX3 A;  3MHV C;  3WHL A;  1XMQ M;  3K9O A;  4LJ5 A;  1FNN A;  3H8C A;  1EWO A;  2C5R A;  3GPU A;  3KX1 A;  1NNJ A;  2UXC M;  2OZ2 A;  2R62 A;  4CDD B;  4YY3 M;  2C0Y A;  4WW0 A;  4REZ A;  3PHX A;  4G6Z A;  2L4E A;  3EIH A;  3E46 A;  2LHC A;  3I4Y A;  3DF0 A;  3HU3 A;  3W30 A;  1LTM A;  7PCK A;  1L8Q A;  4IBF A;  3AOG A;  2NQI A;  3FD9 A;  3BXW A;  1R7R A;  3E9S A;  1K3B B;  1TL9 A;  4MH0 E;  4GHL A;  1VEJ A;  3C0R A;  3P5U A;  3HHX A;  4W5C A;  2VF8 A;  3U6O A;  3HU1 A;  1NLJ A;  3KFU G;  1CS8 A;  3T38 A;  1IQP A;  5F3W A;  2OOA A;  5EXS A;  1IY2 A;  1E9R A;  2QSF X;  4IJE A;  4NRV A;  1PPP A;  1YZB A;  4AI6 A;  3JR5 A;  1A6R A;  3F5V A;  1MDW A;  1Z5A A;  2AIM A;  2PBH A;  3M0E A;  4LFC M;  3S3R A;  1IXS B;  2Z4S A;  5CHV A;  4B7F A;  1PVJ A;  1XC8 A;  2UUC M;  2YNM D;  3HWN A;  1BGO A;  4GUA A;  1GMY A;  4FJC A;  4AQY M;  3GLF E;  2RKO A;  3H89 A;  4LJ6 A;  4LRT A;  2UU9 M;  4DMX A;  1G41 A;  2O6X A;  1E94 E;  3FUT A;  1OTR A;  3MJ5 A;  2FTD A;  4A3V B;  1NSF A;  1L2C A;  3GLF A;  3FYC A;  3N3K A;  4P17 A;  2YJ2 A;  2DCB A;  4M9S A;  4YYR A;  1AIM A;  3LFY A;  2UUA M;  4I5S A;  1TGU A;  4RF1 A;  1AUA A;  3KSE A;  1YAL A;  2MJ5 B;  4BPV A;  1HT2 E;  4K0K M;  1YVB A;  1GLN A;  3J80 S;  3VDU A;  4I04 A;  1SXJ D;  3M6A A;  2QBY A;  3DA1 A;  2JTC A;  4GMQ A;  4AKG A;  2WSF F;  2F1G A;  3OVZ A;  1D0K A;  5KPZ A;  1C7Y A;  5ITR A;  2DZY A;  4ANR A;  2CP8 A;  2HH5 A;  4MGK E;  4BQV A;  3AKZ A;  1DGF A;  2R4J A;  3GRY A;  1PGY A;  5JH3 A;  4OEL A;  1AU2 A;  4G4O A;  1UM8 A;  2N35 A;  4LF6 M;  5LMU M;  2RRU A;  2W82 A;  3T1H M;  4IBD A;  2KA6 B;  1TH4 A;  2QEN A;  4QOZ C;  2KNA A;  3BY4 A;  2NQG A;  1VJV A;  2CE7 A;  2D7G A;  5BPV A;  1L2B A;  2DCD A;  3GPY A;  4D8E A;  1S3S A;  3AFH A;  1AYV A;  5FTM A;  3GCB A;  2HL7 A;  1GO5 A;  1IM2 A;  4QRV A;  1U9V A;  3L28 A;  2ZBK B;  3HWS A;  2YR0 A;  3AL0 C;  4W5B A;  5LMN M;  1NB5 A;  5FTN A;  4QHS A;  4BBA A;  4MZS A;  2OQ4 A;  3WHK A;  2K6B A;  3USV A;  4I81 A;  3SAR A;  2HXZ A;  2KXE A;  3CH2 X;  4CDC B;  4JI4 M;  5H37 D;  1D2N A;  1MU5 A;  2JQG R;  3SFZ A;  1QZM A;  3SYL A;  1WHC A;  3UGJ A;  1ZMU A;  1AU3 A;  2YJC A;  4MI7 A;  5CVM A;  