5KO3A

Structure of a core papain-like protease of mers coronavirus with utility for structure-based drug design
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
257
structure length
255
Chain Sequence
DETKALKELYGPVDPTFLRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structure and Enzymatic Activity Profile of a Core Papain-like Protease of MERS Coronavirus with utility for structure-based drug design.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
molecule tags Hydrolase
molecule keywords ORF1a
total genus 71
structure length 255
sequence length 257
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5ko3A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ko3A02
3MJ5A 4OW0A 4R3DA 4REZA 4WURA 4M0WA 4MM3B 3MP2A 5E6JA 4OVZB 3E9SA 4OVZA 4RF0A 4P16A 4PT5A 5KO3A 2FE8A 4RF1A 4RNAA
chains in the Genus database with same CATH superfamily
5LMNM 1AYWA 4Q8GA 2XU4A 4CDDB 4MGZE 2V6ZM 3T1YM 1Y8GA 1Q02A 4BOSA 3WXEA 2K6BA 2O25A 4YV8A 4QRXA 8CATA 4ITQA 2R6FA 5DFLA 4QBBA 4FCTA 3U5ZB 2R44A 3L28A 4Q8HA 4JI7M 5BR8M 2FE8A 2DHYA 3TPZA 3H4JA 2ZAOA 2C99A 1XMOM 3HZJA 3LXSA 4AXLA 3NBXX 2OULA 1IBKM 4RY2A 2UUAM 2RKOA 3B7ZA 2RGOA 5F3WA 3D8LA 1E9RA 3A45A 3RVXA 3U6SA 2HAKA 1TH3A 4MB7A 1GL6A 3WHLA 2R65A 1GVNA 4CDFB 3LQQA 4NL4H 5CVOB 3T6PA 1MU5A 1MEMA 3SC3A 3BY4A 4DUZM 2BJWA 2XZFA 3LVWA 1EWPA 4KHPM 4DMYA 2NQDB 1NVMA 4YYQA 3C58A 1YUBA 3AL0C 3CGWA 4DV4M 2ZM6M 2PBHA 2J7NA 4WP2A 1DGHB 1QQWA 2BWBA 3IOQA 2FRAA 2CP8A 2G5GX 2L7IA 5FSWA 3I4VA 3KX1A 3U6CA 1TU6A 4YYWA 2R0IA 5CVNB 3M99A 3TWMA 1DO2A 4JI3M 4BLCA 3TWLA 4XUIA 3FRHA 4X66M 3CH3X 4QNRA 3UMMA 4DR4M 3GLIA 2F4VM 2AIMA 1IY1A 5CHTA 1AECA 4PD2A 1WR1B 2G8LA 3BPMA 4G3OA 1HT1E 4MZOA 4RKXA 1R5LA 2X8AA 3TQSA 1DO0A 3HHZA 2JY8A 2A5YB 2DZZA 4DR1M 2NQGA 2AS8A 1PPOA 2HHNA 4GEWA 4DR6M 1U9QX 1QUSA 3H7DA 4F2LA 1SXJE 2FH0A 3PVSA 2DNAA 3MK6A 3PFIA 1IWDA 3PW3A 1AYVA 3K8UA 2OZ2A 4AKHA 2Z8YM 3P5UA 3B79A 1C7YA 3IV2A 5EXPA 2VIIA 1MHWA 3OQCA 4FWGA 3GLGE 1QYRA 1QZMA 4JI5M 3BC3A 1NPZA 4ANRA 1E9SA 2F5QA 2NQAA 4LZZA 2P5TA 4AXMA 3KSJA 1PPPA 2C96A 3HD3A 1MDWA 2HHHM 1NY5A 2JRIA 3A46A 5KPRA 1EWOA 2JXNA 2LTUA 3Q8XA 1OAIA 3VKHA 2DZNB 1YK8A 2QZ4A 4AW4A 1LTMA 2DCAA 2DC8A 3KOYE 3ZH9B 5DYIA 2L4FA 1CB5A 2QCUA 2DC9A 2WSEF 1D0KA 5EP3A 2G7YA 3GLHA 1JR3E 2XZUA 1BVSA 2KNVA 5DNYA 3KKUA 2GNOA 1ITOA 4NXMM 2UXDM 1WXQA 4W4UA 1CJLA 4LZJA 2H7JA 1A5TA 4YY3M 4LF7M 3SATA 3AV0A 3OF9A 1ZIVA 1ME3A 2CRUA 2J7QC 2YJ2A 1X37A 2B1MA 4X65M 4JXJA 3KW9A 1Z6TA 1XXHA 3AOGA 3GLFB 1NB3A 1D2NA 1L2CA 4M0WA 2JY5A 2QHOB 3TL4X 2XU5A 1OKSA 4REZA 3C0RA 3AOEA 2Q2EB 3M7GA 4NRWA 2DOSA 1ZQ9A 1SP4B 3MTVA 2EKKA 3KDSE 1N78A 1QZEA 3KWBX 5EXSA 3F92A 2KZUA 2W82A 3OISA 2X49A 1IXSB 3H4MA 3ZNHA 2QPAA 4OW0A 1R2YA 3N3KA 5KPTA 3R8FA 1PJIA 3VK8A 2HL7A 2XH9A 3J81S 2YR0A 5A24A 3I01M 2R46A 2Y0TA 4OU7A 1POPA 4N8WA 2KEBA 1XXHB 3I04M 1U9VA 1OIPA 4MI7A 3LCVB 3KSEA 1I4WA 1IBMM 3P5VA 1NNUC 2VF7A 2CHQA 5ITXE 3IMAA 2DC6A 3RNVA 1OFHA 2UUBM 5FLXS 2DCDA 4GITA 1NV9A 4YYSA 2JP7A 2KXEA 3GO8A 2O01F 5E6JA 3KS4A 1K3XA 2QQ8A 2FO5A 1CUKA 5ITRA 4IBFA 1G59A 3AI8A 3N3GA 4BBAA 1K82A 3FKEA 1T3TA 2PADA 3HHXA 4BOPA 2ZTDA 4YVAA 3D8BA 1VEJA 2QENA 1FJGM 4CDEB 1HUCB 1F29A 4WURA 2XLJA 1PJTA 4JYAM 3IHPA 3TWKA 1XKGA 3KOWE 2AGAA 4DUYM 5EGWA 4JI4M 3E9SA 1KSFX 1L2DA 4D80A 1VEGA 1TDHA 2DI0A 1VEKA 2CHGA 2R18A 3SBJA 1YT7A 1ATKA 3H6SA 5CHVA 2F5SA 3USVA 1S3SA 1D0MA 4D82A 4DV6M 2Z7JA 3RFWA 5EZSA 1YVBA 3AJIB 4I8OA 2HWJA 2XU1A 4RNAA 4M9SA 2FQ9A 4AG5A 5JA7A 2FYEA 1XHBA 4NRVA 3ZQJA 3BOWA 3KFUG 1UM8A 3PT2A 2CV1A 3RGSA 1AU0A 1G71A 4IBJA 2E5LM 4B7GA 3I3TA 2XU3A 3TMPA 2LNHC 2C5RA 1BQIA 1SXJC 5EZQA 2CV0A 4B3MM 2N35A 2LVNC 3O65A 4LF4M 2V1CA 3HHYA 5C1BA 5JH3A 5FTMA 2D7GA 3FUWA 1KHQA 1IFYA 2EUCA 3K1JA 1DV0A 4L15A 3RVWA 4BOUA 3HU3A 2ZTCA 4A5UA 1X9YA 2DZLA 2G3QA 2ZANA 4LJ7A 2R45A 1FNNA 2VQFM 4AKGA 4X6HA 1QAMA 1KHPA 1YZBA 1XC8A 3MP2A 3K9MA 1VG5A 2BWEA 3KP0E 2F5OA 3L25A 2BDZA 1EFUB 3GLGB 3QSDA 3GQ3A 2HXZA 1G4AE 2DCCA 1PJJA 3KVWA 2OO9A 3DZDA 3UJNA 1XNQM 4CHTB 2OQ4A 4LFCM 1V33A 1GLOA 1ZCMA 4GIPA 1VDLA 1N75A 5IREB 2MR9A 1NY6A 5E26A 2BNKA 4PT5A 1U9XA 3PNRA 3QYBA 2OP3A 4OELA 3Q8GA 4IBGA 3CBKA 3I51A 1ZMUA 9PAPA 3SHFA 1TDZA 1WGLA 1XMQM 1EWLA 3GRRA 3W31A 1AYUA 1W5SA 1TR8A 1F4IA 2Y0QA 1IY0A 2KNZA 1Q3CA 4BPVA 4D8IA 1I94M 5A2QS 5IWAM 1Y4HA 1XB2B 1J7KA 2EA0A 2JZ1A 1ZAEA 3JAMS 3H8CA 3KXEC 4DR2M 3B21A 3J2PB 4R3DA 4DV0M 3LQRA 1IXSA 2RRUA 4LCBA 4W5BA 1ZMVA 2KRUA 2AU1A 1HNZM 4HEOA 5EJCA 4JN6A 2C98A 2EKFA 4RF1A 2D7HA 3BWKA 5ITTA 1NNJA 1QAQA 1ICFA 1YSYA 1Q3BA 3OVXA 4UN2B 3OTOM 1F2AA 3P5XA 3L26A 3U60A 4WW0A 3U6PA 2LVQD 4CIZA 