5KO3A

Structure of a core papain-like protease of mers coronavirus with utility for structure-based drug design
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
257
structure length
255
Chain Sequence
DETKALKELYGPVDPTFLRFYSLKAAVHGWKMVVCDKVRSLKLSDNNYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF1a
publication title X-ray Structure and Enzymatic Activity Profile of a Core Papain-like Protease of MERS Coronavirus with utility for structure-based drug design.
pubmed doi rcsb
source organism Middle east respiratory syndrome coronavirus
total genus 71
structure length 255
sequence length 257
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1190 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5ko3A01
3.90.70.90 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 5ko3A02
3E9SA 4PT5A 4OVZA 5KO3A 4OW0A 4REZA 4RF0A 4WURA 5E6JA 4M0WA 4MM3B 4RNAA 3MP2A 4RF1A 4OVZB 2FE8A 4P16A 3MJ5A 4R3DA
chains in the Genus database with same CATH superfamily
1U9QX 3NBXX 2JTCA 3HKPA 1NL6A 1ICFA 1GJTA 5EXTA 4YYUA 4II7A 2XGNA 2DKLA 1MDWA 3HHAA 1F29A 2HH5A 1IBKM 1YALA 4HXDB 4MGHA 2F5QA 2R9OA 3W68A 3D6SA 1XHBA 5EP1A 5EP3A 3ILKA 3LXSA 4REZA 3UK6A 2BJVA 4LF8M 4NOOB 1ME3A 1ME4A 2YJCA 2VQFM 3IV2A 1TLOA 3V76A 1N75A 2ZAMA 3B7NA 3PFIA 2DCBA 3I51A 4AKGA 4M9SA 1YK7A 2XSZD 3PHWA 3SASA 5DYIA 3GLIE 4G4RA 3MTVA 3KS4A 1IXRC 4LFCM 1OKSA 3OTOM 3ZC7B 2DHRA 3A45A 2DJGB 4PADA 3KWBX 3GLGA 4G4NA 1SXJE 1QVRA 1CV8A 1DGGA 2F5OA 2LHCA 1J7KA 1NB3A 4IBIA 4B08A 2RRUA 4DBGB 4LRTA 5FTKA 2ZTCA 2MJ5B 1POPA 3K9OA 1NJFA 1JB0F 5JA7A 4DR4M 3H8CA 1PJIA 3PNVA 2E02A 2BDZA 2KNAA 2JP7A 3U6EA 2G5GX 1K3XA 1N34M 2DAGA 3OF8A 4TUWA 5PADA 2DAMA 1TF0B 5FTMA 2E00A 1BGOA 3QT4A 3FTDA 4XZXA 2UXCM 4MB7A 3I3TA 4D81A 4X6HA 2R9FA 3VK7A 1IY1A 2P86A 4DV5M 3AL0C 1VQ1A 2QSFX 1XB2B 1HJPA 3PT2A 4LFAM 1K3WA 3VFDA 4GMQA 5E26A 2D7HA 2FUDA 3HHXA 2FT2A 1L2DA 1CVZA 3MHSA 4QH6A 4X66M 2CV1A 4LZJA 5FTJA 1HR0M 3GLHB 1XXHB 4S12A 4JI4M 2JWSA 3RGPA 3FTFA 3F75A 1NQCA 1V34A 4B3TM 1QANA 1R2YA 3TMPA 3EIEA 4NXMM 1IN6A 3GPXA 4LGYA 1WGNA 1HNWM 1EWOA 1TH4A 3SBJA 1NPZA 3U61B 2LVPC 2KEBA 4NRVA 3QYEA 5ITRA 1GCBA 3FUUA 3O0UA 1XXHA 4QRGA 1YSYA 1GABA 3SATA 5LMNM 2E5LM 5A24A 4IBFA 3TWMA 1Y8GA 4YY3M 4DR6M 4RF0A 2F7DA 2AGAA 3PXGA 4LY6A 1CSBB 1ZIVA 4IBBA 1GL7A 3U61A 3DF0A 4PD2A 4N4ZA 1N78A 2Y0TA 3HX3A 1KHPA 1KSFX 2IBIA 3TL4X 2B1MA 2G6DA 5IT9S 2H7JA 4IJFA 2ZM6M 3U6LA 4CIZA 1CJLA 4MI7A 4LF7M 4Q8HA 1M6DA 3P5VA 1QDRA 3AV0A 3K8ZA 1Q3CA 1PGYA 4BQVA 3M0EA 1NNUC 3JR5A 2KRUA 3LFYA 3S3QA 1THEA 1NNJA 3HJQA 4FIPA 3V6CA 3QSDA 1CQDA 2VF8A 4JI2M 3K9PA 1GL6A 3LQQA 3C58A 2OOAA 2K47A 4AKHA 1N32M 5KQ8A 3BY4A 1NV8A 3H7DA 2JY5A 2KNVA 3KS8A 4M0WA 1V92A 2BTWA 4CDCB 2BU3A 2FO5A 3HHWA 2DI0A 1FH0A 2UUBM 2JQFR 3SYLA 2ERCA 3I04M 3SAUA 1SP4B 3RGSA 2DZNB 4IBGA 1XNQM 2CE7A 1WGLA 3QWLA 4JI0M 4DV0M 1HT1E 4CZWA 2XSZA 2AYNA 2UZJA 4OU7A 1WHCA 1OJLA 4OW0A 2D7GA 3ERVA 4F1IA 3LVVA 2YJBA 4LCBA 4LF4M 3K9MA 4IUMA 3DFZA 3H8BA 5EP4A 2B3TA 4WA6A 2DWLA 4DMYA 2UXDM 3U60B 2G8LA 1E32A 2DCDA 2YFQA 1QUTA 1IXSA 1PIPA 2HXZA 3D8LA 2MGWA 2DNAA 2DZOB 3KOWE 1HUCB 3CGWA 2CEAA 2WZJA 1ORYB 3RNVA 4KODA 5IWAM 2DC6A 5KO3A 2V1CA 2WSCF 4IBEA 5A2QS 3U60A 2DCCA 3SAVA 3MP2A 3MMPA 1OQYA 2JUJA 1HQCA 5ITQA 1D0MA 3FUXA 3QJ3A 3PW3A 2X8AA 3H4MA 4LJ8A 4YYSA 1YT7A 1PVJA 4I4LA 2XZFA 3O1GA 4LF9M 4DV2M 1C1KA 1HT2E 3KP1E 2R6FA 1GLNA 1PPDA 2LVNC 3HGIA 1XNRM 1OIPA 3SC3A 1RU3A 4LG2A 4ZTBA 4NXNM 1TTEA 4P6GA 2CHVA 1AU3A 4IP3A 4I8OA 4A3VB 2HWJA 3TE6A 5DNYA 1DGBA 3I4VA 3FTCA 5FLXS 2YNMD 1SXJD 3B79A 2EKFA 4KO8A 5FTNA 1GKIA 3A46A 5ITUA 1YVBA 4GITA 2CHQA 4CGYB 4X62M 3VDPA 5CHVA 4B3SM 4CDDB 4FCWA 4A5UA 3F5VA 1R2ZA 3AOGA 1NV9A 2I7PA 1DO0A 4FWDA 4LJ9A 3P5WA 5KPRA 1CS8A 1N36M 1Z59A 3TWLA 4D8EA 5FTLA 4QNRA 3C9EA 1BP4A 1CPJA 4QNMA 3KX1A 1WJ7A 8CATA 3J27B 1FNNA 1PJTA 1DO2A 2AHMA 4JI5M 1I94M 3AFHA 4M9XA 1L2CA 5EZQA 3PBHA 4R71A 1ZQ9A 3HZJA 1UKFA 2AUXA 2HWKA 2BNKA 1PPOA 5IZ7D 3P5UA 2WBFX 4L78A 2XFTA 2R4EA 5EZSA 3KOYE 3N4CA 2L7IA 2UXBM 1P3QQ 5J94A 4FCTA 3MJ5A 1IY2A 4CISA 3HJSA 2JXNA 2XH9A 2C0YA 1SXJC 1GECE 3CBKA 3WXFA 3KWZA 2ZBKB 3U6OA 1AECA 9PAPA 5CVNB 1MEMA 3SARA 2LXEA 4BOSA 3KVWA 3SMSA 1TR8A 2DXIA 1PPPA 1PM5A 3B21A 1KFVA 3FUVA 5JI2E 3USVA 4XK8F 3HHIA 1AUAA 3FRIA 2F5NA 3GPYA 4DUZM 4D8IA 3GLGB 2F5PA 2FOIC 1OIZA 3C3DA 4M0DA 3I4YA 1R7RA 2PREA 4NC6A 4K7CA 1OAIA 1OFHA 2CV0A 2PADA 2QHOB 1PJJA 3WHKA 1MJGM 2ZANA 2L2DA 5ITXA 4XBOA 1GJSA 3DOAA 4G4QA 3IFUA 3N3KA 1EWMA 5ITYA 3V6EA 2CUZA 3PNRA 3A42A 1IN4A 2VIIA 3U6CA 1NY6A 4L4UA 4BS6A 1ATKA 3IMAA 2WSEF 1D0KA 1LTMA 4MGZE 4MGIE 2V1UA 4MGYE 1Q39A 3L25A 3P5XA 