4W5W A;  3GLI E;  1K3W A;  3LW5 F;  1EF7 A;  1Y8G A;  3IV2 A;  1MJG M;  4PD2 A;  1GCB A;  4IBI A;  3OVX A;  4QRX A;  2J7Q A;  4BB9 A;  3RFW A;  1L1T A;  3LCU A;  3TE6 A;  4OX9 M;  3K8Z A;  1GL7 A;  4AKI A;  3GLI A;  4ITQ A;  1QVR A;  3K92 A;  1G3I A;  1R5L A;  4LCB A;  4OVZ B;  3T6P A;  2QHO B;  3B7N A;  1KXR A;  4GKK M;  2UUB M;  1IN8 A;  2MH8 A;  3I51 A;  2VDB B;  3SAS A;  3B9P A;  1U9Q X;  3JR4 A;  1O0E A;  3RE8 A;  2C96 A;  1CSB B;  2CUZ A;  1KFX L;  3SMS A;  3MHS A;  2R18 A;  1VDD A;  2FT2 A;  2VF7 A;  4L16 A;  3GPP A;  2P86 A;  1TDH A;  2JZ0 A;  3P5X A;  2BDZ A;  3LQR A;  2KW0 A;  1NJG A;  2G8E A;  3B21 A;  3B79 A;  2DXI A;  1IWD A;  3U60 B;  3QYB A;  1F2A A;  4GHA A;  2F5O A;  1AU4 A;  4BLC A;  1NHG C;  4PDG A;  2DAG A;  3I01 M;  4NSR A;  2R9O A;  4YYS A;  3KP1 E;  3OIS A;  4MGH A;  4JXJ A;  2K47 A;  4X6I A;  1IN4 A;  1CB5 A;  3BC3 A;  2O01 F;  4MGZ E;  3WXF A;  3I06 A;  4NOO B;  3Q8X A;  1ZV1 A;  4XBO A;  1J09 A;  2DZL A;  2P7U A;  2Y0T A;  4GIP A;  5IWA M;  1N77 A;  4YHH M;  3QYE A;  2VQE M;  3PVS A;  3SHG B;  1Q3B A;  3AV0 A;  4N8W A;  3BBA A;  1VQ1 A;  1QAN A;  2BNK A;  1SP4 B;  4YYW A;  3UMM A;  3H7D A;  3RVV A;  4PCZ A;  1PCI A;  3F92 A;  4ZUX U;  3KDS E;  4YYV A;  4CIS A;  1ZAE A;  3U6E A;  2R65 A;  2APL A;  1GL6 A;  2LVO C;  2R0I A;  5ITX E;  9PAP A;  4Y28 F;  3HZJ A;  3CTW B;  2ARY A;  1GVN A;  5A24 A;  5EJC A;  1N34 M;  1CPJ A;  4LF9 M;  5EXX A;  1U9W A;  5ITX A;  4DV2 M;  4X66 M;  1XB2 B;  1Z59 A;  2MR9 A;  3P5V A;  1WGN A;  3FUX A;  2EUC A;  4XK8 F;  4DV3 M;  2DAK A;  3UK6 A;  4CDF B;  1Z5B A;  2CV2 A;  2V1U A;  4FWH A;  3U5Z B;  2F7D A;  3L2A A;  4LGY A;  4A5U A;  3V6E A;  4L6V 6;  3U6P A;  4B08 A;  2C98 A;  2E02 A;  1IBL M;  3GLI B;  1N36 M;  4MZO A;  2Y5B A;  3K8U A;  1ME4 A;  3KSX A;  4LJ4 A;  1IY0 A;  3BWK A;  3SAV A;  1WIV A;  3IHP A;  5KPT A;  3IEC A;  1DKI A;  2LHG A;  1F2B A;  3H4M A;  2B1M A;  4GIT A;  8PCH A;  2ZAM A;  1WXQ A;  2IPP B;  1T6O A;  3DZD A;  3B7Z A;  3TL4 X;  4HLQ A;  3MOR A;  1EE8 A;  3KW9 A;  1XNR M;  5CVO B;  3U6L A;  3GQ5 A;  4CIZ A;  3I04 M;  2O25 A;  4NC6 A;  1G8P A;  4OU7 A;  1SNK A;  3EIE A;  3A46 A;  3IG5 A;  3FTE A;  3IG8 A;  