1N32M 1YE9A 3FE3A 3PHUA 2LXEA 2ERCA 2O5RA 1YLAA 2DJGB 4GH9A 3J7BA 2E02A 4QH6A 2Z4SA 3IEJA 4XZXA 5ITQA 3GQ5A 1PE6A 2ATOA 5IT9S 4X6IA 3SYLA 3UK6A 1QDRA 3U6DA 1ME4A 2VHFA 1NJGA 2FT2A 3GLHB 3GCBA 3K24A 2L09A 1E94E 2CFOA 4ZUXU 1CQDA 3IUTA 2KW0A 2R9OA 4FIPA 3W0FA 3LCUA 4JI6M 2P86A 2QP9X 3VKGA 2O6XA 1PM5A 4LJ9A 1IN7A 1VSNA 3C3DA 1XNRM 2MROB 3KWZA 1HT2E 1NSFA 5KQDA 3KFQA 4AQYM 4IBBA 1QVRA 2DAKA 3W67A 2CE7A 4D8BA 1NQCA 4CZWA 3W0LB 2YJ9A 2L7HA 2MGWA 2L2DA 2BDLA 4LJ4A 4YYUA 3HKPA 3F75A 2DHRA 1KXRA 4AKIA 3HGIA 3KP1E 3P5WA 1TH2A 2DAMA 1PXVA 1AU3A 1GJSA 1QOLA 1NV8A 2I7PA 1CPJA 2C0YA 4GKKM 2YJBA 3VLFB 1G41A 1PRBA 2OOBA 4CISA 4L16A 4OEMA 1EF7A 2HCBA 3QWLA 1G8PA 1MX0A 4GHLA 1HJPA 1WGNA 7CATA 2Z84A 2IBIA 1KFUL 3MTNA 3U8EA 1R2ZA 4I81A 4HLQA 2FRQA 2Y6EA 5EXXA 4BB9A 3FTEA 3B7QA 2BTWB 2JQFR 4JI8M 3V76A 4G6ZA 1EIJA 3U6MA 3PHWA 1JB0F 4G4QA 3H89A 1QAOA 3SAVA 5ITYA 3GLFA 2K0BX 2DXIA 4AI6A 3DOAA 4CDCB 3GPUA 2XF3A 4LRSA 4FW9A 1N33M 4BOQA 2JY6B 2R62A 2FNAA 4HWYA 3I4YA 2J7QA 4DR7M 1D0LA 1V34A 4GC5A 3LVVA 1PBHA 4LG2A 2C9OA 5KQ8A 3TRKA 3HHAA 5FTJA 2UXBM 4RF0A 2HH5A 2YFQA 4L78A 4LFBM 3SAWA 3VFDA 3I06A 2JZ0A 3L2AA 1P3QQ 2LBCA 3J80S 2WSCF 4M9ZA 5ITXA 3H8BA 2G6DA 1OIZA 2B1NA 3B89A 3NWLA 2E03A 1CSBB 1S4VA 4BS6A 3GP1A 2CIOA 5K16A 4R71A 4DV2M 5JI3E 3BPFA 5ITUA 4Y28F 4LJ5A 3O1GA 4IBEA 2CB5A 4X64M 4QOZC 1VDDA 1G3IA 6PADA 1BY8A 2YNMD 2L6OA 3WHKA 4IJEA 4AG6A 2FOIC 1IM2A 3GPPA 4KLNA 4YYVA 2AYNA 2DAIA 2XEPA 3HJ8A 3M0EA 4PDIA 2NQ8C 2JWSA 1CVZA 3B7NA 4Z8XA 2LWXA 3ILKA 3BXWA 3PNVA 2EJSA 1HNWM 1BGOA 4IUMA 3CTWB 1HR0M 1MIRA 2DWZB 4L6V6 3GLFE 1U9WA 3DFZA 3K2LA 1RU3A 3U6QA 3IG5A 4I05A 2ACTA 1MJGM 3AFHA 2R6NA 3HHWA 4OVZA 1N77A 1JR3A 5DYGA 4NSRA 4PP1A 1R6BX 1SG9A 1MN3A 4IBDA 2DKLA 4CJ6A 1T43A 1L2BA 2JTCA 2GHUA 1GJTA 4I5SA 4NXNM 4LF6M 2V1UA 1C1KA 4QRGA 1NLJA 5PADA 1TF0B 4X62M 3PXGA 1AU4A 3S3RA 4X6JA 3HX3A 3L27A 3UGJA 4MGHA 2F5NA 1FH0A 1KYIA 3E4RA 3EIEA 3U5ZA 5FPWA 1TTEA 1U5IA 1AU2A 5EP1A 5BPVA 2CWBA 4D8EA 3CF2A 3S3QA 2YQZA 4IIWA 1CTEA 3A98B 3A42A 1SNKA 4FK5A 5IZ7D 1OQYA 1PJSA 1Q39A 4DV7M 4QHSA 1YK7A 4LY6A 2JQGR 3FUTA 3B74A 3JR5A 4ZPXA 2KNAA 1YALA 2WZJA 3FD9A 3MMPA 1OAOC 1XWIA 1GABA 3VK7A 1K3BB 2JNHA 3KS8A 3W68A 4G54A 3ZUAA 3IFUA 5H37D 1L1ZA 1NHGC 1PVJA 2YJ8A 2CHVA 1PADA 2XSZA 2I7NA 2M5ZA 2VF8A 1SXJA 3MHSA 1IN8A 2R9MA 2XFSA 1F2CA 3BBAA 4QOSA 2RGHA 4IBKA 3MORA 1NHWC 2PREA 1IN5A 2FFJA 2K9DA 4R7GA 1J5EM 1OFIA 2KDLA 1HQCA 1W5TA 4II7A 4LF9M 4NSOB 3CH2X 3O0UA 3AOEC 1PIPA 1GO5A 1TLOA 2ZBKB 1O0EA 3SYKA 5EP4A 4LJAA 2VQEM 4F1IA 2JA2A 2FS1A 2J5YA 5C18A 4QNMA 1PCIA 4DR3M 1OJLA 2BU3A 4YYRA 4LFAM 1HQYE 2XGNA 3U61A 3JR4A 1N34M 4A3VB 4I04A 3K92A 1GL7A 3TNXA 1TL9A 4P6GA 2ARYA 4PCZA 3KOXE 3UZUA 1IN6A 1NJFA 2DZYA 4KT0F 2WBFX 3QYEA 3WXGA 3HWSA 2Y21A 1IXRC 3AKZA 3PRMA 3J7AS 1NO1A 1BP4A 3SMSA 3E46A 3GQ4A 1JR3D 4GUAA 3HY5A 4G4OA 1CS8A 4JI0M 4B3TM 3OVZA 4MGYE 4IBCA 2CUZA 3FUUA 2QBYB 4MGIE 2UZJA 3K8ZA 4LGMA 3D6SA 3MJ5A 4FCWA 2XFTA 3WXFA 3ZCBB 3CBJA 4Z6YA 1HNXM 4GHAA 1MS6A 4FWDA 1KFVA 3W30A 2FUDA 2HKJA 3FUXA 3ERVA 1MEGA 2FTDA 4L8RC 1ZV1A 1QUTA 4Q7JA 4NOOB 5F02A 2APLA 4CGYB 4I4LA 4DMXA 1DF0A 4KODA 4W5WA 4QRVA 1R7RA 3K9PA 2DJFB 3GLIE 4P6EA 3EIHA 1KFXL 4TUWA 1H6UA 2JUJA 4OX9M 4G4RA 1QDTA 2D7EA 3FUVA 8PCHA 2WSFF 4PADA 3RGPA 1AUAA 1Y08A 2LVAA 4WA6A 2LVPC 2DAEA 4PP2E 4B3RM 1IQPA 3M6AA 3T1HM 4PDGA 2H1RA 3SMPA 3BB7A 1L8QA 1GECE 4P16A 4DV5M 2JY7A 4BS5A 4P17A 2X4AA 4I07A 2UU9M 3FTDA 4LRTA 5KPZA 1WIVA 3BBZA 1NL6A 2YJCA 5JI2E 3IECA 3GRVA 2R9CA 1GMYA 4FVMA 3C9PA 1DGHA 2H5XA 4XK8F 4JI1M 2OOAA 3N4CA 2R9NA 4EIWA 1AIMA 3V6CA 3THGA 3HWNA 2CV2A 2UXCM 2Y20A 3TE6A 2PNSA 2E01A 4HL4A 3KW6A 2DC7A 3HHIA 1IXZA 3GRUA 2M60A 3FRIA 2J7OA 3GPYA 3HU2A 4FWHA 5GKNA 1TGUA 3FTFA 4LJ6A 3U6LA 3GRYA 4NC6A 1DKIA 3PSEA 2DWMA 5FTNA 1QXPA 2L4EA 2GFOA 2Z3XA 2DAGA 2AVWA 3U6OA 3GLIB 4LF5M 4JV5M 3U6EA 1IY2A 2AHMA 4AZFA 2QBYA 3HJSA 5FTLA 2AYOA 1JQPA 2OPFA 3J27B 4B3SM 4GKJM 1DGFA 3CF0A 2IPPB 3PDFA 1EWMA 4S12A 4XGIA 2DVWB 1Z5BA 2E00A 4BOZA 1CV8A 3T15A 3SAUA 1SXJB 5EXTA 5JZEA 4DV3M 2CEAA 2MJ5B 3R9XB 4QHTA 3NHEA 1QDQA 1XXHE 4PI3A 2C9CA 3QAUA 2KRKA 4FJCA 1Q6KA 4DV1M 1LV7A 1EE8A 2AUXA 1UKFA 3E21A 1GLNA 2QSFX 4IJFA 1IN4A 3IG8A 1VQ1A 5CVMA 2HWKA 4B7FA 4YHHM 4GMQA 3MHVC 2LH0A 1UFZA 3E1ZB 1DEUA 7PCKA 3GLHE 3KSXA 4IP3A 1Z59A 3BCNA 4GC9A 1PJQA 2P7UA 2VDBB 3L29A 3NBIA 4LGYA 2VHSA 3QJ3A 1SXJD 3FYCA 4OVZB 3SASA 3SHGB 3SARA 1STFE 2Z4RA 2AUZA 2HD5A 3PNYA 3LMMA 4MH0E 2F1GA 1V92A 5EQTA 5J94A 4MSXA 3GLGA 3C9EA 1R4GA 3VDUA 4W5CA 3C3EA 1GCBA 3CF6E 1N36M 1PGYA 3RE8A 1IBLM 4IBIA 4M9XA 2DWNA 3HU1A 3PRPA 3V6EA 4ZTBA 4B7HA 5EP2A 3PBHA 