2LWXA 3UGJA 3L29A 2O25A 3GLHE 1XXHE 3L27A 1L2BA 1H6UA 4JI7M 2KXEA 4DR5M 2WSFF 2KDLA 4FK5A 5EGWA 1F2AA 1OFIA 3KW6A 1NB5A 3BBZA 3PDFA 2Y5BA 3BCNA 3CF6E 1Q3BA 3U8EA 2H5XA 2YJ9A 1K3BB 3C3EA 1JR3A 5FPWA 2VHFA 2QZ4A 2IPPB 1YLAA 4CHTB 1X9YA 2JNHA 3OISA 3QYBA 2FRAA 4B7HA 4M9ZA 2R9MA 3CTWB 1JQJC 1G4AE 3U5ZB 4RY2A 3TNXA 2CHGA 2OZ2A 3K92A 4DV4M 3GRYA 2R44A 3HD3A 4DV1M 1DEUA 4GC5A 1KFUL 3VLFB 4AI6A 2JY8A 2LNHC 1S4VA 1GVNA 3HHYA 1GLOA 4GKJM 4R3DA 4K0KM 4Q8GA 4JYAM 3GRRA 2C96A 3R8FA 2BDLA 3U5ZA 3T15A 2CRUA 3FKEA 3KSXA 2DWNA 2G8JA 8PCHA 3EIHA 1T43A 2DAKA 2J7QC 2R62A 1I4WA 1IQPA 3OF9A 4FD2A 1EIJA 2OQ4A 3GLFB 3BPMA 2KA6B 2OPFA 1L1TA 5L8RF 4BOUA 3T6PA 4Z6YA 1PBHA 3BOSA 3MK6A 3B7QA 4BOQA 3THGA 4DV3M 3TPZA 3HWNA 2Y6EA 1EE8A 4RKXA 5KQDA 2XZUA 1U9XA 5EXPA 1ITOA 2C5RA 3OVZA 2O6XA 3GLFA 2DWMA 5ITTA 3B9PA 1D2NA 2BTWB 2DOSA 4GC9A 4DV7M 4XR7A 4JI3M 3KSJA 1PE6A 3SMPA 5IREB 4L8RC 4Z8XA 1J5EM 1VEJA 1D0LA 2L6OA 2KRKA 2YR0A 3OVXA 3LCVB 1GMYA 2DHYA 1KYIA 1Z6TA 1EF7A 2F4VM 3J7AS 4LF5M 2VDBB 4ZUXU 3J2PB 3BOWA 2Y21A 1R6BX 1Y08A 4RF1A 4MSXA 3LCUA 2QPAA 1QXPA 2XU1A 1XMOM 2DZZA 2XFSA 2R65A 1MS6A 4HL4A 2QNJA 4G54A 1ZMVA 3W0FA 3GPPA 3J7BA 2K9DA 4FW9A 1IBLM 3C0RA 4I07A 4WP2A 1A6RA 3GRUA 1UFZA 2HCBA 4HEOA 3DA1A 1IXSB 2R4JA 2XU3A 3SHGB 2X4AA 2BJWA 1G3IA 4F2LA 3KFQA 3ZH9B 3RVXA 2KNZA 4B3RM 4BPVA 5BPVA 2QBYB 3KW9A 1N77A 2C98A 2GHUA 3CBJA 1XC8A 1OTRA 4NRWA 1IWDA 2X49A 4LRSA 1VDLA 1AU4A 3LQRA 2QCUA 2CB5A 3PNYA 2F5SA 4XGIA 1DF0A 1F4IA 2JY7A 3GQ5A 4AQYM 3H6SA 2OP3A 1KXRA 2GFOA 2HAKA 4YV8A 3N3GA 2M5ZA 1VDDA 2GQFA 2QBYA 1T6OA 3ZCBB 2VHSA 1G41A 4W5BA 4YYQA 2PNSA 3VDUA 3GO8A 3M6AA 4X6IA 3HY5A 1EWLA 4BSQA 3SYKA 4WW0A 2R18A 1ZV1A 2L4EA 2Z4RA 1DGHB 1QUSA 3D8BA 1WR1B 1QAMA 2Z4SA 2Z8YM 4W5CA 4GEWA 3RFWA 1MN3A 3UZUA 1DV0A 1F2CA 4GIPA 4GHLA 2Z3XA 6PADA 1PRBA 3BPFA 1EWPA 3VKGA 3KXEC 1NJGA 5CHTA 5DYGA 4AG6A 3U6QA 2C99A 1R4GA 4LF6M 1NLJA 2YQZA 2J5YA 3E46A 1PCIA 1Q6KA 1DGHA 1OAOC 2AYOA 1QYRA 2QP9X 3R9XB 2UUAM 2DWZB 3W67A 3CF2A 2ZTDA 4GHAA 2VQEM 1QMYA 2G8EA 1C7YA 4OX9M 4MZOA 4JN6A 4LJ6A 1E9RA 1E94E 4PP1A 3Q8XA 3KDSE 5EF4A 4P6EA 1CUKA 3U6SA 4X65M 3FUWA 4L16A 3IG8A 4PCZA 2HHHM 2HD5A 4JXJA 5FSWA 5EP2A 2JZ0A 4QOZC 2R9NA 1X37A 4XUIA 3QAUA 3AI8A 5LMUM 3C9PA 3AOEC 2ACTA 1IFYA 4RNAA 1ZAEA 3FUTA 4G6ZA 4AXLA 1IM2A 1AYUA 4RKUF 5F02A 5ITXE 3KOXE 2RKOA 4Y28F 1A5TA 5GKNA 5C18A 3GLGE 2EJSA 4I04A 2JQGR 2DAIA 2MR9A 1QDQA 2H1RA 2G7YA 5JH3A 3S3RA 1U9VA 4FWHA 3MORA 1VJVA 2N35A 1GO5A 2FNAA 2OO9A 4BB9A 1T3TA 1W5SA 4UN2B 3CH3X 3GRVA 4CDFB 2E01A 4IJEA 1F2BA 4GKKM 4YVAA 2DC9A 4NSRA 4FVMA 1N33M 2QENA 2YJ8A 4ZPXA 4B7FA 4B7GA 1TH2A 2Z7JA 5BR8M 2FE8A 1NY5A 4JI1M 3VK8A 2KW0A 2NQGA 3AJIB 3RVVA 2C9OA 1O0EA 3IEJA 2LVQD 1W5TA 2EUCA 4OEMA 2B1NA 3JR4A 1IN7A 1JR3E 2R0IA 1BY8A 1NHWC 4CJ6A 2AU1A 1QZMA 4DV6M 1TH3A 4MGKE 3GPUA 3HU2A 3LVWA 2FFJA 4DUYM 3LW5F 2YJ2A 1J09A 2GNOA 1HQYE 4DR7M 2L09A 4X64M 2XU4A 1NVMA 1G8PA 4L15A 1L8QA 1XMQM 2APLA 3J81S 3T1YM 1WIVA 5K16A 4X6JA 1HNXM 4YYVA 2CP8A 1CB5A 4KLNA 3L2AA 3HHZA 4HWYA 2L4FA 1DKIA 2R46A 2LVOC 4N8WA 2RGOA 4LZZA 2JZ1A 4DR3M 3U6MA 3M7GA 1AU2A 3O65A 1MEGA 5JI3E 1XKGA 3GLIB 2XF3A 2DC7A 1CTEA 3GQ3A 1FJGM 4PI3A 4AXMA 2D7EA 3U6DA 3AOEA 2DCAA 1PADA 4PDGA 4IIWA 1SXJB 1Z5BA 2DAEA 5KPZA 2JRIA 2O01F 2QQ8A 4BOPA 2AVWA 4MH0E 1LV7A 2KHHA 1AYWA 2KZSA 4LGMA 3IG5A 4BLCA 2P5TA 1EFUB 3IHPA 3L28A 4IBDA 4CDEB 3GLIA 1VEKA 2CFOA 3GLFE 4JV5M 4W5WA 3U6PA 2HHNA 4KLBA 2EKKA 3SAWA 4IBKA 1SXJA 1TDHA 2CIOA 2K0BX 4BS5A 3L26A 3GQ4A 1UM8A 1MIRA 1PPNA 3LMMA 3WXGA 2Y0QA 4LJ7A 4LJ5A 3TWKA 3E1ZB 3NBIA 3K1JA 4GRIA 3GLHA 2K6BA 3AKZA 3HU1A 1TL9A 1AU0A 2LHGA 3TQSA 1MU5A 1G71A 2FRQA 1E9SA 3SHFA 1YE9A 2DJFB 1NSFA 2LH0A 1MX0A 4OVZB 4PP2E 3FE3A 2NQIA 3BB7A 2MROB 1AIMA 3PSEA 2J7NA 3E9SA 1JQPA 3FRHA 4IBCA 3PRPA 2ZAOA 3E21A 3T1HM 4DR1M 3DZDA 2VF7A 2G3QA 4KHPM 4D82A 3GCBA 5EQTA 3A98B 4OVZA 4PDIA 4YYWA 2DVWB 2JY6B 4OELA 3K2LA 5F3WA 3T38A 2XEPA 4ANRA 1YK8A 3KP0E 2OOBA 3J80S 2P7UA 4BOZA 3ZQJA 3H4JA 2ATOA 3NWLA 2MH8A 2DZYA 4JI6M 2EO2A 4FJCA 1Z5AA 4I05A 4QHTA 3NHEA 4Q7JA 4ITQA 3WHLA 3BXWA 2CV2A 3FTEA 2AIMA 5EXSA 3ZUAA 4G3OA 2A5YB 3E4RA 1BQIA 1KFXL 5DFLA 1L1ZA 3TRKA 5H37D 4MZSA 2NQ8C 2C9CA 1PJQA 2LTUA 1VEGA 4IBJA 1KHQA 2OULA 1Q02A 3I01M 4GH9A 4W4UA 3CF0A 1QZEA 1U9WA 3RVWA 3HWSA 1TGUA 2DENA 2Y20A 3W0LB 2R6NA 2L7HA 4DMXA 1ZMUA 2V6ZM 5E6JA 4FCVA 5CVOB 2KZUA 1SNKA 4QRVA 1VG5A 2FTDA 2NQAA 1STFE 1S3SA 5C1BA 3Q8GA 2FS1A 3BC3A 2DC8A 3W30A 3PVSA 2JA2A 3UJNA 1TDZA 1VSNA 3B7ZA 4AKIA 4QBBA 3HU3A 1YZBA 2FH0A 2J7OA 2J7QA 1QAOA 4EIWA 1IY0A 3OQCA 3PHXA 1BVSA 2XU5A 2P0RA 1SG9A 3IUTA 7PCKA 3F92A 4NL4H 2F1GA 4WURA 2BWBA 3UMMA 1AYVA 