5ITU A;  2EO2 A;  2JZ1 A;  5JZE A;  5EP4 A;  1EWL A;  4PI3 A;  4CDE B;  1ZCM A;  1VEG A;  4MGY E;  3AOE A;  3VK7 A;  2G7Y A;  1IXR C;  3R9X B;  3KXE C;  1DGB A;  2XFT A;  4FWD A;  3ZCB B;  4FCV A;  4PP2 E;  2DCC A;  1AYW A;  4RF0 A;  4Q7J A;  3ZH9 B;  2BJW A;  2MRO B;  1PM5 A;  2XU3 A;  3LQQ A;  1CTE A;  3RGP A;  4LJ8 A;  1K3X A;  3NBX X;  1OAO C;  3A42 A;  4F2L A;  4LFA M;  1OFH A;  3J81 S;  1TDZ A;  1JR3 E;  2AS8 A;  1Z6T A;  1ZQ9 A;  4PP1 A;  2J7Q C;  1OFI A;  1AEC A;  3HJS A;  2XEP A;  1TR8 A;  3K1J A;  1JR3 A;  2KZU A;  3MK6 A;  1GJT A;  4GH9 A;  4KOD A;  2IBI A;  4HL4 A;  1N78 A;  2Z4R A;  1PXV A;  2R6N A;  3OF8 A;  2OP3 A;  2EKF A;  4P6E A;  1DGH B;  3ZUA A;  1BP4 A;  2J7N A;  2LVA A;  1CJL A;  4DV0 M;  5FLX S;  4QRG A;  2UXD M;  2KDL A;  1X37 A;  4OVZ A;  4TUW A;  4G3O A;  4D82 A;  3U6S A;  2H1R A;  3FUW A;  2LNH C;  3C3D A;  4IP3 A;  2PAD A;  1VG5 A;  2CHQ A;  1STF E;  2FRQ A;  3FE3 A;  2R9F A;  1UKF A;  3UZU A;  1IFY A;  4S12 A;  4F1I A;  2VII A;  3KOY E;  4OEM A;  2R6F A;  2ZM6 M;  5E26 A;  3TWL A;  3E21 A;  2FFJ A;  1E9S A;  1QAO A;  3QT4 A;  3T1Y M;  4MM3 B;  1NJF A;  2WBF X;  4ZPX A;  1Q6K A;  4L78 A;  2F5N A;  4M9Z A;  3U60 A;  4II7 A;  3VK8 A;  1XXH B;  2YJ8 A;  1R2Z A;  1EIJ A;  4AW4 A;  4CHT B;  1G4A E;  4JI6 M;  2FS1 A;  2UZJ A;  1G71 A;  1G59 A;  3BPF A;  4DV1 M;  1HUC B;  2JXN A;  4NXN M;  3U6Q A;  1HT1 E;  3PRM A;  3QJ3 A;  3C58 A;  4DR3 M;  2DZO B;  1F2C A;  3U8E A;  3NWL A;  2ZAN A;  2DC7 A;  1JQP A;  1AYU A;  2P5T A;  1NL6 A;  1OKS A;  2DCA A;  4WA6 A;  4X65 M;  5FTK A;  2R9C A;  1S4V A;  1KHQ A;  2CIO A;  3FUV A;  3IOQ A;  3BB7 A;  2JQF R;  3W31 A;  2Z84 A;  1SXJ B;  3T15 A;  4KLB A;  3DOA A;  4DUZ M;  2HCB A;  1YSY A;  2LTU A;  1N33 M;  4R7G A;  2E5L M;  2R9N A;  4AG5 A;  2Z7J A;  2YJ9 A;  3J27 B;  2LVN C;  2JY7 A;  1JR3 D;  4JI2 M;  3J7B A;  3BCN A;  2R4E A;  2KZS A;  4I07 A;  4LRS A;  3HGI A;  3H6S A;  3KKU A;  1JB0 F;  4DV6 M;  5EZQ A;  1DV0 A;  2OO9 A;  4QBB A;  4DV4 M;  2CV0 A;  3H4J A;  1IN6 A;  1YK7 A;  1WR1 B;  4HEO A;  1JQJ C;  1BVS A;  1QDQ A;  2Y6E A;  3V76 A;  1DEU A;  2ATO A;  1KSF X;  3ERV A;  5CVN B;  2R45 A;  4LZJ A;  1R4G A;  1UFZ A;  