1QANA 2Y5BA 4MZSA 5EF4A 2DZOB 2P0RA 1OTRA 4MM3B 1GKIA 4LJ8A 2BJVA 1WHCA 2KA6B 1DGGA 4BSQA 1T6OA 1F2BA 4G4NA 3LFYA 2LHGA 1Z5CA 4N79A 4JI2M 4K7CA 3FYDA 4FCVA 1TH4A 2XSZD 1K3WA 2QNJA 1PPNA 2F5PA 1WJ7A 2DENA 3U61B 2KHHA 1THEA 2LHCA 3PHXA 2F7DA 4FD2A 2R4JA 1JQJC 4D81A 2DWLA 2R9FA 2G8JA 3MHHA 4DR5M 1L1TA 3B9PA 5KO3A 3F5VA 4LF8M 2LVOC 4KLBA 1DGBA 5LMUM 3KOZE 1VJVA 1M6DA 3BOSA 3RVVA 2EO2A 2NQIA 4RKUF 3SFZA 4XR7A 3DA1A 3QT4A 2R4EA 1AIPC 3FTCA 4BQVA 2UUCM 4GRIA 1A6RA 3VDPA 4DBGB 1J09A 2GQFA 1QMYA 3DF0A 4MGKE 4XBOA 3HJQA 4B08A 4KO8A 4M0DA 5L8RF 2B3TA 4HXDB 1Z5AA 5FTKA 1PPDA 4N4ZA 2KZSA 2MH8A 3GPXA 2G8EA 2ZAMA 3U60B 1ZMWA 3OF8A 3LW5F 2BTWA 3K9OA 2DCBA 3T38A 1E32A 1ORYB 4K0KM 1NB5A 2K47A 3ZC7B 4L4UA
chains in the Genus database with same CATH topology
5LMNM 4MGZE 4WURA 3EIHA 2XLJA 2V6ZM 2XF3A 1H6UA 3T1YM 4TUWA 4JYAM 4LRSA 3TWKA 4BOSA 4FW9A 4OX9M 3KOWE 2AGAA 4G4RA 4DUYM 4JI4M 3E9SA 2D7EA 1N33M 1KSFX 1L2DA 4D80A 3FUVA 4BOQA 3RGPA 2R62A 1TDHA 2FNAA 8CATA 4ITQA 3I4YA 2J7QA 4DR7M 2CHGA 4FCTA 3U5ZB 2R18A 3L28A 3SBJA 4JI7M 4GC5A 5BR8M 3LVVA 4LG2A 4B3RM 2C9OA 5KQ8A 2F5SA 2FE8A 3TRKA 1IQPA 3M6AA 3T1HM 1S3SA 5FTJA 4PDGA 2H1RA 3SMPA 3BB7A 2UXBM 1L8QA 4D82A 4RF0A 2Z7JA 4DV6M 3RFWA 4P16A 2YFQA 3TPZA 5EZSA 4DV5M 2ZAOA 2C99A 4L78A 1XMOM 4LFBM 3AJIB 3SAWA 4I8OA 2X4AA 3VFDA 2UU9M 3FTDA 1IBKM 4RNAA 4M9SA 3L2AA 4LRTA 4AG5A 5KPZA 2UUAM 1XHBA 4NRVA 3KFUG 1UM8A 2RKOA 3PT2A 2CV1A 5JI2E 2RGOA 3RGSA 5F3WA 3J80S 4M9ZA 4IBJA 2E5LM 3D8LA 1E9RA 3A45A 3GRVA 4B7GA 5ITXA 3U6SA 3TMPA 4FVMA 2LNHC 2C5RA 1TH3A 3NWLA 4MB7A 1GL6A 1SXJC 3WHLA 5EZQA 2R65A 3GP1A 2CV0A 1GVNA 4B3MM 1DGHA 3LQQA 4JI1M 3O65A 4NL4H 4LF4M 2V1CA 4DV2M 5JI3E 3HHYA 5C1BA 5ITUA 5FTMA 4EIWA 1MU5A 2D7GA 3FUWA 4LJ5A 3SC3A 2EUCA 3K1JA 3THGA 3BY4A 4DUZM 4IBEA 2BJWA 4X64M 4QOZC 1VDDA 1G3IA 2XZFA 4L15A 2CV2A 3LVWA 2UXCM 2Y20A 2YNMD 4KHPM 2L6OA 3TE6A 3WHKA 4BOUA 4IJEA 4AG6A 1NVMA 4HL4A 3HU3A 2FOIC 1YUBA 3C58A 3AL0C 4DV4M 1IM2A 3GPPA 3KW6A 4KLNA 2ZM6M 4A5UA 2J7NA 2ZANA 1DGHB 4LJ7A 2R45A 1FNNA 2VQFM 1IXZA 4AKGA 1QQWA 3GRUA 2M60A 2XEPA 1QAMA 3HJ8A 2J7OA 1YZBA 3M0EA 2G5GX 2L7IA 1XC8A 4PDIA 2NQ8C 5FSWA 3MP2A 3I4VA 2LWXA 4Z8XA 3KP0E 3U6CA 3ILKA 3GPYA 2F5OA 3HU2A 3L25A 4FWHA 5GKNA 3PNVA 3GLGB 1TGUA 3FTFA 1HNWM 4LJ6A 3GQ3A 1G4AE 3U6LA 3GRYA 1DKIA 3PSEA 4IUMA 3CTWB 3TWMA 2DWMA 1PJJA 3KVWA 5FTNA 1HR0M 1DO2A 4JI3M 2DWZB 4BLCA 3DFZA 3K2LA 3TWLA 3DZDA 3UJNA 2Z3XA 4X66M 3U6QA 4CHTB 2OQ4A 4LFCM 1XNQM 3U6OA 3IG5A 3GLIB 4LF5M 3U6EA 4JV5M 4QNRA 1IY2A 2AHMA 3UMMA 4DR4M 3GLIA 2F4VM 3AFHA 1IY1A 4PD2A 4AZFA 4GIPA 3HHWA 4OVZA 1N77A 1JR3A 1N75A 2QBYA 2G8LA 3HJSA 4NSRA 5DYGA 5FTLA 5IREB 1R6BX 1HT1E 2OPFA 4IBDA 4RKXA 3J27B 4B3SM 1NY6A 1DGFA 3CF0A 4GKJM 1L2BA 5E26A 2BNKA 2X8AA 4PT5A 3TQSA 1DO0A 3HHZA 4S12A 4XGIA 2A5YB 2DVWB 2JTCA 1Z5BA 4DR1M 4I5SA 4BOZA 3T15A 3SAUA 4NXNM 4LF6M 4DR6M 1SXJB 2V1UA 5EXTA 1C1KA 4IBGA 5JZEA 3I51A 4DV3M 1SXJE 2CEAA 3PVSA 3SHFA 1TDZA 3R9XB 4QHTA 1XMQM 4X62M 3GRRA 3PXGA 3MK6A 2C9CA 3W31A 3QAUA 3PFIA 2KRKA 1W5SA 2Y0QA 3L27A 3UGJA 1IY0A 4MGHA 4DV1M 2F5NA 1LV7A 1KYIA 1EE8A 3E4RA 1UKFA 1Q3CA 3EIEA 4AKHA 4D8IA 1I94M 1GLNA 5A2QS 5IWAM 3U5ZA 1J7KA 4IJFA 1IN4A 3IG8A 2EA0A 5EXPA 2VIIA 1ZAEA 3JAMS 4FWGA 5EP1A 5BPVA 4B7FA 4YHHM 2HWKA 4GMQA 3KXEC 1QYRA 3CF2A 4D8EA 1QZMA 3MHVC 2LH0A 2YQZA 4DR2M 4JI5M 3B21A 3J2PB 4IIWA 4R3DA 1E9SA 2F5QA 4DV0M 3LQRA 3A98B 3A42A 4LCBA 3KSXA 4LZZA 1Z59A 2P5TA 4IP3A 4GC9A 2KRUA 5IZ7D 1HNZM 3KSJA 5EJCA 4JN6A 2C96A 2C98A 4RF1A 2D7HA 1Q39A 3L29A 4DV7M 2HHHM 3NBIA 4LGYA 5ITTA 1NNJA 1NY5A 2JRIA 1QAQA 4QHSA 1SXJD 3FYCA 1YSYA 1Q3BA 4LY6A 3A46A 3OTOM 3FUTA 3JR5A 4ZPXA 5KPRA 4OVZB 3SASA 3SHGB 3Q8XA 3VKHA 3L26A 3FD9A 3SARA 3U60A 2DZNB 2Z4RA 2QZ4A 4AW4A 4WW0A 3U6PA 3PNYA 3KOYE 3ZH9B 1N32M 1XWIA 1YE9A 3VK7A 3PHUA 5DYIA 3KS8A 2LXEA 2QCUA 2ERCA 3LMMA 5EP3A 3GLHA 4MH0E 2XZUA 2O5RA 5DNYA 3IFUA 5EQTA 5H37D 1L1ZA 4GH9A 1NHGC 3J7BA 4NXMM 3GLGA 1PVJA 2UXDM 1WXQA 3VDUA 2CHVA 2Z4SA 4LZJA 2XSZA 2I7NA 3CF6E 1N36M 4XZXA 5ITQA 4YY3M 3GQ5A 4LF7M 2M5ZA 3RE8A 3SATA 5IT9S 1IBLM 3AV0A 4IBIA 1SXJA 3SYLA 4M9XA 2DWNA 3HU1A 3UK6A 3PRPA 4ZTBA 2J7QC 4B7HA 5EP2A 1IN8A 3U6DA 1QANA 1NJGA 2XFSA 1X37A 3BBAA 3GLHB 4QOSA 2DZOB 4X65M 4JXJA 2RGHA 4IBKA 1Z6TA 1NHWC 4MM3B 1XXHA 2L09A 1E94E 3AOGA 3GLFB 1IN5A 1GKIA 2CFOA 4LJ8A 2FFJA 2BJVA 4R7GA 1D2NA 2KA6B 1OFIA 1J5EM 2KW0A 1DGGA 1HQCA 1W5TA 4II7A 1L2CA 4M0WA 3OQCA 3W0FA 4LF9M 3TL4X 4NSOB 4G4NA 4JI6M 4REZA 3C0RA 3AOEC 2ZBKB 1Z5CA 2QP9X 3AOEA 3VKGA 4JI2M 2Q2EB 3M7GA 1PM5A 4LJ9A 1IN7A 5EP4A 3SYKA 3FYDA 4NRWA 4LJAA 4FCVA 1XNRM 2VQEM 2DOSA 1ZQ9A 1TH4A 3MTVA 2JA2A 