3PRMA 5EJCA 4I81A 2BWEA 4LJAA 3IECA 3FD9A 3PHUA 2I7NA 4PT5A 7CATA 3KKUA 4D80A 4LJ4A 2DZLA 3KFUG 3B74A 3VKHA 1JR3D 1IXZA 3MHVC 4YYRA 1IN8A 2AUZA 1TU6A 4YHHM 1R5LA 3GP1A 4QRXA 4JI8M 3M99A 4DR2M 4D8BA 3W31A 3JAMS 1QDTA 1V33A 4L6V6 2R45A 2Z84A 3BWKA 4MM3B 3I06A 4NSOB 1YUBA 1IBMM 2UU9M 1XWIA 3B89A 1Z5CA 4B3MM 3WXEA 2ARYA 1U5IA 2LBCA 3FYDA 1QOLA 4QOSA 5CVMA 3BBAA 4AG5A 3HJ8A 2XLJA 3CH2X 1PXVA 3KSEA 5JZEA 1AIPC 2HL7A 4HLQA 1HNZM 2M60A 2AS8A 2EA0A 3KOZE 4AZFA 1K82A 2Q2EB 4G4OA 1ZCMA 3IOQA 1QAQA 2UUCM 2E03A 2CWBA 2HKJA 4BBAA 1DGFA 4N79A 3RE8A 3SFZA 4QHSA 4FWGA 2FYEA 5KPTA 1ZMWA 4P16A 4AW4A 1Y4HA 2RGHA 2LVAA 4I5SA 1MHWA 1IN5A 3FYCA 3MTNA 1PJSA 1WXQA 2W82A 4KT0F 3MHHA 1G59A 2R9CA 1NO1A 4LFBM 4P17A 4R7GA 4GUAA 3K8UA 3K24A 5EXXA 1NHGC 1QQWA 2FQ9A 2PBHA 3ZNHA 3H89A 2NQDB 2O5RA
chains in the Genus database with same CATH topology
1SXJB 1Z5BA 2L6OA 2KRKA 2YR0A 5KPZA 2JRIA 2JTCA 3HKPA 3H4MA 4LJ8A 4BOPA 4MH0E 5EXTA 1LV7A 1KYIA 2KZSA 1PVJA 4I4LA 1Z6TA 2XZFA 2F4VM 4II7A 3J7AS 4LF9M 4LGMA 4LF5M 4DV2M 3J2PB 3IG5A 4BLCA 2XGNA 1C1KA 1HT2E 2P5TA 3KP1E 2Y21A 3L28A 1R6BX 4IBDA 4RF1A 3GLIA 1GLNA 2CFOA 4JV5M 1IBKM 2QPAA 4W5WA 3HGIA 4HXDB 4MGHA 1XNRM 3U6PA 1XMOM 3SC3A 2F5QA 4LG2A 2XFSA 2R65A 4ZTBA 4NXNM 1XHBA 5EP1A 2CHVA 5EP3A 4HL4A 3ILKA 4IP3A 4I8OA 4A3VB 4REZA 3SAWA 4IBKA 3UK6A 1SXJA 2BJVA 1TDHA 3TE6A 4LF8M 5DNYA 3W0FA 1DGBA 3I4VA 3FTCA 5FLXS 2YNMD 3GPPA 1SXJD 4NOOB 4KO8A 5FTNA 3J7BA 2VQFM 1GKIA 3A46A 3L26A 5ITUA 4FW9A 1IBLM 3GQ4A 3C0RA 4GITA 1N75A 2CHQA 2ZAMA 1UM8A 4CGYB 3VDPA 4X62M 3PFIA 4B3SM 4FCWA 4A5UA 3GRUA 3I51A 4AKGA 1R2ZA 3AOGA 2I7PA 2HCBA 3LMMA 4M9SA 1DO0A 3DA1A 1IXSB 2XSZD 2R4JA 2Y0QA 3PHWA 4FWDA 3SHGB 4LJ9A 4LJ7A 2X4AA 5DYIA 3SASA 2BJWA 1G3IA 4G4RA 4LJ5A 3KS4A 1IXRC 3TWKA 5KPRA 4LFCM 3ZH9B 3MTVA 3NBIA 3K1JA 1N36M 3OTOM 3ZC7B 1Z59A 3TWLA 4B3RM 4D8EA 2DHRA 3A45A 4GRIA 3GLHA 5BPVA 5FTLA 2QBYB 3GLGA 1N77A 3AKZA 4QNRA 3HU1A 4G4NA 2C98A 4QNMA 1XC8A 4NRWA 1SXJE 8CATA 1QVRA 1DGGA 2X49A 2F5OA 3J27B 1FNNA 4LRSA 3TQSA 1J7KA 1MU5A 4IBIA 1DO2A 3LQRA 2QCUA 1E9SA 2AHMA 1YE9A 3SHFA 4B08A 4JI5M 3PNYA 2F5SA 1I94M 3AFHA 4XGIA 4LRTA 5FTKA 4M9XA 4AQYM 3GQ5A 1L2CA 1NSFA 2LH0A 1MX0A 1NJFA 4OVZB 5EZQA 3BB7A 4DR4M 1UKFA 1ZQ9A 3PSEA 2M5ZA 1PJIA 2J7NA 3PNVA 3E9SA 2HWKA 1VDDA 2BNKA 3U6EA 5IZ7D 2G5GX 2QBYA 3ZCBB 1K3XA 1N34M 4IBCA 4TUWA 4L78A 3PRPA 1G41A 2XFTA 2R4EA 2ZAOA 3T1HM 4DR1M 5EZSA 3KOYE 3DZDA 3VDUA 3GO8A 2L7IA 5FTMA 3M6AA 4KHPM 4D82A 3SYKA 4WW0A 2UXBM 4FCTA 3MJ5A 1IY2A 2R18A 4CISA 3FTDA 4XZXA 2Z4RA 5EQTA 3HJSA 1DGHB 2UXCM 2XH9A 3A98B 3D8BA 1QAMA 1SXJC 2Z4SA 4OVZA 4PDIA 4MB7A 2DVWB 4D81A 3RFWA 3UZUA 3K2LA 5F3WA 2ZBKB 3U6OA 3T38A 3VK7A 2XEPA 4GIPA 4GHLA 1IY1A 2Z3XA 4DV5M 3SARA 3AL0C 3KP0E 2LXEA 3J80S 4BOSA 3KVWA 3SMSA 2DXIA 3PT2A 3VKGA 4LFAM 3KXEC 1PM5A 3VFDA 1NJGA 1K3WA 3B21A 1KFVA 4GMQA 5E26A 2D7HA 3FUVA 3HHXA 5DYGA 5JI2E 1L2DA 4BOZA 4AG6A 3U6QA 3NWLA 2C99A 4LF6M 4X66M 2YQZA 4JI6M 2EO2A 2CV1A 1DGHA 2F5NA 4LZJA 1Z5AA 5FTJA 3GPYA 1HR0M 4DUZM 4D8IA 4QHTA 3GLHB 1QYRA 1XXHB 3GLGB 2QP9X 4S12A 2F5PA 4JI4M 3R9XB 2UUAM 3RGPA 2FOIC 2DWZB 3FTFA 4ITQA 3WHLA 3CF2A 2CV2A 3FTEA 4M0DA 5EXSA 3I4YA 2A5YB 4B3TM 1QANA 1R2YA 3E4RA 2VQEM 4GHAA 3TMPA 4OX9M 1R7RA 3EIEA 4NXMM 4JN6A 1IN6A 3GPXA 4LGYA 2CV0A 1OFHA 1L1ZA 4LJ6A 3TRKA 1E9RA 5H37D 1E94E 1HNWM 1PJJA 3WHKA 3Q8XA 1TH4A 3KDSE 3SBJA 2ZANA 3U61B 2NQ8C 2KEBA 2C9CA 5ITXA 4IBJA 4XBOA 4NRVA 3U6SA 4X65M 5ITRA 3DOAA 3FUWA 3FUUA 4GH9A 4L16A 4G4QA 3IG8A 1XXHA 4PCZA 2HHHM 3IFUA 1YSYA 4JXJA 5ITYA 3CF0A 5FSWA 3SATA 2CUZA 5EP2A 3A42A 5LMNM 4QOZC 1IN4A 2E5LM 3HWSA 4IBFA 1TGUA 1X37A 2VIIA 3U6CA 3TWMA 1NY6A 4YY3M 4DR6M 3QAUA 4RF0A 2Y20A 4L4UA 3W0LB 2L7HA 2AGAA 3PXGA 4LY6A 5LMUM 2V6ZM 4IBBA 5E6JA 4MGZE 4MGIE 3AOEC 4FCVA 2V1UA 4MGYE 2KZUA 1GL7A 4RNAA 3U61A 1ZAEA 1Q39A 3FUTA 4G6ZA 4PD2A 1IM2A 3L25A 1S3SA 1N78A 2Y0TA 2LWXA 1KSFX 3UGJA 5C1BA 5ITXE 3L29A 3TL4X 3KOXE 2RKOA 3W30A 3PVSA 5IT9S 4IJFA 2JA2A 5GKNA 3UJNA 1TDZA 5C18A 2ZM6M 3U6LA 3L27A 1L2BA 1H6UA 4AKIA 3HU3A 4JI7M 1YZBA 2KXEA 2J7OA 2H1RA 2J7QA 1QAOA 4DR5M 4EIWA 4MI7A 4LF7M 1IY0A 3OQCA 3PHXA 3AV0A 3K8ZA 1Q3CA 4NL4H 1OFIA 4FWHA 3KW6A 3M0EA 4WURA 1NNUC 3JR5A 2KRUA 3UMMA 2FNAA 3CF6E 1NNJA 1Q3BA 4BB9A 1T3TA 3HJQA 5EJCA 3PRMA 1W5SA 4I81A 4LJAA 4JI2M 3FD9A 3PHUA 1GL6A 3LQQA 3C58A 2I7NA 1JR3A 3GRVA 2K47A 4PT5A 7CATA 4IJEA 4D80A 1N32M 4LJ4A 4AKHA 5KQ8A 4GKKM 3BY4A 3KFUG 3VKHA 1JR3D 1IXZA 4NSRA 3MHVC 1IN8A 4FVMA 2QZ4A 4CHTB 1N33M 3KS8A 4M0WA 2QENA 2BTWA 4B7HA 4M9ZA 4ZPXA 4B7FA 4B7GA 4YHHM 2BU3A 3CTWB 3HHWA 1TH2A 2Z7JA 1JQJC 5BR8M 2FE8A 1G4AE 3U5ZB 1NY5A 2CHGA 4JI1M 3VK8A 3GP1A 