4FCW A;  3PDF A;  3GRU A;  4RKX A;  3IUT A;  2ACT A;  3K24 A;  2QZ4 A;  4DR6 M;  1TTE A;  2X4A A;  3U5Z A;  3OF9 A;  4UN2 B;  1XWI A;  2X8A A;  2KNV A;  5EGW A;  3KSJ A;  1EWP A;  2FYE A;  3U6C A;  1GEC E;  1ZMW A;  4IBE A;  2E01 A;  1YE9 A;  3GLG E;  4L8R C;  3CF2 A;  3K2L A;  4OW0 A;  4RKU F;  2Y0Q A;  4GRI A;  2CFO A;  1J7K A;  2KEB A;  3C9E A;  5J94 A;  1XMO M;  4LF8 M;  2Z8Y M;  8CAT A;  3QSD A;  4BOS A;  2F5Q A;  3TNX A;  2KRK A;  3J7A S;  4W4U A;  4N79 A;  5DFL A;  3GLG A;  2CHG A;  2DC6 A;  1Q39 A;  3DFZ A;  1HR0 M;  1PJS A;  3KW6 A;  2XU5 A;  2G5G X;  5FPW A;  2P0R A;  2VHF A;  2ZTD A;  4X6H A;  3AOE C;  2AUX A;  2G6D A;  3VLF B;  4X64 M;  1IN5 A;  4WP2 A;  4MSX A;  1TH3 A;  2B3T A;  4JI1 M;  3GRR A;  2V6Z M;  5IRE B;  2J7O A;  2DVW B;  1FJG M;  5EXT A;  4LZZ A;  5EP3 A;  2GNO A;  7CAT A;  4I8O A;  5KQD A;  1U5I A;  1DO0 A;  4IBG A;  4IBK A;  3KVW A;  2F5P A;  5GKN A;  3MTV A;  2FNA A;  2K9D A;  3D6S A;  2DAM A;  4BOZ A;  2CB5 A;  4KT0 F;  1OJL A;  1AIP C;  3LVW A;  4JI0 M;  2HD5 A;  2JWS A;  4FCT A;  5PAD A;  2D7H A;  2D7E A;  3CBJ A;  2M5Z A;  3LMM A;  5DYI A;  2BTW B;  4FD2 A;  4CJ6 A;  1QUT A;  3B74 A;  4XR7 A;  2AU1 A;  3VKG A;  3QAU A;  2DWM A;  1ORY B;  2L4F A;  3PNY A;  3FTD A;  1HJP A;  1PJJ A;  5F02 A;  4XGI A;  1AU0 A;  2DJG B;  3MHH A;  1EFU B;  1QXP A;  4G54 A;  2F5S A;  1I94 M;  4D81 A;  2C9C A;  1YUB A;  5C1B A;  2FUD A;  1IY1 A;  2XSZ A;  1WGL A;  4IBC A;  4G4N A;  4ZTB A;  1DGH A;  2RGO A;  4BS6 A;  1PPN A;  4XZX A;  1NY5 A;  4BOU A;  3FYD A;  4LFB M;  3HHZ A;  3FKE A;  3TRK A;  2J5Y A;  1J5E M;  2R44 A;  4LGM A;  2Z3X A;  2DJF B;  4R3D A;  3VDP A;  3L25 A;  3HHA A;  3FTF A;  2HHN A;  2DHY A;  3RNV A;  3O1G A;  1THE A;  4QNR A;  1PRB A;  1A5T A;  1BQI A;  1ZMV A;  5KQ8 A;  1KHP A;  2DC9 A;  2QPA A;  1XXH E;  1VEK A;  3CBK A;  4Z8X A;  2Q2E B;  3I4V A;  3IFU A;  4AXM A;  5FTL A;  3GLG B;  3TQS A;  4JYA M;  4EIW A;  1HQC A;  4QH6 A;  2OPF A;  3NHE A;  3PHW A;  2L7H A;  3TWM A;  2BWB A;  1XXH A;  3C9P A;  1Y08 A;  2WSC F;  3TMP A;  2AGA A;  3D8L A;  3W68 A;  3U6M A;  2L09 A;  1NO1 A;  4DUY M;  2PNS A;  3PNV A;  2VHS A;  5L8R F;  2JY8 A;  3SMP A;  1SXJ E;  