3KDSE 5C18A 2XSZD 1N78A 4QNMA 5EXSA 4DR3M 1K3WA 1HT2E 1NSFA 1OJLA 2KZUA 2W82A 5KQDA 2F5PA 2BU3A 4AQYM 4LFAM 1HQYE 2XGNA 4IBBA 3U61B 1QVRA 2X49A 1IXSB 2CE7A 3H4MA 3ZNHA 2QPAA 4OW0A 3JR4A 3U61A 1R2YA 1N34M 3PHXA 4D8BA 4FD2A 2R4JA 4A3VB 5KPTA 3K92A 3R8FA 1PJIA 1GL7A 3W0LB 3VK8A 1JQJC 4D81A 2DWLA 2HL7A 2L7HA 4DR5M 4LJ4A 1L1TA 3B9PA 4PCZA 3KOXE 3UZUA 1IN6A 1NJFA 3HKPA 5KO3A 2XH9A 3J81S 2YR0A 4LF8M 2DHRA 1DGBA 2R46A 4AKIA 2Y0TA 3HWSA 4OU7A 2Y21A 5LMUM 3HGIA 3KOZE 3KP1E 1IXRC 3AKZA 3PRMA 3J7AS 2KEBA 1TH2A 1XXHB 3BOSA 2EO2A 3SMSA 3GQ4A 3SFZA 3DA1A 4MI7A 2R4EA 2I7PA 1JR3D 3FTCA 4GUAA 2UUCM 4G4OA 4GRIA 4GKKM 1I4WA 1IBMM 3VDPA 3VLFB 4JI0M 1NNUC 1J09A 1G41A 2CHQA 4CISA 4B3TM 5ITXE 4MGYE 3RNVA 1OFHA 4L16A 2UUBM 5FLXS 4MGKE 4XBOA 3HJQA 4GITA 4IBCA 2HCBA 4B08A 3QWLA 4KO8A 4M0DA 1G8PA 1MX0A 2CUZA 7CATA 3FUUA 4GHLA 2QBYB 4HXDB 1Z5AA 2KXEA 4MGIE 3GO8A 2Z84A 5E6JA 5FTKA 3KS4A 2UZJA 3K8ZA 4LGMA 1R2ZA 3MJ5A 2KZSA 4FCWA 4HLQA 4I81A 1K3XA 2XFTA 5ITRA 3ZCBB 5EXXA 4IBFA 4BB9A 3FTEA 4Z6YA 3GPXA 2ZAMA 1HNXM 2BTWB 4JI8M 4GHAA 3U60B 4G6ZA 1G59A 4BBAA 3U6MA 3FKEA 1T3TA 4FWDA 1K82A 3PHWA 1KFVA 3W30A 2HKJA 2BTWA 3FUXA 3HHXA 4L8RC 3T38A 4G4QA 1E32A 1QAOA 4BOPA 3SAVA 1ORYB 4NOOB 5ITYA 4K0KM 3GLFA 2K47A 3ZC7B 4CGYB 4I4LA 4L4UA 3D8BA 4KODA 2DXIA 2QENA 4AI6A 3DOAA 1FJGM 4W5WA 3GPUA 1R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJ5 A;  4OW0 A;  4R3D A;  4REZ A;  4WUR A;  4M0W A;  4MM3 B;  3MP2 A;  5E6J A;  4OVZ B;  3E9S A;  4OVZ A;  4RF0 A;  4P16 A;  4PT5 A;  5KO3 A;  2FE8 A;  4RF1 A;  4RNA A; 
#chains in the Genus database with same CATH topology
 5LMN M;  1AYW A;  4Q8G A;  2XU4 A;  4CDD B;  4MGZ E;  2V6Z M;  3T1Y M;  1Y8G A;  1Q02 A;  4BOS A;  3WXE A;  2K6B A;  2O25 A;  4YV8 A;  4QRX A;  8CAT A;  4ITQ A;  2R6F A;  5DFL A;  4QBB A;  4FCT A;  3U5Z B;  2R44 A;  3L28 A;  4Q8H A;  4JI7 M;  5BR8 M;  2FE8 A;  2DHY A;  3TPZ A;  3H4J A;  2ZAO A;  2C99 A;  1XMO M;  3HZJ A;  3LXS A;  4AXL A;  3NBX X;  2OUL A;  1IBK M;  4RY2 A;  2UUA M;  2RKO A;  3B7Z A;  2RGO A;  5F3W A;  3D8L A;  1E9R A;  3A45 A;  3RVX A;  3U6S A;  2HAK A;  1TH3 A;  4MB7 A;  1GL6 A;  3WHL A;  2R65 A;  1GVN A;  4CDF B;  3LQQ A;  4NL4 H;  5CVO B;  3T6P A;  1MU5 A;  1MEM A;  3SC3 A;  3BY4 A;  4DUZ M;  2BJW A;  2XZF A;  3LVW A;  1EWP A;  4KHP M;  4DMY A;  2NQD B;  1NVM A;  4YYQ A;  3C58 A;  1YUB A;  3AL0 C;  3CGW A;  4DV4 M;  2ZM6 M;  2PBH A;  2J7N A;  4WP2 A;  1DGH B;  1QQW A;  2BWB A;  3IOQ A;  2FRA A;  2CP8 A;  2G5G X;  2L7I A;  5FSW A;  3I4V A;  3KX1 A;  3U6C A;  1TU6 A;  4YYW A;  2R0I A;  5CVN B;  3M99 A;  3TWM A;  1DO2 A;  4JI3 M;  4BLC A;  3TWL A;  4XUI A;  3FRH A;  4X66 M;  3CH3 X;  4QNR A;  3UMM A;  4DR4 M;  3GLI A;  2F4V M;  2AIM A;  1IY1 A;  5CHT A;  1AEC A;  4PD2 A;  1WR1 B;  2G8L A;  3BPM A;  4G3O A;  1HT1 E;  4MZO A;  4RKX A;  1R5L A;  2X8A A;  3TQS A;  1DO0 A;  3HHZ A;  2JY8 A;  2A5Y B;  2DZZ A;  4DR1 M;  2NQG A;  2AS8 A;  1PPO A;  2HHN A;  4GEW A;  4DR6 M;  1U9Q X;  1QUS A;  3H7D A;  4F2L A;  1SXJ E;  2FH0 A;  3PVS A;  2DNA A;  3MK6 A;  3PFI A;  1IWD A;  3PW3 A;  1AYV A;  3K8U A;  2OZ2 A;  4AKH A;  2Z8Y M;  3P5U A;  3B79 A;  1C7Y A;  3IV2 A;  5EXP A;  2VII A;  1MHW A;  3OQC A;  4FWG A;  3GLG E;  1QYR A;  1QZM A;  4JI5 M;  3BC3 A;  1NPZ A;  4ANR A;  1E9S A;  2F5Q A;  2NQA A;  4LZZ A;  2P5T A;  4AXM A;  3KSJ A;  1PPP A;  2C96 A;  3HD3 A;  1MDW A;  2HHH M;  1NY5 A;  2JRI A;  3A46 A;  5KPR A;  1EWO A;  2JXN A;  2LTU A;  3Q8X A;  1OAI A;  3VKH A;  2DZN B;  1YK8 A;  2QZ4 A;  4AW4 A;  1LTM A;  2DCA A;  2DC8 A;  3KOY E;  3ZH9 B;  5DYI A;  2L4F A;  1CB5 A;  2QCU A;  2DC9 A;  2WSE F;  1D0K A;  5EP3 A;  2G7Y A;  3GLH A;  1JR3 E;  2XZU A;  1BVS A;  2KNV A;  5DNY A;  3KKU A;  2GNO A;  1ITO A;  4NXM M;  2UXD M;  1WXQ A;  4W4U A;  1CJL A;  4LZJ A;  2H7J A;  1A5T A;  4YY3 M;  4LF7 M;  3SAT A;  3AV0 A;  3OF9 A;  1ZIV A;  1ME3 A;  2CRU A;  2J7Q C;  2YJ2 A;  1X37 A;  2B1M A;  4X65 M;  4JXJ A;  3KW9 A;  1Z6T A;  1XXH A;  3AOG A;  3GLF B;  1NB3 A;  1D2N A;  1L2C A;  4M0W A;  2JY5 A;  2QHO B;  3TL4 X;  2XU5 A;  1OKS A;  4REZ A;  3C0R A;  3AOE A;  2Q2E B;  3M7G A;  4NRW A;  2DOS A;  1ZQ9 A;  1SP4 B;  3MTV A;  2EKK A;  3KDS E;  1N78 A;  1QZE A;  3KWB X;  5EXS A;  3F92 A;  2KZU A;  2W82 A;  3OIS A;  2X49 A;  1IXS B;  3H4M A;  3ZNH A;  2QPA A;  4OW0 A;  1R2Y A;  3N3K A;  5KPT A;  3R8F A;  1PJI A;  3VK8 A;  2HL7 A;  2XH9 A;  3J81 S;  2YR0 A;  5A24 A;  3I01 M;  2R46 A;  2Y0T A;  4OU7 A;  1POP A;  4N8W A;  2KEB A;  1XXH B;  3I04 M;  1U9V A;  1OIP A;  4MI7 A;  3LCV B;  3KSE