2KW0A 2UUBM 3K92A 3AJIB 4JI8M 4DV4M 4DR2M 4D8BA 3SYLA 3GRYA 3W31A 3JAMS 2C9OA 2ERCA 3SAUA 1W5TA 4DV1M 2EUCA 3RGSA 2DZNB 4IBGA 1XNQM 2R45A 4GC5A 2Z84A 2CE7A 3VLFB 3JR4A 4AI6A 4MM3B 3QWLA 2LNHC 1IN7A 4JI0M 4DV0M 1GVNA 4NSOB 1NHWC 1YUBA 1IBMM 2UU9M 3HHYA 1XWIA 4R3DA 1Z5CA 4GKJM 4K0KM 1QZMA 1HT1E 2XSZA 4B3MM 2UZJA 4OU7A 4JYAM 4DV6M 3GRRA 1TH3A 2C96A 3R8FA 3FYDA 4MGKE 3GPUA 3U5ZA 3HU2A 4QOSA 3T15A 1OJLA 4OW0A 3KSXA 3FKEA 2DWNA 2D7GA 3LVWA 4AG5A 3HJ8A 2XLJA 2FFJA 3BBAA 4DUYM 3LVVA 5JZEA 1J09A 3EIHA 4LCBA 2HL7A 1HQYE 2R62A 1I4WA 4DR7M 4LF4M 2J7QC 1IQPA 4HLQA 1HNZM 4FD2A 4IUMA 3DFZA 2L09A 2M60A 2OQ4A 3GLFB 4X64M 2KA6B 5EP4A 2OPFA 1NVMA 1L1TA 2DWLA 1G8PA 2EA0A 4BOUA 2UXDM 3KOZE 1L8QA 4L15A 1XMQM 3J81S 4AZFA 1K82A 4Z6YA 2Q2EB 3BOSA 4G4OA 3T1YM 3U60B 2G8LA 1E32A 3MK6A 1HNXM 1QAQA 2UUCM 2YFQA 2HKJA 4BBAA 4BOQA 3THGA 1DGFA 4DV3M 3RE8A 4KLNA 3L2AA 3TPZA 3SFZA 4QHSA 4FWGA 3D8LA 3HHZA 1EE8A 4RKXA 5KPTA 5KQDA 2DZOB 1DKIA 2R46A 3KOWE 2XZUA 4P16A 5EXPA 4AW4A 2RGHA 2RGOA 4I5SA 4LZZA 2CEAA 1ORYB 1IN5A 2C5RA 4DR3M 3FYCA 3U6MA 1WXQA 3M7GA 3RNVA 4KODA 5IWAM 2W82A 3GLFA 2DWMA 5KO3A 3O65A 5JI3E 2V1CA 5ITTA 3B9PA 1D2NA 4IBEA 1G59A 2BTWB 5A2QS 2DOSA 4GC9A 3GLIB 4LFBM 2XF3A 3U60A 4DV7M 4R7GA 3GQ3A 1FJGM 4JI3M 3SAVA 4GUAA 3MP2A 3KSJA 5EXXA 2D7EA 3U6DA 1NHGC 1QQWA 1HQCA 5ITQA 3SMPA 5IREB 4L8RC 3AOEA 4Z8XA 3ZNHA 3FUXA 4PDGA 2X8AA 4IIWA 1J5EM 2O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9S A;  4PT5 A;  4OVZ A;  5KO3 A;  4OW0 A;  4REZ A;  4RF0 A;  4WUR A;  5E6J A;  4M0W A;  4MM3 B;  4RNA A;  3MP2 A;  4RF1 A;  4OVZ B;  2FE8 A;  4P16 A;  3MJ5 A;  4R3D A; 
#chains in the Genus database with same CATH topology
 1U9Q X;  3NBX X;  2JTC A;  3HKP A;  1NL6 A;  1ICF A;  1GJT A;  5EXT A;  4YYU A;  4II7 A;  2XGN A;  2DKL A;  1MDW A;  3HHA A;  1F29 A;  2HH5 A;  1IBK M;  1YAL A;  4HXD B;  4MGH A;  2F5Q A;  2R9O A;  3W68 A;  3D6S A;  1XHB A;  5EP1 A;  5EP3 A;  3ILK A;  3LXS A;  4REZ A;  3UK6 A;  2BJV A;  4LF8 M;  4NOO B;  1ME3 A;  1ME4 A;  2YJC A;  2VQF M;  3IV2 A;  1TLO A;  3V76 A;  1N75 A;  2ZAM A;  3B7N A;  3PFI A;  2DCB A;  3I51 A;  4AKG A;  4M9S A;  1YK7 A;  2XSZ D;  3PHW A;  3SAS A;  5DYI A;  3GLI E;  4G4R A;  3MTV A;  3KS4 A;  1IXR C;  4LFC M;  1OKS A;  3OTO M;  3ZC7 B;  2DHR A;  3A45 A;  2DJG B;  4PAD A;  3KWB X;  3GLG A;  4G4N A;  1SXJ E;  1QVR A;  1CV8 A;  1DGG A;  2F5O A;  2LHC A;  1J7K A;  1NB3 A;  4IBI A;  4B08 A;  2RRU A;  4DBG B;  4LRT A;  5FTK A;  2ZTC A;  2MJ5 B;  1POP A;  3K9O A;  1NJF A;  1JB0 F;  5JA7 A;  4DR4 M;  3H8C A;  1PJI A;  3PNV A;  2E02 A;  2BDZ A;  2KNA A;  2JP7 A;  3U6E A;  2G5G X;  1K3X A;  1N34 M;  2DAG A;  3OF8 A;  4TUW A;  5PAD A;  2DAM A;  1TF0 B;  5FTM A;  2E00 A;  1BGO A;  3QT4 A;  3FTD A;  4XZX A;  2UXC M;  4MB7 A;  3I3T A;  4D81 A;  4X6H A;  2R9F A;  3VK7 A;  1IY1 A;  2P86 A;  4DV5 M;  3AL0 C;  1VQ1 A;  2QSF X;  1XB2 B;  1HJP A;  3PT2 A;  4LFA M;  1K3W A;  3VFD A;  4GMQ A;  5E26 A;  2D7H A;  2FUD A;  3HHX A;  2FT2 A;  1L2D A;  1CVZ A;  3MHS A;  4QH6 A;  4X66 M;  2CV1 A;  4LZJ A;  5FTJ A;  1HR0 M;  3GLH B;  1XXH B;  4S12 A;  4JI4 M;  2JWS A;  3RGP A;  3FTF A;  3F75 A;  1NQC A;  1V34 A;  4B3T M;  1QAN A;  1R2Y A;  3TMP A;  3EIE A;  4NXM M;  1IN6 A;  3GPX A;  4LGY A;  1WGN A;  1HNW M;  1EWO A;  1TH4 A;  3SBJ A;  1NPZ A;  3U61 B;  2LVP C;  2KEB A;  4NRV A;  3QYE A;  5ITR A;  1GCB A;  3FUU A;  3O0U A;  1XXH A;  4QRG A;  1YSY A;  1GAB A;  3SAT A;  5LMN M;  2E5L M;  5A24 A;  4IBF A;  3TWM A;  1Y8G A;  4YY3 M;  4DR6 M;  4RF0 A;  2F7D A;  2AGA A;  3PXG A;  4LY6 A;  1CSB B;  1ZIV A;  4IBB A;  1GL7 A;  3U61 A;  3DF0 A;  4PD2 A;  4N4Z A;  1N78 A;  2Y0T A;  3HX3 A;  1KHP A;  1KSF X;  2IBI A;  3TL4 X;  2B1M A;  2G6D A;  5IT9 S;  2H7J A;  4IJF A;  2ZM6 M;  3U6L A;  4CIZ A;  1CJL A;  4MI7 A;  4LF7 M;  4Q8H A;  1M6D A;  3P5V A;  1QDR A;  3AV0 A;  3K8Z A;  1Q3C A;  1PGY A;  4BQV A;  3M0E A;  1NNU C;  3JR5 A;  2KRU A;  3LFY A;  3S3Q A;  1THE A;  1NNJ A;  3HJQ A;  4FIP A;  3V6C A;  3QSD A;  1CQD A;  2VF8 A;  4JI2 M;  3K9P A;  1GL6 A;  3LQQ A;  3C58 A;  2OOA A;  2K47 A;  4AKH A;  1N32 M;  5KQ8 A;  3BY4 A;  1NV8 A;  3H7D A;  2JY5 A;  2KNV A;  3KS8 A;  4M0W A;  1V92 A;  2BTW A;  4CDC B;  2BU3 A;  2FO5 A;  3HHW A;  2DI0 A;  1FH0 A;  2UUB M;  2JQF R;  3SYL A;  2ERC A;  3I04 M;  3SAU A;  1SP4 B;  3RGS A;  2DZN B;  4IBG A;  1XNQ M;  2CE7 A;  1WGL A;  3QWL A;  4JI0 M;  4DV0 M;  1HT1 E;  4CZW A;  2XSZ A;  2AYN A;  2UZJ A;  4OU7 A;  1WHC A;  1OJL A;  4OW0 A;  2D7G A;  3ERV A;  4F1I A;  3LVV A;  2YJB A;  4LCB A;  4LF4 M;  3K9M