2RGH A;  1CV8 A;  4D8B A;  3PHU A;  2GQF A;  4JI5 M;  4D80 A;  4GC5 A;  1QUS A;  3H8B A;  2QQ8 A;  1SXJ A;  1N75 A;  4L15 A;  2DWN A;  1ICF A;  4G4Q A;  3I3T A;  3THG A;  3KFQ A;  5A2Q S;  2HAK A;  1BY8 A;  2KNZ A;  2XLJ A;  2LWX A;  3VFD A;  3J2P B;  1ME3 A;  1PPD A;  4YV8 A;  3MMP A;  4DBG B;  2ZAO A;  5KPR A;  4QHT A;  2XSZ D;  2KHH A;  3KS8 A;  3K9M A;  3HD3 A;  3LCV B;  4PDI A;  1VDL A;  3SYK A;  2VQF M;  4LJ9 A;  1IN7 A;  2EKK A;  3OTO M;  4PAD A;  2I7N A;  3KS4 A;  1MHW A;  3LVV A;  3FTC A;  3PSE A;  2LVQ D;  3U6D A;  1GJS A;  4M9X A;  3PW3 A;  3WXE A;  2JNH A;  3PBH A;  3LXS A;  1N32 M;  3TPZ A;  3KP0 E;  1V92 A;  3Q8G A;  1T3T A;  4D8I A;  3ILK A;  4Q8G A;  1QYR A;  2DAE A;  2QP9 X;  4WUR A;  4B3S M;  3A98 B;  1MEG A;  5EQT A;  1NY6 A;  1F4I A;  1T43 A;  2DWZ B;  2LH0 A;  4NXM M;  1MEM A;  4BS5 A;  4JI3 M;  3K9P A;  4AKH A;  1TLO A;  3HHW A;  6PAD A;  2H7J A;  1CQD A;  1DO2 A;  1HNZ M;  2JY5 A;  2WSE F;  1RU3 A;  1IBK M;  3FRH A;  4FK5 A;  1POP A;  1DGG A;  3KWZ A;  3ZNH A;  1QDR A;  2JP7 A; 
#chains in the Genus database with same CATH homology
 4IIW A;  3U61 B;  4GIP A;  5IWA M;  1FNN A;  4YHH M;  1N77 A;  4FCW A;  2VQE M;  2C5R A;  3PVS A;  2KRU A;  3GRU A;  4G4R A;  4AZF A;  3GPU A;  4RKX A;  3SHG B;  1NNJ A;  1Q3B A;  4JI7 M;  1W5S A;  2UXC M;  2R62 A;  2FOI C;  3AV0 A;  5BR8 M;  4YY3 M;  4WW0 A;  3BBA A;  2QZ4 A;  4REZ A;  4DR6 M;  2X4A A;  1QAN A;  1E32 A;  2BNK A;  3U5Z A;  3PHX A;  1XWI A;  3UMM A;  2X8A A;  2DZN B;  3M7G A;  1MX0 A;  4G6Z A;  3GLH B;  4PCZ A;  3GRV A;  3KSJ A;  2EA0 A;  2XF3 A;  3EIH A;  3L29 A;  1QQW A;  3U6C A;  4HXD B;  3SBJ A;  1TH2 A;  3KDS E;  4CIS A;  3I4Y A;  1ZAE A;  4IBE A;  3U6E A;  2R65 A;  4GC9 A;  1YE9 A;  3HU3 A;  1GL6 A;  3W30 A;  4RNA A;  1L8Q A;  4IBF A;  4L8R C;  2Y20 A;  3AOG A;  3CF2 A;  3K2L A;  4OW0 A;  5ITX E;  3FD9 A;  2Y0Q A;  4GRI A;  1R7R A;  2CFO A;  3E9S A;  1J7K A;  2KEB A;  1XMO M;  4LF8 M;  8CAT A;  4BOS A;  2F5Q A;  4MH0 E;  2KRK A;  3J7A S;  2C99 A;  3CTW B;  4GHL A;  1GVN A;  3C0R A;  1NNU C;  3HHX A;  3U6O A;  3PFI A;  5EJC A;  1N34 M;  1L1Z A;  4L4U A;  3HU1 A;  3GLG A;  4LF9 M;  5EXX A;  2CHG A;  5ITX