A;  1I4W A;  1IBM M;  3P5V A;  1NNU C;  2VF7 A;  2CHQ A;  5ITX E;  3IMA A;  2DC6 A;  3RNV A;  1OFH A;  2UUB M;  5FLX S;  2DCD A;  4GIT A;  1NV9 A;  4YYS A;  2JP7 A;  2KXE A;  3GO8 A;  2O01 F;  5E6J A;  3KS4 A;  1K3X A;  2QQ8 A;  2FO5 A;  1CUK A;  5ITR A;  4IBF A;  1G59 A;  3AI8 A;  3N3G A;  4BBA A;  1K82 A;  3FKE A;  1T3T A;  2PAD A;  3HHX A;  4BOP A;  2ZTD A;  4YVA A;  3D8B A;  1VEJ A;  2QEN A;  1FJG M;  4CDE B;  1HUC B;  1F29 A;  4WUR A;  2XLJ A;  1PJT A;  4JYA M;  3IHP A;  3TWK A;  1XKG A;  3KOW E;  2AGA A;  4DUY M;  5EGW A;  4JI4 M;  3E9S A;  1KSF X;  1L2D A;  4D80 A;  1VEG A;  1TDH A;  2DI0 A;  1VEK A;  2CHG A;  2R18 A;  3SBJ A;  1YT7 A;  1ATK A;  3H6S A;  5CHV A;  2F5S A;  3USV A;  1S3S A;  1D0M A;  4D82 A;  4DV6 M;  2Z7J A;  3RFW A;  5EZS A;  1YVB A;  3AJI B;  4I8O A;  2HWJ A;  2XU1 A;  4RNA A;  4M9S A;  2FQ9 A;  4AG5 A;  5JA7 A;  2FYE A;  1XHB A;  4NRV A;  3ZQJ A;  3BOW A;  3KFU G;  1UM8 A;  3PT2 A;  2CV1 A;  3RGS A;  1AU0 A;  1G71 A;  4IBJ A;  2E5L M;  4B7G A;  3I3T A;  2XU3 A;  3TMP A;  2LNH C;  2C5R A;  1BQI A;  1SXJ C;  5EZQ A;  2CV0 A;  4B3M M;  2N35 A;  2LVN C;  3O65 A;  4LF4 M;  2V1C A;  3HHY A;  5C1B A;  5JH3 A;  5FTM A;  2D7G A;  3FUW A;  1KHQ A;  1IFY A;  2EUC A;  3K1J A;  1DV0 A;  4L15 A;  3RVW A;  4BOU A;  3HU3 A;  2ZTC A;  4A5U A;  1X9Y A;  2DZL A;  2G3Q A;  2ZAN A;  4LJ7 A;  2R45 A;  1FNN A;  2VQF M;  4AKG A;  4X6H A;  1QAM A;  1KHP A;  1YZB A;  1XC8 A;  3MP2 A;  3K9M A;  1VG5 A;  2BWE A;  3KP0 E;  2F5O A;  3L25 A;  2BDZ A;  1EFU B;  3GLG B;  3QSD A;  3GQ3 A;  2HXZ A;  1G4A E;  2DCC A;  1PJJ A;  3KVW A;  2OO9 A;  3DZD A;  3UJN A;  1XNQ M;  4CHT B;  2OQ4 A;  4LFC M;  1V33 A;  1GLO A;  1ZCM A;  4GIP A;  1VDL A;  1N75 A;  5IRE B;  2MR9 A;  1NY6 A;  5E26 A;  2BNK A;  4PT5 A;  1U9X A;  3PNR A;  3QYB A;  2OP3 A;  4OEL A;  3Q8G A;  4IBG A;  3CBK A;  3I51 A;  1ZMU A;  9PAP A;  3SHF A;  1TDZ A;  1WGL A;  1XMQ M;  1EWL A;  3GRR A;  3W31 A;  1AYU A;  1W5S A;  1TR8 A;  1F4I A;  2Y0Q A;  1IY0 A;  2KNZ A;  1Q3C A;  4BPV A;  4D8I A;  1I94 M;  5A2Q S;  5IWA M;  1Y4H A;  1XB2 B;  1J7K A;  2EA0 A;  2JZ1 A;  1ZAE A;  3JAM S;  3H8C A;  3KXE C;  4DR2 M;  3B21 A;  3J2P B;  4R3D A;  4DV0 M;  3LQR A;  1IXS A;  2RRU A;  4LCB A;  4W5B A;  1ZMV A;  2KRU A;  2AU1 A;  1HNZ M;  4HEO A;  5EJC A;  4JN6 A;  2C98 A;  2EKF A;  4RF1 A;  2D7H A;  3BWK A;  5ITT A;  1NNJ A;  1QAQ A;  1ICF A;  1YSY A;  1Q3B A;  3OVX A;  4UN2 B;  3OTO M;  1F2A A;  3P5X A;  3L26 A;  3U60 A;  4WW0 A;  3U6P A;  2LVQ D;  4CIZ A;  1N32 M;  1YE9 A;  3FE3 A;  3PHU A;  2LXE A;  2ERC A;  2O5R A;  1YLA A;  2DJG B;  4GH9 A;  3J7B A;  2E02 A;  4QH6 A;  2Z4S A;  3IEJ A;  4XZX A;  5ITQ A;  3GQ5 A;  1PE6 A;  2ATO A;  5IT9 S;  4X6I A;  3SYL A;  3UK6 A;  1QDR A;  3U6D A;  1ME4 A;  2VHF A;  1NJG A;  2FT2 A;  3GLH B;  3GCB A;  3K24 A;  2L09 A;  1E94 E;  2CFO A;  4ZUX U;  1CQD A;  3IUT A;  2KW0 A;  2R9O A;  4FIP A;  3W0F A;  3LCU A;  4JI6 M;  2P86 A;  2QP9 X;  3VKG A;  2O6X A;  1PM5 A;  4LJ9 A;  1IN7 A;  1VSN A;  3C3D A;  1XNR M;  2MRO B;  3KWZ A;  1HT2 E;  1NSF A;  5KQD A;  3KFQ A;  4AQY M;  4IBB A;  1QVR A;  2DAK A;  3W67 A;  2CE7 A;  4D8B A;  1NQC A;  4CZW A;  3W0L B;  2YJ9 A;  2L7H A;  2MGW A;  2L2D A;  2BDL A;  4LJ4 A;  4YYU A;  3HKP A;  3F75 A;  2DHR A;  1KXR A;  4AKI A;  3HGI A;  3KP1 E;  3P5W A;  1TH2 A;  2DAM A;  1PXV A;  1AU3 A;  1GJS A;  1QOL A;  1NV8 A;  2I7P A;  1CPJ A;  2C0Y A;  4GKK M;  2YJB A;  3VLF B;  1G41 A;  1PRB A;  2OOB A;  4CIS A;  4L16 A;  4OEM A;  1EF7 A;  2HCB A;  3QWL A;  1G8P A;  1MX0 A;  4GHL A;  1HJP A;  1WGN A;  7CAT A;  2Z84 A;  2IBI A;  1KFU L;  3MTN A;  3U8E A;  1R2Z A;  4I81 A;  4HLQ A;  2FRQ A;  2Y6E A;  5EXX A;  4BB9 A;  3FTE A;  3B7Q A;  2BTW B;  2JQF R;  4JI8 M;  3V76 A;  4G6Z A;  1EIJ A;  3U6M A;  3PHW A;  1JB0 F;  4G4Q A;  3H89 A;  1QAO A;  3SAV A;  5ITY A;  3GLF A;  2K0B X;  2DXI A;  4AI6 A;  3DOA A;  4CDC B;  3GPU A;  2XF3 A;  4LRS A;  4FW9 A;  1N33 M;  4BOQ A;  2JY6 B;  2R62 A;  2FNA A;  4HWY A;  3I4Y A;  2J7Q A;  4DR7 M;  1D0L A;  1V34 A;  4GC5 A;  3LVV A;  1PBH A;  4LG2 A;  2C9O A;  5KQ8 A;  3TRK A;  3HHA A;  5FTJ A;  2UXB M;  4RF0 A;  2HH5 A;  2YFQ A;  4L78 A;  4LFB M;  3SAW A;  3VFD A;  3I06 A;  2JZ0 A;  3L2A A;  1P3Q Q;  2LBC A;  3J80 S;  2WSC F;  4M9Z A;  5ITX A;  3H8B A;  2G6D A;  1OIZ A;  2B1N A;  3B89 A;  3NWL A;  2E03 A;  1CSB B;  1S4V A;  4BS6 A;  3GP1 A;  2CIO A;  5K16 A;  4R71 A;  4DV2 M;  5JI3 E;  3BPF A;  5ITU A;  4Y28 F;  4LJ5 A;  3O1G A;  4IBE A;  2CB5 A;  4X64 M;  4QOZ C;  1VDD