A;  4IUM A;  3DFZ A;  3H8B A;  5EP4 A;  2B3T A;  4WA6 A;  2DWL A;  4DMY A;  2UXD M;  3U60 B;  2G8L A;  1E32 A;  2DCD A;  2YFQ A;  1QUT A;  1IXS A;  1PIP A;  2HXZ A;  3D8L A;  2MGW A;  2DNA A;  2DZO B;  3KOW E;  1HUC B;  3CGW A;  2CEA A;  2WZJ A;  1ORY B;  3RNV A;  4KOD A;  5IWA M;  2DC6 A;  5KO3 A;  2V1C A;  2WSC F;  4IBE A;  5A2Q S;  3U60 A;  2DCC A;  3SAV A;  3MP2 A;  3MMP A;  1OQY A;  2JUJ A;  1HQC A;  5ITQ A;  1D0M A;  3FUX A;  3QJ3 A;  3PW3 A;  2X8A A;  3H4M A;  4LJ8 A;  4YYS A;  1YT7 A;  1PVJ A;  4I4L A;  2XZF A;  3O1G A;  4LF9 M;  4DV2 M;  1C1K A;  1HT2 E;  3KP1 E;  2R6F A;  1GLN A;  1PPD A;  2LVN C;  3HGI A;  1XNR M;  1OIP A;  3SC3 A;  1RU3 A;  4LG2 A;  4ZTB A;  4NXN M;  1TTE A;  4P6G A;  2CHV A;  1AU3 A;  4IP3 A;  4I8O A;  4A3V B;  2HWJ A;  3TE6 A;  5DNY A;  1DGB A;  3I4V A;  3FTC A;  5FLX S;  2YNM D;  1SXJ D;  3B79 A;  2EKF A;  4KO8 A;  5FTN A;  1GKI A;  3A46 A;  5ITU A;  1YVB A;  4GIT A;  2CHQ A;  4CGY B;  4X62 M;  3VDP A;  5CHV A;  4B3S M;  4CDD B;  4FCW A;  4A5U A;  3F5V A;  1R2Z A;  3AOG A;  1NV9 A;  2I7P A;  1DO0 A;  4FWD A;  4LJ9 A;  3P5W A;  5KPR A;  1CS8 A;  1N36 M;  1Z59 A;  3TWL A;  4D8E A;  5FTL A;  4QNR A;  3C9E A;  1BP4 A;  1CPJ A;  4QNM A;  3KX1 A;  1WJ7 A;  8CAT A;  3J27 B;  1FNN A;  1PJT A;  1DO2 A;  2AHM A;  4JI5 M;  1I94 M;  3AFH A;  4M9X A;  1L2C A;  5EZQ A;  3PBH A;  4R71 A;  1ZQ9 A;  3HZJ A;  1UKF A;  2AUX A;  2HWK A;  2BNK A;  1PPO A;  5IZ7 D;  3P5U A;  2WBF X;  4L78 A;  2XFT A;  2R4E A;  5EZS A;  3KOY E;  3N4C A;  2L7I A;  2UXB M;  1P3Q Q;  5J94 A;  4FCT A;  3MJ5 A;  1IY2 A;  4CIS A;  3HJS A;  2JXN A;  2XH9 A;  2C0Y A;  1SXJ C;  1GEC E;  3CBK A;  3WXF A;  3KWZ A;  2ZBK B;  3U6O A;  1AEC A;  9PAP A;  5CVN B;  1MEM A;  3SAR A;  2LXE A;  4BOS A;  3KVW A;  3SMS A;  1TR8 A;  2DXI A;  1PPP A;  1PM5 A;  3B21 A;  1KFV A;  3FUV A;  5JI2 E;  3USV A;  4XK8 F;  3HHI A;  1AUA A;  3FRI A;  2F5N A;  3GPY A;  4DUZ M;  4D8I A;  3GLG B;  2F5P A;  2FOI C;  1OIZ A;  3C3D A;  4M0D A;  3I4Y A;  1R7R A;  2PRE A;  4NC6 A;  4K7C A;  1OAI A;  1OFH A;  2CV0 A;  2PAD A;  2QHO B;  1PJJ A;  3WHK A;  1MJG M;  2ZAN A;  2L2D A;  5ITX A;  4XBO A;  1GJS A;  3DOA A;  4G4Q A;  3IFU A;  3N3K A;  1EWM A;  5ITY A;  3V6E A;  2CUZ A;  3PNR A;  3A42 A;  1IN4 A;  2VII A;  3U6C A;  1NY6 A;  4L4U A;  4BS6 A;  1ATK A;  3IMA A;  2WSE F;  1D0K A;  1LTM A;  4MGZ E;  4MGI E;  2V1U A;  4MGY E;  1Q39 A;  3L25 A;  3P5X A;  2LWX A;  3UGJ A;  3L29 A;  2O25 A;  3GLH E;  1XXH E;  3L27 A;  1L2B A;  1H6U A;  4JI7 M;  2KXE A;  4DR5 M;  2WSF F;  2KDL A;  4FK5 A;  5EGW A;  1F2A A;  1OFI A;  3KW6 A;  1NB5 A;  3BBZ A;  3PDF A;  2Y5B A;  3BCN A;  3CF6 E;  1Q3B A;  3U8E A;  2H5X A;  2YJ9 A;  1K3B B;  3C3E A;  1JR3 A;  5FPW A;  2VHF A;  2QZ4 A;  2IPP B;  1YLA A;  4CHT B;  1X9Y A;  2JNH A;  3OIS A;  3QYB A;  2FRA A;  4B7H A;  4M9Z A;  2R9M A;  3CTW B;  1JQJ C;  1G4A E;  3U5Z B;  4RY2 A;  3TNX A;  2CHG A;  2OZ2 A;  3K92 A;  4DV4 M;  3GRY A;  2R44 A;  3HD3 A;  4DV1 M;  1DEU A;  4GC5 A;  1KFU L;  3VLF B;  4AI6 A;  2JY8 A;  2LNH C;  1S4V A;  1GVN A;  3HHY A;  1GLO A;  4GKJ M;  4R3D A;  4K0K M;  4Q8G A;  4JYA M;  3GRR A;  2C96 A;  3R8F A;  2BDL A;  3U5Z A;  3T15 A;  2CRU A;  3FKE A;  3KSX A;  2DWN A;  2G8J A;  8PCH A;  3EIH A;  1T43 A;  2DAK A;  2J7Q C;  2R62 A;  1I4W A;  1IQP A;  3OF9 A;  4FD2 A;  1EIJ A;  2OQ4 A;  3GLF B;  3BPM A;  2KA6 B;  2OPF A;  1L1T A;  5L8R F;  4BOU A;  3T6P A;  4Z6Y A;  1PBH A;  3BOS A;  3MK6 A;  3B7Q A;  4BOQ A;  3THG A;  4DV3 M;  3TPZ A;  3HWN A;  2Y6E A;  1EE8 A;  4RKX A;  5KQD A;  2XZU A;  1U9X A;  5EXP A;  1ITO A;  2C5R A;  3OVZ A;  2O6X A;  3GLF A;  2DWM A;  5ITT A;  3B9P A;  1D2N A;  2BTW B;  2DOS A;  4GC9 A;  4DV7 M;  4XR7 A;  4JI3 M;  3KSJ A;  1PE6 A;  3SMP A;  5IRE B;  4L8R C;  4Z8X A;  1J5E M;  1VEJ A;  1D0L A;  2L6O A;  2KRK A;  2YR0 A;  3OVX A;  3LCV B;  1GMY A;  2DHY A;  1KYI A;  1Z6T A;  1EF7 A;  2F4V M;  3J7A S;  4LF5 M;  2VDB B;  4ZUX U;  3J2P B;  3BOW A;  2Y21 A;  1R6B X;  1Y08 A;  4RF1 A;  4MSX A;  3LCU A;  2QPA A;  1QXP A;  2XU1 A;  1XMO M;  2DZZ A;  2XFS A;  2R65 A;  1MS6 A;  4HL4 A;  2QNJ A;  4G54 A;  1ZMV A;  3W0F A;  3GPP A;  3J7B A;  2K9D A;  4FW9 A;  1IBL M;  3C0R A;  4I07 A;  4WP2 A;  1A6R A;  3GRU A;  1UFZ A;  2HCB A;  4HEO A;  3DA1 A;  1IXS B;  2R4J A;  2XU3 A;  3SHG B;  2X4A A;  2BJW A;  1G3I A;  4F2L A;  3KFQ A;  3ZH9 B;  3RVX A;  2KNZ A;  4B3R M;  4BPV A;  5BPV A;  2QBY B;  3KW9 A;  1N77 A;  2C98 A;  2GHU A;  3CBJ A;  1XC8 A;  1OTR A;  4NRW A;  1IWD A;  2X49 A;  4LRS A;  1VDL A;  