A;  4DR7 M;  4DV2 M;  4X66 M;  4JV5 M;  1Z59 A;  1GKI A;  1Q39 A;  3KFU G;  3DFZ A;  1HR0 M;  3FUX A;  2EUC A;  4DV3 M;  3KW6 A;  1NVM A;  3HHY A;  2XFS A;  2G5G X;  3T38 A;  1IQP A;  3UK6 A;  2CHV A;  5F3W A;  1Z5B A;  5EP2 A;  2CV2 A;  1QAQ A;  2V1U A;  4FWH A;  3U5Z B;  1W5T A;  5EXS A;  4B3T M;  1IY2 A;  1E9R A;  3L2A A;  4IJE A;  4NRV A;  2L7I A;  3AOE C;  1YZB A;  4AI6 A;  4LGY A;  3VLF B;  3JR5 A;  1XNQ M;  4A5U A;  4X64 M;  1IN5 A;  3U6P A;  3GQ4 A;  4B08 A;  1TH3 A;  2C98 A;  1Z5A A;  3CF0 A;  4JI1 M;  3SHF A;  3GRR A;  3GLI B;  1IBL M;  2V6Z M;  1N36 M;  2BTW A;  1IBM M;  3M0E A;  3KOZ E;  5IRE B;  2JA2 A;  4LFC M;  2HKJ A;  3KSX A;  2C9O A;  4LJ4 A;  1IY0 A;  1XHB A;  2J7O A;  5DNY A;  2DVW B;  3QWL A;  3SAV A;  1FJG M;  1IXS B;  4LF5 M;  2Z4S A;  4B7F A;  5KPT A;  1PVJ A;  1XC8 A;  1DKI A;  3ZC7 B;  2Y21 A;  3H4M A;  2UUC M;  4GIT A;  2YFQ A;  2F4V M;  2YNM D;  5EXT A;  5JI2 E;  2ZAM A;  1WXQ A;  4LZZ A;  5EP3 A;  4GUA A;  2X49 A;  7CAT A;  4CGY B;  2V1C A;  2G8L A;  3DZD A;  4AQY M;  2RKO A;  3TL4 X;  4LJ6 A;  4LRT A;  4HLQ A;  2UU9 M;  4I8O A;  5KQD A;  3SAT A;  1DO0 A;  1Q3C A;  3HJQ A;  4IBG A;  4IBK A;  4Z6Y A;  1EE8 A;  3KVW A;  2F5P A;  5EP1 A;  2R46 A;  5GKN A;  3GP1 A;  4KO8 A;  1C1K A;  3MTV A;  2FNA A;  1G41 A;  1XNR M;  4IUM A;  1E94 E;  4IBJ A;  3U6L A;  3FUT A;  3MJ5 A;  3GQ5 A;  4JI8 M;  4BOZ A;  4A3V B;  1NSF A;  1L2C A;  3GLF A;  3FYC A;  2UXB M;  1OJL A;  1G8P A;  4OU7 A;  3LVW A;  3E4R A;  3EIE A;  4JI0 M;  3A46 A;  2CEA A;  3IG5 A;  4M9S A;  4FCT A;  2D7H A;  2UUA M;  4I5S A;  4LJA A;  2D7E A;  1TGU A;  4RF1 A;  3FTE A;  2M5Z A;  2XH9 A;  3LMM A;  5DYI A;  3TWK A;  3W0F A;  2BTW B;  3OQC A;  4FD2 A;  4B7H A;  3IG8 A;  1H6U A;  5IT9 S;  4B3M M;  2XZF A;  1HT2 E;  3RGS A;  5ITU A;  2EO2 A;  3VKG A;  3QAU A;  4K0K M;  4FVM A;  1GLN A;  5JZE A;  3J80 S;  3VDU A;  5EP4 A;  4BOQ A;  1QAM A;  2DWM A;  1ORY B;  3SAW A;  3PNY A;  3FTD A;  1SXJ D;  3MP2 A;  1PJJ A;  3M6A A;  4MGY E;  3UJN A;  4XGI A;  4LG2 A;  2QBY A;  3AOE A;  3VK7 A;  1IXR C;  3DA1 A;  4FW9 A;  3BOS A;  3R9X B;  2JTC A;  4GMQ A;  2F5S A;  1I94 M;  4AKG A;  2M60 A;  3KXE C;  4D81 A;  2O5R