A;  1G3I A;  6PAD A;  1BY8 A;  2YNM D;  2L6O A;  3WHK A;  4IJE A;  4AG6 A;  2FOI C;  1IM2 A;  3GPP A;  4KLN A;  4YYV A;  2AYN A;  2DAI A;  2XEP A;  3HJ8 A;  3M0E A;  4PDI A;  2NQ8 C;  2JWS A;  1CVZ A;  3B7N A;  4Z8X A;  2LWX A;  3ILK A;  3BXW A;  3PNV A;  2EJS A;  1HNW M;  1BGO A;  4IUM A;  3CTW B;  1HR0 M;  1MIR A;  2DWZ B;  4L6V 6;  3GLF E;  1U9W A;  3DFZ A;  3K2L A;  1RU3 A;  3U6Q A;  3IG5 A;  4I05 A;  2ACT A;  1MJG M;  3AFH A;  2R6N A;  3HHW A;  4OVZ A;  1N77 A;  1JR3 A;  5DYG A;  4NSR A;  4PP1 A;  1R6B X;  1SG9 A;  1MN3 A;  4IBD A;  2DKL A;  4CJ6 A;  1T43 A;  1L2B A;  2JTC A;  2GHU A;  1GJT A;  4I5S A;  4NXN M;  4LF6 M;  2V1U A;  1C1K A;  4QRG A;  1NLJ A;  5PAD A;  1TF0 B;  4X62 M;  3PXG A;  1AU4 A;  3S3R A;  4X6J A;  3HX3 A;  3L27 A;  3UGJ A;  4MGH A;  2F5N A;  1FH0 A;  1KYI A;  3E4R A;  3EIE A;  3U5Z A;  5FPW A;  1TTE A;  1U5I A;  1AU2 A;  5EP1 A;  5BPV A;  2CWB A;  4D8E A;  3CF2 A;  3S3Q A;  2YQZ A;  4IIW A;  1CTE A;  3A98 B;  3A42 A;  1SNK A;  4FK5 A;  5IZ7 D;  1OQY A;  1PJS A;  1Q39 A;  4DV7 M;  4QHS A;  1YK7 A;  4LY6 A;  2JQG R;  3FUT A;  3B74 A;  3JR5 A;  4ZPX A;  2KNA A;  1YAL A;  2WZJ A;  3FD9 A;  3MMP A;  1OAO C;  1XWI A;  1GAB A;  3VK7 A;  1K3B B;  2JNH A;  3KS8 A;  3W68 A;  4G54 A;  3ZUA A;  3IFU A;  5H37 D;  1L1Z A;  1NHG C;  1PVJ A;  2YJ8 A;  2CHV A;  1PAD A;  2XSZ A;  2I7N A;  2M5Z A;  2VF8 A;  1SXJ A;  3MHS A;  1IN8 A;  2R9M A;  2XFS A;  1F2C A;  3BBA A;  4QOS A;  2RGH A;  4IBK A;  3MOR A;  1NHW C;  2PRE A;  1IN5 A;  2FFJ A;  2K9D A;  4R7G A;  1J5E M;  1OFI A;  2KDL A;  1HQC A;  1W5T A;  4II7 A;  4LF9 M;  4NSO B;  3CH2 X;  3O0U A;  3AOE C;  1PIP A;  1GO5 A;  1TLO A;  2ZBK B;  1O0E A;  3SYK A;  5EP4 A;  4LJA A;  2VQE M;  4F1I A;  2JA2 A;  2FS1 A;  2J5Y A;  5C18 A;  4QNM A;  1PCI A;  4DR3 M;  1OJL A;  2BU3 A;  4YYR A;  4LFA M;  1HQY E;  2XGN A;  3U61 A;  3JR4 A;  1N34 M;  4A3V B;  4I04 A;  3K92 A;  1GL7 A;  3TNX A;  1TL9 A;  4P6G A;  2ARY A;  4PCZ A;  3KOX E;  3UZU A;  1IN6 A;  1NJF A;  2DZY A;  4KT0 F;  2WBF X;  3QYE A;  3WXG A;  3HWS A;  2Y21 A;  1IXR C;  3AKZ A;  3PRM A;  3J7A S;  1NO1 A;  1BP4 A;  3SMS A;  3E46 A;  3GQ4 A;  1JR3 D;  4GUA A;  3HY5 A;  4G4O A;  1CS8 A;  4JI0 M;  4B3T M;  3OVZ A;  4MGY E;  4IBC A;  2CUZ A;  3FUU A;  2QBY B;  4MGI E;  2UZJ A;  3K8Z A;  4LGM A;  3D6S A;  3MJ5 A;  4FCW A;  2XFT A;  3WXF A;  3ZCB B;  3CBJ A;  4Z6Y A;  1HNX M;  4GHA A;  1MS6 A;  4FWD A;  1KFV A;  3W30 A;  2FUD A;  2HKJ A;  3FUX A;  3ERV A;  1MEG A;  2FTD A;  4L8R C;  1ZV1 A;  1QUT A;  4Q7J A;  4NOO B;  5F02 A;  2APL A;  4CGY B;  4I4L A;  4DMX A;  1DF0 A;  4KOD A;  4W5W A;  4QRV A;  1R7R A;  3K9P A;  2DJF B;  3GLI E;  4P6E A;  3EIH A;  1KFX L;  4TUW A;  1H6U A;  2JUJ A;  4OX9 M;  4G4R A;  1QDT A;  2D7E A;  3FUV A;  8PCH A;  2WSF F;  4PAD A;  3RGP A;  1AUA A;  1Y08 A;  2LVA A;  4WA6 A;  2LVP C;  2DAE A;  4PP2 E;  4B3R M;  1IQP A;  3M6A A;  3T1H M;  4PDG A;  2H1R A;  3SMP A;  3BB7 A;  1L8Q A;  1GEC E;  4P16 A;  4DV5 M;  2JY7 A;  4BS5 A;  4P17 A;  2X4A A;  4I07 A;  2UU9 M;  3FTD A;  4LRT A;  5KPZ A;  1WIV A;  3BBZ A;  1NL6 A;  2YJC A;  5JI2 E;  3IEC A;  3GRV A;  2R9C A;  1GMY A;  4FVM A;  3C9P A;  1DGH A;  2H5X A;  4XK8 F;  4JI1 M;  2OOA A;  3N4C A;  2R9N A;  4EIW A;  1AIM A;  3V6C A;  3THG A;  3HWN A;  2CV2 A;  2UXC M;  2Y20 A;  3TE6 A;  2PNS A;  2E01 A;  4HL4 A;  3KW6 A;  2DC7 A;  3HHI A;  1IXZ A;  3GRU A;  2M60 A;  3FRI A;  2J7O A;  3GPY A;  3HU2 A;  4FWH A;  5GKN A;  1TGU A;  3FTF A;  4LJ6 A;  3U6L A;  3GRY A;  4NC6 A;  1DKI A;  3PSE A;  2DWM A;  5FTN A;  1QXP A;  2L4E A;  2GFO A;  2Z3X A;  2DAG A;  2AVW A;  3U6O A;  3GLI B;  4LF5 M;  4JV5 M;  3U6E A;  1IY2 A;  2AHM A;  4AZF A;  2QBY A;  3HJS A;  5FTL A;  2AYO A;  1JQP A;  2OPF A;  3J27 B;  4B3S M;  4GKJ M;  1DGF A;  3CF0 A;  2IPP B;  3PDF A;  1EWM A;  4S12 A;  4XGI A;  2DVW B;  1Z5B A;  2E00 A;  4BOZ A;  1CV8 A;  3T15 A;  3SAU A;  1SXJ B;  5EXT A;  5JZE A;  4DV3 M;  2CEA A;  2MJ5 B;  3R9X B;  4QHT A;  3NHE A;  1QDQ A;  1XXH E;  4PI3 A;  2C9C A;  3QAU A;  2KRK A;  4FJC A;  1Q6K A;  4DV1 M;  1LV7 A;  1EE8 A;  2AUX A;  1UKF A;  3E21 A;  1GLN A;  2QSF X;  4IJF A;  1IN4 A;  3IG8 A;  1VQ1 A;  5CVM A;  2HWK A;  4B7F A;  4YHH M;  4GMQ A;  3MHV C;  2LH0 A;  1UFZ A;  3E1Z B;  1DEU A;  7PCK A;  3GLH E;  3KSX A;  4IP3 A;  1Z59 A;  3BCN A;  4GC9 A;  1PJQ A;  2P7U A;  2VDB B;  3L29 A;  3NBI A;  4LGY A;  2VHS A;  3QJ3 A;  1SXJ D;  3FYC A;  4OVZ B;  3SAS A;  3SHG B;  3SAR A;  1STF E;  2Z4R A;  2AUZ A;  2HD5 A;  3PNY A;  3LMM A;  4MH0 