1AU4 A;  3LQR A;  2QCU A;  2CB5 A;  3PNY A;  2F5S A;  4XGI A;  1DF0 A;  1F4I A;  2JY7 A;  3GQ5 A;  4AQY M;  3H6S A;  2OP3 A;  1KXR A;  2GFO A;  2HAK A;  4YV8 A;  3N3G A;  2M5Z A;  1VDD A;  2GQF A;  2QBY A;  1T6O A;  3ZCB B;  2VHS A;  1G41 A;  4W5B A;  4YYQ A;  2PNS A;  3VDU A;  3GO8 A;  3M6A A;  4X6I A;  3HY5 A;  1EWL A;  4BSQ A;  3SYK A;  4WW0 A;  2R18 A;  1ZV1 A;  2L4E A;  2Z4R A;  1DGH B;  1QUS A;  3D8B A;  1WR1 B;  1QAM A;  2Z4S A;  2Z8Y M;  4W5C A;  4GEW A;  3RFW A;  1MN3 A;  3UZU A;  1DV0 A;  1F2C A;  4GIP A;  4GHL A;  2Z3X A;  6PAD A;  1PRB A;  3BPF A;  1EWP A;  3VKG A;  3KXE C;  1NJG A;  5CHT A;  5DYG A;  4AG6 A;  3U6Q A;  2C99 A;  1R4G A;  4LF6 M;  1NLJ A;  2YQZ A;  2J5Y A;  3E46 A;  1PCI A;  1Q6K A;  1DGH A;  1OAO C;  2AYO A;  1QYR A;  2QP9 X;  3R9X B;  2UUA M;  2DWZ B;  3W67 A;  3CF2 A;  2ZTD A;  4GHA A;  2VQE M;  1QMY A;  2G8E A;  1C7Y A;  4OX9 M;  4MZO A;  4JN6 A;  4LJ6 A;  1E9R A;  1E94 E;  4PP1 A;  3Q8X A;  3KDS E;  5EF4 A;  4P6E A;  1CUK A;  3U6S A;  4X65 M;  3FUW A;  4L16 A;  3IG8 A;  4PCZ A;  2HHH M;  2HD5 A;  4JXJ A;  5FSW A;  5EP2 A;  2JZ0 A;  4QOZ C;  2R9N A;  1X37 A;  4XUI A;  3QAU A;  3AI8 A;  5LMU M;  3C9P A;  3AOE C;  2ACT A;  1IFY A;  4RNA A;  1ZAE A;  3FUT A;  4G6Z A;  4AXL A;  1IM2 A;  1AYU A;  4RKU F;  5F02 A;  5ITX E;  3KOX E;  2RKO A;  4Y28 F;  1A5T A;  5GKN A;  5C18 A;  3GLG E;  2EJS A;  4I04 A;  2JQG R;  2DAI A;  2MR9 A;  1QDQ A;  2H1R A;  2G7Y A;  5JH3 A;  3S3R A;  1U9V A;  4FWH A;  3MOR A;  1VJV A;  2N35 A;  1GO5 A;  2FNA A;  2OO9 A;  4BB9 A;  1T3T A;  1W5S A;  4UN2 B;  3CH3 X;  3GRV A;  4CDF B;  2E01 A;  4IJE A;  1F2B A;  4GKK M;  4YVA A;  2DC9 A;  4NSR A;  4FVM A;  1N33 M;  2QEN A;  2YJ8 A;  4ZPX A;  4B7F A;  4B7G A;  1TH2 A;  2Z7J A;  5BR8 M;  2FE8 A;  1NY5 A;  4JI1 M;  3VK8 A;  2KW0 A;  2NQG A;  3AJI B;  3RVV A;  2C9O A;  1O0E A;  3IEJ A;  2LVQ D;  1W5T A;  2EUC A;  4OEM A;  2B1N A;  3JR4 A;  1IN7 A;  1JR3 E;  2R0I A;  1BY8 A;  1NHW C;  4CJ6 A;  2AU1 A;  1QZM A;  4DV6 M;  1TH3 A;  4MGK E;  3GPU A;  3HU2 A;  3LVW A;  2FFJ A;  4DUY M;  3LW5 F;  2YJ2 A;  1J09 A;  2GNO A;  1HQY E;  4DR7 M;  2L09 A;  4X64 M;  2XU4 A;  1NVM A;  1G8P A;  4L15 A;  1L8Q A;  1XMQ M;  2APL A;  3J81 S;  3T1Y M;  1WIV A;  5K16 A;  4X6J A;  1HNX M;  4YYV A;  2CP8 A;  1CB5 A;  4KLN A;  3L2A A;  3HHZ A;  4HWY A;  2L4F A;  1DKI A;  2R46 A;  2LVO C;  4N8W A;  2RGO A;  4LZZ A;  2JZ1 A;  4DR3 M;  3U6M A;  3M7G A;  1AU2 A;  3O65 A;  1MEG A;  5JI3 E;  1XKG A;  3GLI B;  2XF3 A;  2DC7 A;  1CTE A;  3GQ3 A;  1FJG M;  4PI3 A;  4AXM A;  2D7E A;  3U6D A;  3AOE A;  2DCA A;  1PAD A;  4PDG A;  4IIW A;  1SXJ B;  1Z5B A;  2DAE A;  5KPZ A;  2JRI A;  2O01 F;  2QQ8 A;  4BOP A;  2AVW A;  4MH0 E;  1LV7 A;  2KHH A;  1AYW A;  2KZS A;  4LGM A;  3IG5 A;  4BLC A;  2P5T A;  1EFU B;  3IHP A;  3L28 A;  4IBD A;  4CDE B;  3GLI A;  1VEK A;  2CFO A;  3GLF E;  4JV5 M;  4W5W A;  3U6P A;  2HHN A;  4KLB A;  2EKK A;  3SAW A;  4IBK A;  1SXJ A;  1TDH A;  2CIO A;  2K0B X;  4BS5 A;  3L26 A;  3GQ4 A;  1UM8 A;  1MIR A;  1PPN A;  3LMM A;  3WXG A;  2Y0Q A;  4LJ7 A;  4LJ5 A;  3TWK A;  3E1Z B;  3NBI A;  3K1J A;  4GRI A;  3GLH A;  2K6B A;  3AKZ A;  3HU1 A;  1TL9 A;  1AU0 A;  2LHG A;  3TQS A;  1MU5 A;  1G71 A;  2FRQ A;  1E9S A;  3SHF A;  1YE9 A;  2DJF B;  1NSF A;  2LH0 A;  1MX0 A;  4OVZ B;  4PP2 E;  3FE3 A;  2NQI A;  3BB7 A;  2MRO B;  1AIM A;  3PSE A;  2J7N A;  3E9S A;  1JQP A;  3FRH A;  4IBC A;  3PRP A;  2ZAO A;  3E21 A;  3T1H M;  4DR1 M;  3DZD A;  2VF7 A;  2G3Q A;  4KHP M;  4D82 A;  3GCB A;  5EQT A;  3A98 B;  4OVZ A;  4PDI A;  4YYW A;  2DVW B;  2JY6 B;  4OEL A;  3K2L A;  5F3W A;  3T38 A;  2XEP A;  4ANR A;  1YK8 A;  3KP0 E;  2OOB A;  3J80 S;  2P7U A;  4BOZ A;  3ZQJ A;  3H4J A;  2ATO A;  3NWL A;  2MH8 A;  2DZY A;  4JI6 M;  2EO2 A;  4FJC A;  1Z5A A;  4I05 A;  4QHT A;  3NHE A;  4Q7J A;  4ITQ A;  3WHL A;  3BXW A;  2CV2 A;  3FTE A;  2AIM A;  5EXS A;  3ZUA A;  4G3O A;  2A5Y B;  3E4R A;  1BQI A;  1KFX L;  5DFL A;  1L1Z A;  3TRK A;  5H37 D;  4MZS A;  2NQ8 C;  2C9C A;  1PJQ A;  2LTU A;  1VEG A;  4IBJ A;  1KHQ A;  2OUL A;  1Q02 A;  3I01 M;  4GH9 A;  4W4U A;  3CF0 A;  1QZE A;  1U9W A;  3RVW A;  3HWS A;  1TGU A;  2DEN A;  2Y20 A;  3W0L B;  2R6N A;  2L7H A;  4DMX A;  1ZMU A;  2V6Z M;  5E6J A;  4FCV A;  5CVO B;  2KZU A;  1SNK A;  4QRV A;  1VG5 A;  2FTD A;  2NQA A;  1STF E;  1S3S A;  5C1B A;  3Q8G A;  2FS1 A;  3BC3 A;  2DC8 A;  3W30 A;  3PVS A;  2JA2 A;  3UJN A;  1TDZ A;  1VSN A;  3B7Z A;  4AKI A;  4QBB A;  3HU3 A;  1YZB A;  2FH0 A;  2J7O A;  2J7Q A;  1QAO