A;  5KPZ A;  1DGB A;  2NQ8 C;  2C9C A;  1YUB A;  5C1B A;  2XFT A;  4FWD A;  2BU3 A;  5ITR A;  3ZCB B;  4FCV A;  1IY1 A;  4RF0 A;  5IZ7 D;  2XSZ A;  3CF6 E;  4MGK E;  4IBC A;  4G4N A;  4ZTB A;  3ZH9 B;  2BJW A;  3GLF B;  1DGH A;  4DR1 M;  3AKZ A;  3VKH A;  3PRP A;  1DGF A;  2RGO A;  4QOS A;  2R4J A;  3GRY A;  1PM5 A;  4AG6 A;  4XZX A;  5FTJ A;  3LQQ A;  1NY5 A;  2YQZ A;  4BOU A;  3RGP A;  3FYD A;  5FSW A;  1UM8 A;  4G4O A;  4LJ8 A;  1K3X A;  3HHZ A;  4LFB M;  2QCU A;  4LF6 M;  5LMU M;  3L27 A;  3A42 A;  3FKE A;  3TRK A;  1J5E M;  2W82 A;  4LFA M;  1OFH A;  1SXJ C;  3J81 S;  3T1H M;  1TDZ A;  4IBD A;  4LGM A;  4DR4 M;  1Z6T A;  2KA6 B;  1TH4 A;  1ZQ9 A;  2Z3X A;  2QEN A;  4QOZ C;  2J7Q C;  1OFI A;  3BY4 A;  4KLN A;  4R3D A;  3VDP A;  3D8B A;  3L25 A;  2CV1 A;  3HJS A;  2XEP A;  2CE7 A;  2D7G A;  3FTF A;  5BPV A;  1L2B A;  2LXE A;  3GPY A;  3K1J A;  3RNV A;  1JR3 A;  4NL4 H;  2KZU A;  1LV7 A;  4D8E A;  1S3S A;  3AFH A;  2QBY B;  3KOW E;  4QNR A;  3A45 A;  5FTM A;  3MK6 A;  4DV7 M;  2HL7 A;  5ITY A;  5KQ8 A;  4GH9 A;  2QPA A;  4KOD A;  4Z8X A;  2Q2E B;  1IM2 A;  3I4V A;  4HL4 A;  3IFU A;  1N78 A;  2Z4R A;  3L28 A;  2ZBK B;  4LY6 A;  3HWS A;  3GPX A;  4LF7 M;  3W0L B;  5ITT A;  1IXZ A;  5FTL A;  3GLG B;  3TQS A;  4JYA M;  4EIW A;  1HQC A;  2YR0 A;  2OPF A;  3PHW A;  1DGH B;  2L7H A;  3AL0 C;  3TWM A;  5LMN M;  1XXH A;  2J7N A;  5FTN A;  4QHS A;  4DR5 M;  4BBA A;  4DV0 M;  2OQ4 A;  3WHK A;  2L6O A;  5FLX S;  4I81 A;  3GQ3 A;  3SAR A;  3TMP A;  2AGA A;  3D8L A;  2UXD M;  1X37 A;  4OVZ A;  3SC3 A;  3U6M A;  4TUW A;  2L09 A;  4M0W A;  4DUY M;  4D82 A;  2KXE A;  3U6S A;  3HKP A;  3PNV A;  4GKJ M;  2H1R A;  4JI4 M;  3FUW A;  2LNH C;  5H37 D;  3SMP A;  4IP3 A;  3JAM S;  2CHQ A;  1SXJ E;  2RGH A;  4IBB A;  1D2N A;  1MU5 A;  1UKF A;  3SFZ A;  1QZM A;  3SYL A;  5DYG A;  3HU2 A;  4NSO B;  4B7G A;  4D8B A;  3UZU A;  4S12 A;  3UGJ A;  2VII A;  3KOY E;  3HJ8 A;  3KOX E;  3PHU A;  3SAU A;  4JI5 M;  4D80 A;  1KFV A;  2ZM6 M;  5E26 A;  4B3R M;  2DOS A;  3TWL A;  4MI7 A;  4GC5 A;  4W5W A;  4P16 A;  2FFJ A;  1K3W A;  1SXJ A;  1E9S A;  4QNM A;  1QAO A;  1N75 A;  3T1Y M;  5EXP A;  1R6B X;  3L26 A;  4L15 