E;  2F1G A;  1V92 A;  5EQT A;  5J94 A;  4MSX A;  3GLG A;  3C9E A;  1R4G A;  3VDU A;  4W5C A;  3C3E A;  1GCB A;  3CF6 E;  1N36 M;  1PGY A;  3RE8 A;  1IBL M;  4IBI A;  4M9X A;  2DWN A;  3HU1 A;  3PRP A;  3V6E A;  4ZTB A;  4B7H A;  5EP2 A;  3PBH A;  1QAN A;  2Y5B A;  4MZS A;  5EF4 A;  2DZO B;  2P0R A;  1OTR A;  4MM3 B;  1GKI A;  4LJ8 A;  2BJV A;  1WHC A;  2KA6 B;  1DGG A;  4BSQ A;  1T6O A;  1F2B A;  4G4N A;  3LFY A;  2LHG A;  1Z5C A;  4N79 A;  4JI2 M;  4K7C A;  3FYD A;  4FCV A;  1TH4 A;  2XSZ D;  1K3W A;  2QNJ A;  1PPN A;  2F5P A;  1WJ7 A;  2DEN A;  3U61 B;  2KHH A;  1THE A;  2LHC A;  3PHX A;  2F7D A;  4FD2 A;  2R4J A;  1JQJ C;  4D81 A;  2DWL A;  2R9F A;  2G8J A;  3MHH A;  4DR5 M;  1L1T A;  3B9P A;  5KO3 A;  3F5V A;  4LF8 M;  2LVO C;  4KLB A;  1DGB A;  5LMU M;  3KOZ E;  1VJV A;  1M6D A;  3BOS A;  3RVV A;  2EO2 A;  2NQI A;  4RKU F;  3SFZ A;  4XR7 A;  3DA1 A;  3QT4 A;  2R4E A;  1AIP C;  3FTC A;  4BQV A;  2UUC M;  4GRI A;  1A6R A;  3VDP A;  4DBG B;  1J09 A;  2GQF A;  1QMY A;  3DF0 A;  4MGK E;  4XBO A;  3HJQ A;  4B08 A;  4KO8 A;  4M0D A;  5L8R F;  2B3T A;  4HXD B;  1Z5A A;  5FTK A;  1PPD A;  4N4Z A;  2KZS A;  2MH8 A;  3GPX A;  2G8E A;  2ZAM A;  3U60 B;  1ZMW A;  3OF8 A;  3LW5 F;  2BTW A;  3K9O A;  2DCB A;  3T38 A;  1E32 A;  1ORY B;  4K0K M;  1NB5 A;  2K47 A;  3ZC7 B;  4L4U A; 
#chains in the Genus database with same CATH homology
 5LMN M;  4MGZ E;  4WUR A;  3EIH A;  2XLJ A;  2V6Z M;  2XF3 A;  1H6U A;  3T1Y M;  4TUW A;  4JYA M;  4LRS A;  3TWK A;  4BOS A;  4FW9 A;  4OX9 M;  3KOW E;  2AGA A;  4G4R A;  4DUY M;  4JI4 M;  3E9S A;  2D7E A;  1N33 M;  1KSF X;  1L2D A;  4D80 A;  3FUV A;  4BOQ A;  3RGP A;  2R62 A;  1TDH A;  2FNA A;  8CAT A;  4ITQ A;  3I4Y A;  2J7Q A;  4DR7 M;  2CHG A;  4FCT A;  3U5Z B;  2R18 A;  3L28 A;  3SBJ A;  4JI7 M;  4GC5 A;  5BR8 M;  3LVV A;  4LG2 A;  4B3R M;  2C9O A;  5KQ8 A;  2F5S A;  2FE8 A;  3TRK A;  1IQP A;  3M6A A;  3T1H M;  1S3S A;  5FTJ A;  4PDG A;  2H1R A;  3SMP A;  3BB7 A;  2UXB M;  1L8Q A;  4D82 A;  4RF0 A;  2Z7J A;  4DV6 M;  3RFW A;  4P16 A;  2YFQ A;  3TPZ A;  5EZS A;  4DV5 M;  2ZAO A;  2C99 A;  4L78 A;  1XMO M;  4LFB M;  3AJI B;  3SAW A;  4I8O A;  2X4A A;  3VFD A;  2UU9 M;  3FTD A;  1IBK M;  4RNA A;  4M9S A;  3L2A A;  4LRT A;  4AG5 A;  5KPZ A;  2UUA M;  1XHB A;  4NRV A;  3KFU G;  1UM8 A;  2RKO A;  3PT2 A;  2CV1 A;  5JI2 E;  2RGO A;  3RGS A;  5F3W A;  3J80 S;  4M9Z A;  4IBJ A;  2E5L M;  3D8L A;  1E9R A;  3A45 A;  3GRV A;  4B7G A;  5ITX A;  3U6S A;  3TMP A;  4FVM A;  2LNH C;  2C5R A;  1TH3 A;  3NWL A;  4MB7 A;  1GL6 A;  1SXJ C;  3WHL A;  5EZQ A;  2R65 A;  3GP1 A;  2CV0 A;  1GVN A;  4B3M M;  1DGH A;  3LQQ A;  4JI1 M;  3O65 A;  4NL4 H;  4LF4 M;  2V1C A;  4DV2 M;  5JI3 E;  3HHY A;  5C1B A;  5ITU A;  5FTM A;  4EIW A;  1MU5 A;  2D7G A;  3FUW A;  4LJ5 A;  3SC3 A;  2EUC A;  3K1J A;  3THG A;  3BY4 A;  4DUZ M;  4IBE A;  2BJW A;  4X64 M;  4QOZ C;  1VDD A;  1G3I A;  2XZF A;  4L15 A;  2CV2 A;  3LVW A;  2UXC M;  2Y20 A;  2YNM D;  4KHP M;  2L6O A;  3TE6 A;  3WHK A;  4BOU A;  4IJE A;  4AG6 A;  1NVM A;  4HL4 A;  3HU3 A;  2FOI C;  1YUB A;  3C58 A;  3AL0 C;  4DV4 M;  1IM2 A;  3GPP A;  3KW6 A;  4KLN A;  2ZM6 M;  4A5U A;  2J7N A;  2ZAN A;  1DGH B;  4LJ7 A;  2R45 A;  1FNN A;  2VQF M;  1IXZ A;  4AKG A;  1QQW A;  3GRU A;  2M60 A;  2XEP A;  1QAM A;  3HJ8 A;  2J7O A;  1YZB A;  3M0E A;  2G5G X;  2L7I A;  1XC8 A;  4PDI A;  2NQ8 C;  5FSW A;  3MP2 A;  3I4V A;  2LWX A;  4Z8X A;  3KP0 E;  3U6C A;  3ILK A;  3GPY A;  2F5O A;  3HU2 A;  3L25 A;  4FWH A;  5GKN A;  3PNV A;  3GLG B;  1TGU A;  3FTF A;  1HNW M;  4LJ6 A;  3GQ3 A;  1G4A E;  3U6L A;  3GRY A;  1DKI A;  3PSE A;  4IUM A;  3CTW B;  3TWM A;  2DWM A;  1PJJ A;  3KVW A;  5FTN A;  1HR0 M;  1DO2 A;  4JI3 M;  2DWZ B;  4BLC A;  3DFZ A;  3K2L A;  3TWL A;  3DZD A;  3UJN A;  2Z3X A;  4X66 M;  3U6Q A;  4CHT B;  2OQ4 A;  4LFC M;  1XNQ M;  3U6O A;  3IG5 A;  3GLI B;  4LF5 M;  3U6E A;  4JV5 M;  4QNR A;  1IY2 A;  2AHM A;  3UMM A;  4DR4 M;  3GLI A;  2F4V M;  3AFH A;  1IY1 A;  4PD2 A;  4AZF A;  4GIP A;  3HHW A;  4OVZ A;  1N77 A;  1JR3 A;  1N75 A;  2QBY A;  2G8L A;  3HJS A;  4NSR A;  5DYG A;  5FTL A;  5IRE B;  1R6B X;  1HT1 E;  2OPF A;  4IBD A;  4RKX A;  3J27 B;  4B3S M;  1NY6 A;  1DGF A;  3CF0 A;  4GKJ M;  1L2B A;  5E26 A;  2BNK A;  2X8A A;  4PT5 A;  3TQS A;  1DO0 A;  3HHZ A;  4S12 A;  4XGI A;  2A5Y B;  2DVW B;  2JTC A;  1Z5B A;  4DR1 M;  4I5S A;  4BOZ A;  3T15 A;  3SAU A;  4NXN M;  4LF6 M;  4DR6 M;  1SXJ B;  2V1U A;  5EXT A;  1C1K A;  4IBG A;  5JZE A;  3I51 A;  4DV3 