A;  4EIW A;  1IY0 A;  3OQC A;  3PHX A;  1BVS A;  2XU5 A;  2P0R A;  1SG9 A;  3IUT A;  7PCK A;  3F92 A;  4NL4 H;  2F1G A;  4WUR A;  2BWB A;  3UMM A;  1AYV A;  3PRM A;  5EJC A;  4I81 A;  2BWE A;  4LJA A;  3IEC A;  3FD9 A;  3PHU A;  2I7N A;  4PT5 A;  7CAT A;  3KKU A;  4D80 A;  4LJ4 A;  2DZL A;  3KFU G;  3B74 A;  3VKH A;  1JR3 D;  1IXZ A;  3MHV C;  4YYR A;  1IN8 A;  2AUZ A;  1TU6 A;  4YHH M;  1R5L A;  3GP1 A;  4QRX A;  4JI8 M;  3M99 A;  4DR2 M;  4D8B A;  3W31 A;  3JAM S;  1QDT A;  1V33 A;  4L6V 6;  2R45 A;  2Z84 A;  3BWK A;  4MM3 B;  3I06 A;  4NSO B;  1YUB A;  1IBM M;  2UU9 M;  1XWI A;  3B89 A;  1Z5C A;  4B3M M;  3WXE A;  2ARY A;  1U5I A;  2LBC A;  3FYD A;  1QOL A;  4QOS A;  5CVM A;  3BBA A;  4AG5 A;  3HJ8 A;  2XLJ A;  3CH2 X;  1PXV A;  3KSE A;  5JZE A;  1AIP C;  2HL7 A;  4HLQ A;  1HNZ M;  2M60 A;  2AS8 A;  2EA0 A;  3KOZ E;  4AZF A;  1K82 A;  2Q2E B;  4G4O A;  1ZCM A;  3IOQ A;  1QAQ A;  2UUC M;  2E03 A;  2CWB A;  2HKJ A;  4BBA A;  1DGF A;  4N79 A;  3RE8 A;  3SFZ A;  4QHS A;  4FWG A;  2FYE A;  5KPT A;  1ZMW A;  4P16 A;  4AW4 A;  1Y4H A;  2RGH A;  2LVA A;  4I5S A;  1MHW A;  1IN5 A;  3FYC A;  3MTN A;  1PJS A;  1WXQ A;  2W82 A;  4KT0 F;  3MHH A;  1G59 A;  2R9C A;  1NO1 A;  4LFB M;  4P17 A;  4R7G A;  4GUA A;  3K8U A;  3K24 A;  5EXX A;  1NHG C;  1QQW A;  2FQ9 A;  2PBH A;  3ZNH A;  3H89 A;  2NQD B;  2O5R A; 
#chains in the Genus database with same CATH homology
 1SXJ B;  1Z5B A;  2L6O A;  2KRK A;  2YR0 A;  5KPZ A;  2JRI A;  2JTC A;  3HKP A;  3H4M A;  4LJ8 A;  4BOP A;  4MH0 E;  5EXT A;  1LV7 A;  1KYI A;  2KZS A;  1PVJ A;  4I4L A;  1Z6T A;  2XZF A;  2F4V M;  4II7 A;  3J7A S;  4LF9 M;  4LGM A;  4LF5 M;  4DV2 M;  3J2P B;  3IG5 A;  4BLC A;  2XGN A;  1C1K A;  1HT2 E;  2P5T A;  3KP1 E;  2Y21 A;  3L28 A;  1R6B X;  4IBD A;  4RF1 A;  3GLI A;  1GLN A;  2CFO A;  4JV5 M;  1IBK M;  2QPA A;  4W5W A;  3HGI A;  4HXD B;  4MGH A;  1XNR M;  3U6P A;  1XMO M;  3SC3 A;  2F5Q A;  4LG2 A;  2XFS A;  2R65 A;  4ZTB A;  4NXN M;  1XHB A;  5EP1 A;  2CHV A;  5EP3 A;  4HL4 A;  3ILK A;  4IP3 A;  4I8O A;  4A3V B;  4REZ A;  3SAW A;  4IBK A;  3UK6 A;  1SXJ A;  2BJV A;  1TDH A;  3TE6 A;  4LF8 M;  5DNY A;  3W0F A;  1DGB A;  3I4V A;  3FTC A;  5FLX S;  2YNM D;  3GPP A;  1SXJ D;  4NOO B;  4KO8 A;  5FTN A;  3J7B A;  2VQF M;  1GKI A;  3A46 A;  3L26 A;  5ITU A;  4FW9 A;  1IBL M;  3GQ4 A;  3C0R A;  4GIT A;  1N75 A;  2CHQ A;  2ZAM A;  1UM8 A;  4CGY B;  3VDP A;  4X62 M;  3PFI A;  4B3S M;  4FCW A;  4A5U A;  3GRU A;  3I51 A;  4AKG A;  1R2Z A;  3AOG A;  2I7P A;  2HCB A;  3LMM A;  4M9S A;  1DO0 A;  3DA1 A;  1IXS B;  2XSZ D;  2R4J A;  2Y0Q A;  3PHW A;  4FWD A;  3SHG B;  4LJ9 A;  4LJ7 A;  2X4A A;  5DYI A;  3SAS A;  2BJW A;  1G3I A;  4G4R A;  4LJ5 A;  3KS4 A;  1IXR C;  3TWK A;  5KPR A;  4LFC M;  3ZH9 B;  3MTV A;  3NBI A;  3K1J A;  1N36 M;  3OTO M;  3ZC7 B;  1Z59 A;  3TWL A;  4B3R M;  4D8E A;  2DHR A;  3A45 A;  4GRI A;  3GLH A;  5BPV A;  5FTL A;  2QBY B;  3GLG A;  1N77 A;  3AKZ A;  4QNR A;  3HU1 A;  4G4N A;  2C98 A;  4QNM A;  1XC8 A;  4NRW A;  1SXJ E;  8CAT A;  1QVR A;  1DGG A;  2X49 A;  2F5O A;  3J27 B;  1FNN A;  4LRS A;  3TQS A;  1J7K A;  1MU5 A;  4IBI A;  1DO2 A;  3LQR A;  2QCU A;  1E9S A;  2AHM A;  1YE9 A;  3SHF A;  4B08 A;  4JI5 M;  3PNY A;  2F5S A;  1I94 M;  3AFH A;  4XGI A;  4LRT A;  5FTK A;  4M9X A;  4AQY M;  3GQ5 A;  1L2C A;  1NSF A;  2LH0 A;  1MX0 A;  1NJF A;  4OVZ B;  5EZQ A;  3BB7 A;  4DR4 M;  1UKF A;  1ZQ9 A;  3PSE A;  2M5Z A;  1PJI A;  2J7N A;  3PNV A;  3E9S A;  2HWK A;  1VDD A;  2BNK A;  3U6E A;  5IZ7 D;  2G5G X;  2QBY A;  3ZCB B;  1K3X A;  1N34 M;  4IBC A;  4TUW A;  4L78 A;  3PRP A;  1G41 A;  2XFT A;  2R4E A;  2ZAO A;  3T1H M;  4DR1 M;  5EZS A;  3KOY E;  3DZD A;  3VDU A;  3GO8 A;  2L7I A;  5FTM A;  3M6A A;  4KHP M;  4D82 A;  3SYK A;  4WW0 A;  2UXB M;  4FCT A;  3MJ5 A;  1IY2 A;  2R18 A;  4CIS A;  3FTD A;  4XZX A;  2Z4R A;  5EQT A;  3HJS A;  1DGH B;  2UXC M;  2XH9 A;  3A98 B;  3D8B A;  1QAM A;  1SXJ C;  2Z4S A;  4OVZ A;  4PDI A;  4MB7 A;  2DVW B;  4D81 A;  3RFW A;  3UZU A;  3K2L A;  5F3W A;  2ZBK B;  3U6O A;  3T38 A;  3VK7 A;  2XEP A;  4GIP A;  4GHL A;  1IY1 A;  2Z3X A;  4DV5 M;  3SAR A;  3AL0 C;  3KP0 E;  2LXE A;  3J80 S;  4BOS A;  3KVW A;  3SMS A;  2DXI A;  3PT2 A;  3VKG A;  4LFA M;  3KXE C;  1PM5 A;  3VFD A;  1NJG A;  1K3W A;  3B21 A;  1KFV A;  4GMQ A;  5E26 A;  2D7H A;  3FUV A;  3HHX A;  5DYG A;  5JI2 E;  1L2D A;  4BOZ A;  4AG6 A;  3U6Q A;  3NWL A;  2C99 A;  4LF6 M;  4X66 M;  2YQZ A;  4JI6 M;  2EO2 A;  2CV1 A;  1DGH A;  2F5N A;  4LZJ A;  1Z5A A;  