A;  4PD2 A;  5KO3 A;  2DWN A;  4IBI A;  4MGI E;  2J7Q A;  4DR2 M;  2FE8 A;  4MM3 B;  1NJF A;  4G4Q A;  4ZPX A;  4BB9 A;  3RFW A;  4L78 A;  3THG A;  1L1T A;  3R8F A;  2F5N A;  4M9Z A;  3U60 A;  1HQY E;  4II7 A;  3VK8 A;  3TE6 A;  4OX9 M;  3K8Z A;  3NBI A;  1GL7 A;  5A2Q S;  4AKI A;  4JN6 A;  1XXH B;  4FWG A;  3GLI A;  1R2Z A;  4ITQ A;  4AW4 A;  1QVR A;  3K92 A;  4CHT B;  1HNX M;  4BOP A;  1G3I A;  1G4A E;  4JI6 M;  2UZJ A;  1G59 A;  2XLJ A;  4LCB A;  4LJ7 A;  4DV1 M;  2LWX A;  3VFD A;  4OVZ B;  4M0D A;  4NXN M;  3J2P B;  1HT1 E;  3U6Q A;  3PRM A;  4I4L A;  3C58 A;  4DR3 M;  2DZO B;  1L2D A;  4GKK M;  2UUB M;  3NWL A;  2ZAN A;  1IN8 A;  2HHH M;  2XGN A;  5ITQ A;  1I4W A;  3I51 A;  3SAS A;  3B9P A;  2P5T A;  1R2Y A;  2ZAO A;  5KPR A;  4QHT A;  3JR4 A;  2XSZ D;  1HNW M;  3RE8 A;  4DV5 M;  2C96 A;  3KS8 A;  5C18 A;  4PDI A;  1NHW C;  5EZS A;  3SYK A;  4X65 M;  4X62 M;  2A5Y B;  4LJ9 A;  1IN7 A;  2VQF M;  2CUZ A;  2JRI A;  3SMS A;  3OTO M;  5E6J A;  5FTK A;  2I7N A;  3KS4 A;  2R18 A;  1VDD A;  3FUV A;  4L16 A;  3BB7 A;  3LVV A;  3GPP A;  4KHP M;  3W31 A;  3FTC A;  3PSE A;  3U61 A;  3U6D A;  3AJI B;  2Z84 A;  1TDH A;  1SXJ B;  3T15 A;  2DWL A;  3LQR A;  2ERC A;  3DOA A;  4M9X A;  3PXG A;  2KW0 A;  1NJG A;  1KYI A;  4DUZ M;  2HCB A;  3B21 A;  1YSY A;  1N33 M;  2BJV A;  1N32 M;  4R7G A;  2DXI A;  3TPZ A;  2E5L M;  3KP0 E;  3U60 B;  4AG5 A;  2Z7J A;  1T3T A;  4D8I A;  3ILK A;  3J27 B;  1QYR A;  4GHA A;  2QP9 X;  4WUR A;  2F5O A;  3GO8 A;  4BLC A;  1NHG C;  1JR3 D;  3GLH A;  4B3S M;  3A98 B;  4PDG A;  4JI2 M;  3J7B A;  5EQT A;  3O65 A;  1NY6 A;  2AHM A;  2KZS A;  2R4E A;  3FUU A;  4NRW A;  4LRS A;  3HGI A;  2I7P A;  4NSR A;  2DWZ B;  1Z5C A;  4DV6 M;  3KP1 E;  2LH0 A;  5EZQ A;  4NXM M;  2XZU A;  1K82 A;  4JI3 M;  4MGH A;  4JXJ A;  2K47 A;  4DV4 M;  2CV0 A;  4AKH A;  1IN4 A;  3HHW A;  1IN6 A;  4IJF A;  4PT5 A;  1DO2 A;  1HNZ M;  5JI3 E;  2HWK A;  4MGZ E;  1PJI A;  1JQJ C;  3PT2 A;  1IBK M;  4LF4 M;  4NOO B;  3Q8X A;  2DHR A;  1DGG A;  4MB7 A;  3ZNH A;  4XBO A;  1J09 A;  1KSF X;  3MHV C;  3WHL A;  1XMQ M;  2R45 A;  4LZJ A;  4LJ5 A;  2Y0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...