M;  1SXJ E;  2CEA A;  3PVS A;  3SHF A;  1TDZ A;  3R9X B;  4QHT A;  1XMQ M;  4X62 M;  3GRR A;  3PXG A;  3MK6 A;  2C9C A;  3W31 A;  3QAU A;  3PFI A;  2KRK A;  1W5S A;  2Y0Q A;  3L27 A;  3UGJ A;  1IY0 A;  4MGH A;  4DV1 M;  2F5N A;  1LV7 A;  1KYI A;  1EE8 A;  3E4R A;  1UKF A;  1Q3C A;  3EIE A;  4AKH A;  4D8I A;  1I94 M;  1GLN A;  5A2Q S;  5IWA M;  3U5Z A;  1J7K A;  4IJF A;  1IN4 A;  3IG8 A;  2EA0 A;  5EXP A;  2VII A;  1ZAE A;  3JAM S;  4FWG A;  5EP1 A;  5BPV A;  4B7F A;  4YHH M;  2HWK A;  4GMQ A;  3KXE C;  1QYR A;  3CF2 A;  4D8E A;  1QZM A;  3MHV C;  2LH0 A;  2YQZ A;  4DR2 M;  4JI5 M;  3B21 A;  3J2P B;  4IIW A;  4R3D A;  1E9S A;  2F5Q A;  4DV0 M;  3LQR A;  3A98 B;  3A42 A;  4LCB A;  3KSX A;  4LZZ A;  1Z59 A;  2P5T A;  4IP3 A;  4GC9 A;  2KRU A;  5IZ7 D;  1HNZ M;  3KSJ A;  5EJC A;  4JN6 A;  2C96 A;  2C98 A;  4RF1 A;  2D7H A;  1Q39 A;  3L29 A;  4DV7 M;  2HHH M;  3NBI A;  4LGY A;  5ITT A;  1NNJ A;  1NY5 A;  2JRI A;  1QAQ A;  4QHS A;  1SXJ D;  3FYC A;  1YSY A;  1Q3B A;  4LY6 A;  3A46 A;  3OTO M;  3FUT A;  3JR5 A;  4ZPX A;  5KPR A;  4OVZ B;  3SAS A;  3SHG B;  3Q8X A;  3VKH A;  3L26 A;  3FD9 A;  3SAR A;  3U60 A;  2DZN B;  2Z4R A;  2QZ4 A;  4AW4 A;  4WW0 A;  3U6P A;  3PNY A;  3KOY E;  3ZH9 B;  1N32 M;  1XWI A;  1YE9 A;  3VK7 A;  3PHU A;  5DYI A;  3KS8 A;  2LXE A;  2QCU A;  2ERC A;  3LMM A;  5EP3 A;  3GLH A;  4MH0 E;  2XZU A;  2O5R A;  5DNY A;  3IFU A;  5EQT A;  5H37 D;  1L1Z A;  4GH9 A;  1NHG C;  3J7B A;  4NXM M;  3GLG A;  1PVJ A;  2UXD M;  1WXQ A;  3VDU A;  2CHV A;  2Z4S A;  4LZJ A;  2XSZ A;  2I7N A;  3CF6 E;  1N36 M;  4XZX A;  5ITQ A;  4YY3 M;  3GQ5 A;  4LF7 M;  2M5Z A;  3RE8 A;  3SAT A;  5IT9 S;  1IBL M;  3AV0 A;  4IBI A;  1SXJ A;  3SYL A;  4M9X A;  2DWN A;  3HU1 A;  3UK6 A;  3PRP A;  4ZTB A;  2J7Q C;  4B7H A;  5EP2 A;  1IN8 A;  3U6D A;  1QAN A;  1NJG A;  2XFS A;  1X37 A;  3BBA A;  3GLH B;  4QOS A;  2DZO B;  4X65 M;  4JXJ A;  2RGH A;  4IBK A;  1Z6T A;  1NHW C;  4MM3 B;  1XXH A;  2L09 A;  1E94 E;  3AOG A;  3GLF B;  1IN5 A;  1GKI A;  2CFO A;  4LJ8 A;  2FFJ A;  2BJV A;  4R7G A;  1D2N A;  2KA6 B;  1OFI A;  1J5E M;  2KW0 A;  1DGG A;  1HQC A;  1W5T A;  4II7 A;  1L2C A;  4M0W A;  3OQC A;  3W0F A;  4LF9 M;  3TL4 X;  4NSO B;  4G4N A;  4JI6 M;  4REZ A;  3C0R A;  3AOE C;  2ZBK B;  1Z5C A;  2QP9 X;  3AOE A;  3VKG A;  4JI2 M;  2Q2E B;  3M7G A;  1PM5 A;  4LJ9 A;  1IN7 A;  5EP4 A;  3SYK A;  3FYD A;  4NRW A;  4LJA A;  4FCV A;  1XNR M;  2VQE M;  2DOS A;  1ZQ9 A;  1TH4 A;  3MTV A;  2JA2 A;  3KDS E;  5C18 A;  2XSZ D;  1N78 A;  4QNM A;  5EXS A;  4DR3 M;  1K3W A;  1HT2 E;  1NSF A;  1OJL A;  2KZU A;  2W82 A;  5KQD A;  2F5P A;  2BU3 A;  4AQY M;  4LFA M;  1HQY E;  2XGN A;  4IBB A;  3U61 B;  1QVR A;  2X49 A;  1IXS B;  2CE7 A;  3H4M A;  3ZNH A;  2QPA A;  4OW0 A;  3JR4 A;  3U61 A;  1R2Y A;  1N34 M;  3PHX A;  4D8B A;  4FD2 A;  2R4J A;  4A3V B;  5KPT A;  3K92 A;  3R8F A;  1PJI A;  1GL7 A;  3W0L B;  3VK8 A;  1JQJ C;  4D81 A;  2DWL A;  2HL7 A;  2L7H A;  4DR5 M;  4LJ4 A;  1L1T A;  3B9P A;  4PCZ A;  3KOX E;  3UZU A;  1IN6 A;  1NJF A;  3HKP A;  5KO3 A;  2XH9 A;  3J81 S;  2YR0 A;  4LF8 M;  2DHR A;  1DGB A;  2R46 A;  4AKI A;  2Y0T A;  3HWS A;  4OU7 A;  2Y21 A;  5LMU M;  3HGI A;  3KOZ E;  3KP1 E;  1IXR C;  3AKZ A;  3PRM A;  3J7A S;  2KEB A;  1TH2 A;  1XXH B;  3BOS A;  2EO2 A;  3SMS A;  3GQ4 A;  3SFZ A;  3DA1 A;  4MI7 A;  2R4E A;  2I7P A;  1JR3 D;  3FTC A;  4GUA A;  2UUC M;  4G4O A;  4GRI A;  4GKK M;  1I4W A;  1IBM M;  3VDP A;  3VLF B;  4JI0 M;  1NNU C;  1J09 A;  1G41 A;  2CHQ A;  4CIS A;  4B3T M;  5ITX E;  4MGY E;  3RNV A;  1OFH A;  4L16 A;  2UUB M;  5FLX S;  4MGK E;  4XBO A;  3HJQ A;  4GIT A;  4IBC A;  2HCB A;  4B08 A;  3QWL A;  4KO8 A;  4M0D A;  1G8P A;  1MX0 A;  2CUZ A;  7CAT A;  3FUU A;  4GHL A;  2QBY B;  4HXD B;  1Z5A A;  2KXE A;  4MGI E;  3GO8 A;  2Z84 A;  5E6J A;  5FTK A;  3KS4 A;  2UZJ A;  3K8Z A;  4LGM A;  1R2Z A;  3MJ5 A;  2KZS A;  4FCW A;  4HLQ A;  4I81 A;  1K3X A;  2XFT A;  5ITR A;  3ZCB B;  5EXX A;  4IBF A;  4BB9 A;  3FTE A;  4Z6Y A;  3GPX A;  2ZAM A;  1HNX M;  2BTW B;  4JI8 M;  4GHA A;  3U60 B;  4G6Z A;  1G59 A;  4BBA A;  3U6M A;  3FKE A;  1T3T A;  4FWD A;  1K82 A;  3PHW A;  1KFV A;  3W30 A;  2HKJ A;  2BTW A;  3FUX A;  3HHX A;  4L8R C;  3T38 A;  4G4Q A;  1E32 A;  1QAO A;  4BOP A;  3SAV A;  1ORY B;  4NOO B;  5ITY A;  4K0K M;  3GLF A;  2K47 A;  3ZC7 B;  4CGY B;  4I4L A;  4L4U A;  3D8B A;  4KOD A;  2DXI A;  2QEN A;  4AI6 A;  3DOA A;  1FJG M;  4W5W A;  3GPU A;  1R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...