5FTJ A;  3GPY A;  1HR0 M;  4DUZ M;  4D8I A;  4QHT A;  3GLH B;  1QYR A;  1XXH B;  3GLG B;  2QP9 X;  4S12 A;  2F5P A;  4JI4 M;  3R9X B;  2UUA M;  3RGP A;  2FOI C;  2DWZ B;  3FTF A;  4ITQ A;  3WHL A;  3CF2 A;  2CV2 A;  3FTE A;  4M0D A;  5EXS A;  3I4Y A;  2A5Y B;  4B3T M;  1QAN A;  1R2Y A;  3E4R A;  2VQE M;  4GHA A;  3TMP A;  4OX9 M;  1R7R A;  3EIE A;  4NXM M;  4JN6 A;  1IN6 A;  3GPX A;  4LGY A;  2CV0 A;  1OFH A;  1L1Z A;  4LJ6 A;  3TRK A;  1E9R A;  5H37 D;  1E94 E;  1HNW M;  1PJJ A;  3WHK A;  3Q8X A;  1TH4 A;  3KDS E;  3SBJ A;  2ZAN A;  3U61 B;  2NQ8 C;  2KEB A;  2C9C A;  5ITX A;  4IBJ A;  4XBO A;  4NRV A;  3U6S A;  4X65 M;  5ITR A;  3DOA A;  3FUW A;  3FUU A;  4GH9 A;  4L16 A;  4G4Q A;  3IG8 A;  1XXH A;  4PCZ A;  2HHH M;  3IFU A;  1YSY A;  4JXJ A;  5ITY A;  3CF0 A;  5FSW A;  3SAT A;  2CUZ A;  5EP2 A;  3A42 A;  5LMN M;  4QOZ C;  1IN4 A;  2E5L M;  3HWS A;  4IBF A;  1TGU A;  1X37 A;  2VII A;  3U6C A;  3TWM A;  1NY6 A;  4YY3 M;  4DR6 M;  3QAU A;  4RF0 A;  2Y20 A;  4L4U A;  3W0L B;  2L7H A;  2AGA A;  3PXG A;  4LY6 A;  5LMU M;  2V6Z M;  4IBB A;  5E6J A;  4MGZ E;  4MGI E;  3AOE C;  4FCV A;  2V1U A;  4MGY E;  2KZU A;  1GL7 A;  4RNA A;  3U61 A;  1ZAE A;  1Q39 A;  3FUT A;  4G6Z A;  4PD2 A;  1IM2 A;  3L25 A;  1S3S A;  1N78 A;  2Y0T A;  2LWX A;  1KSF X;  3UGJ A;  5C1B A;  5ITX E;  3L29 A;  3TL4 X;  3KOX E;  2RKO A;  3W30 A;  3PVS A;  5IT9 S;  4IJF A;  2JA2 A;  5GKN A;  3UJN A;  1TDZ A;  5C18 A;  2ZM6 M;  3U6L A;  3L27 A;  1L2B A;  1H6U A;  4AKI A;  3HU3 A;  4JI7 M;  1YZB A;  2KXE A;  2J7O A;  2H1R A;  2J7Q A;  1QAO A;  4DR5 M;  4EIW A;  4MI7 A;  4LF7 M;  1IY0 A;  3OQC A;  3PHX A;  3AV0 A;  3K8Z A;  1Q3C A;  4NL4 H;  1OFI A;  4FWH A;  3KW6 A;  3M0E A;  4WUR A;  1NNU C;  3JR5 A;  2KRU A;  3UMM A;  2FNA A;  3CF6 E;  1NNJ A;  1Q3B A;  4BB9 A;  1T3T A;  3HJQ A;  5EJC A;  3PRM A;  1W5S A;  4I81 A;  4LJA A;  4JI2 M;  3FD9 A;  3PHU A;  1GL6 A;  3LQQ A;  3C58 A;  2I7N A;  1JR3 A;  3GRV A;  2K47 A;  4PT5 A;  7CAT A;  4IJE A;  4D80 A;  1N32 M;  4LJ4 A;  4AKH A;  5KQ8 A;  4GKK M;  3BY4 A;  3KFU G;  3VKH A;  1JR3 D;  1IXZ A;  4NSR A;  3MHV C;  1IN8 A;  4FVM A;  2QZ4 A;  4CHT B;  1N33 M;  3KS8 A;  4M0W A;  2QEN A;  2BTW A;  4B7H A;  4M9Z A;  4ZPX A;  4B7F A;  4B7G A;  4YHH M;  2BU3 A;  3CTW B;  3HHW A;  1TH2 A;  2Z7J A;  1JQJ C;  5BR8 M;  2FE8 A;  1G4A E;  3U5Z B;  1NY5 A;  2CHG A;  4JI1 M;  3VK8 A;  3GP1 A;  2KW0 A;  2UUB M;  3K92 A;  3AJI B;  4JI8 M;  4DV4 M;  4DR2 M;  4D8B A;  3SYL A;  3GRY A;  3W31 A;  3JAM S;  2C9O A;  2ERC A;  3SAU A;  1W5T A;  4DV1 M;  2EUC A;  3RGS A;  2DZN B;  4IBG A;  1XNQ M;  2R45 A;  4GC5 A;  2Z84 A;  2CE7 A;  3VLF B;  3JR4 A;  4AI6 A;  4MM3 B;  3QWL A;  2LNH C;  1IN7 A;  4JI0 M;  4DV0 M;  1GVN A;  4NSO B;  1NHW C;  1YUB A;  1IBM M;  2UU9 M;  3HHY A;  1XWI A;  4R3D A;  1Z5C A;  4GKJ M;  4K0K M;  1QZM A;  1HT1 E;  2XSZ A;  4B3M M;  2UZJ A;  4OU7 A;  4JYA M;  4DV6 M;  3GRR A;  1TH3 A;  2C96 A;  3R8F A;  3FYD A;  4MGK E;  3GPU A;  3U5Z A;  3HU2 A;  4QOS A;  3T15 A;  1OJL A;  4OW0 A;  3KSX A;  3FKE A;  2DWN A;  2D7G A;  3LVW A;  4AG5 A;  3HJ8 A;  2XLJ A;  2FFJ A;  3BBA A;  4DUY M;  3LVV A;  5JZE A;  1J09 A;  3EIH A;  4LCB A;  2HL7 A;  1HQY E;  2R62 A;  1I4W A;  4DR7 M;  4LF4 M;  2J7Q C;  1IQP A;  4HLQ A;  1HNZ M;  4FD2 A;  4IUM A;  3DFZ A;  2L09 A;  2M60 A;  2OQ4 A;  3GLF B;  4X64 M;  2KA6 B;  5EP4 A;  2OPF A;  1NVM A;  1L1T A;  2DWL A;  1G8P A;  2EA0 A;  4BOU A;  2UXD M;  3KOZ E;  1L8Q A;  4L15 A;  1XMQ M;  3J81 S;  4AZF A;  1K82 A;  4Z6Y A;  2Q2E B;  3BOS A;  4G4O A;  3T1Y M;  3U60 B;  2G8L A;  1E32 A;  3MK6 A;  1HNX M;  1QAQ A;  2UUC M;  2YFQ A;  2HKJ A;  4BBA A;  4BOQ A;  3THG A;  1DGF A;  4DV3 M;  3RE8 A;  4KLN A;  3L2A A;  3TPZ A;  3SFZ A;  4QHS A;  4FWG A;  3D8L A;  3HHZ A;  1EE8 A;  4RKX A;  5KPT A;  5KQD A;  2DZO B;  1DKI A;  2R46 A;  3KOW E;  2XZU A;  4P16 A;  5EXP A;  4AW4 A;  2RGH A;  2RGO A;  4I5S A;  4LZZ A;  2CEA A;  1ORY B;  1IN5 A;  2C5R A;  4DR3 M;  3FYC A;  3U6M A;  1WXQ A;  3M7G A;  3RNV A;  4KOD A;  5IWA M;  2W82 A;  3GLF A;  2DWM A;  5KO3 A;  3O65 A;  5JI3 E;  2V1C A;  5ITT A;  3B9P A;  1D2N A;  4IBE A;  1G59 A;  2BTW B;  5A2Q S;  2DOS A;  4GC9 A;  3GLI B;  4LFB M;  2XF3 A;  3U60 A;  4DV7 M;  4R7G A;  3GQ3 A;  1FJG M;  4JI3 M;  3SAV A;  4GUA A;  3MP2 A;  3KSJ A;  5EXX A;  2D7E A;  3U6D A;  1NHG C;  1QQW A;  1HQC A;  5ITQ A;  3SMP A;  5IRE B;  4L8R C;  3AOE A;  4Z8X A;  3ZNH A;  3FUX A;  4PDG A;  2X8A A;  4IIW A;  1J5E M;  2O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...