1ATKA

Crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor e-64
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Crystal structure of human osteoclast cathepsin K complex with E-64.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1996-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1atkA00
3AI8A 3F75A 4BS6A 2XU3A 3DF0A 3OVXA 1MHWA 2DZYA 1QDQA 2DC7A 1PXVA 5F02A 1CSBB 1Y08A 1FH0A 2YJCA 4DMXA 4YYSA 2H7JA 2YJ2A 1VSNA 2DC8A 1DF0A 2B1MA 3H7DA 3CBKA 2PBHA 7PCKA 1YVBA 1CVZA 1ZCMA 3K24A 2BDLA 4BQVA 1PBHA 3BPMA 4K7CA 4YV8A 4MZSA 3B79A 3P5XA 3OISA 3H6SA 3HWNA 1ME3A 4N8WA 2VHSA 4AXLA 1GCBA 1VJVA 1NL6A 1U5IA 1F2CA 3OVZA 1ITOA 3M99A 4KLBA 4W5BA 2DCBA 1EWOA 3ERVA 3QT4A 2E00A 4XUIA 1QOLA 5K16A 3E1ZB 3HHIA 1ME4A 4QBBA 2R9CA 1F2BA 2G6DA 4P6EA 2CB5A 4XR7A 4PP1A 3TNXA 1CQDA 3P5VA 1K3BB 3MHSA 2CIOA 4OELA 3U8EA 2C0YA 2XU5A 4FK5A 3KWBX 3MHHA 1AU3A 2PNSA 9PAPA 4CDFB 1CJLA 2FYEA 4BS5A 1QXPA 1JQPA 4P6GA 1MEGA 1KHPA 3N3KA 2AYNA 2AYOA 4YYQA 2HD5A 3K9MA 2F1GA 3O1GA 1CPJA 1YK8A 1KFXL 3IEJA 4N79A 1AYWA 2P86A 3USVA 1PPDA 3PW3A 1STFE 2DJFB 1AIMA 1F29A 3WXEA 3OF8A 1AYVA 2G8JA 3H8BA 2AIMA 2FQ9A 4BSQA 2DJGB 4X6IA 2JQGR 2FUDA 5PADA 1PIPA 5CVOB 4PP2E 1SNKA 2AUZA 1X9YA 2IBIA 1MS6A 4FIPA 1CS8A 1KXRA 2XU4A 2E03A 1MEMA 1BQIA 8PCHA 1BY8A 3KW9A 1CV8A 3WXGA 2AUXA 4RY2A 2B1NA 3MORA 4YYWA 2ARYA 1TL9A 1GLOA 3CH2X 1AU4A 2YJ8A 3CBJA 2XU1A 1KHQA 1Y4HA 4CZWA 4YVAA 4YYUA 2AVWA 4PADA 5CHVA 1MIRA 1IWDA 1BGOA 3MTNA 1NB3A 2P7UA 3KFQA 3S3QA 5J94A 3PNRA 5FPWA 3S3RA 3N3GA 1U9VA 3GCBA 2HH5A 1EF7A 4YYVA 4DMYA 2JQFR 3P5WA 3IOQA 4OEMA 4I04A 2DCCA 3CH3X 2P0RA 3BC3A 4HWYA 3I3TA 2FO5A 2YJBA 1U9WA 4I05A 2OP3A 2YJ9A 2DC9A 1PCIA 2E02A 4W4UA 3C9EA 5CVMA 2NQGA 1POPA 3KWZA 3WXFA 1EWMA 4ZUXU 3BWKA 4WA6A 1ICFA 2FT2A 2NQIA 1PPPA 3F5VA 1NLJA 1S4VA 2HXZA 5EGWA 3HD3A 2AU1A 3O0UA 4Q8GA 4AXMA 3PDFA 1F2AA 2R9OA 1NQCA 1Q6KA 3N4CA 3PBHA 1CTEA 1PPNA 4MSXA 4YYRA 3BPFA 3I06A 1O0EA 1TU6A 2VHFA 3OF9A 2WBFX 1HUCB 4QH6A 3QSDA 1YT7A 3K8UA 2R6NA 2G7YA 3V6CA 2IPPB 2Y5BA 2DZZA 1BP4A 3IMAA 2NQDB 1NB5A 1MDWA 2GFOA 3IV2A 3V6EA 2DCAA 5EF4A 3RVVA 4G54A 1AECA 5JA7A 1U9XA 1PE6A 4CDCB 2OZ2A 1CB5A 4FJCA 3H89A 1A6RA 4QRVA 3RVWA 4CDDB 5JH3A 3HHAA 2GHUA 3RVXA 1ZIVA 4QRXA 1M6DA 1QMYA 2E01A 5CVNB 6PADA 2ACTA 3BOWA 2R9FA 2ATOA 3H8CA 1GECE 4W5CA 3IUTA 1EWPA 3D6SA 2R9NA 4X6JA 1PPOA 4X6HA 1PADA 1DEUA 4PI3A 4Q8HA 2Y6EA 1AU0A 4MZOA 1THEA 2FRQA 1XKGA 2AS8A 1EWLA 2FTDA 2BDZA 2R9MA 3NHEA 2PADA 3BCNA 5CHTA 1AYUA 5A24A 2OULA 3QJ3A 1NPZA 3LXSA 4I07A 1AU2A 2O6XA 2G8EA 3ZUAA 1YK7A 2FRAA 2DCDA 4BPVA 1ATKA 3LFYA 1U9QX 1TLOA 1YALA 2F7DA 2PREA 4CDEB 4QRGA 2DC6A 3P5UA 4N4ZA 1GMYA 3KSEA 3KX1A 2HHNA 1KFUL 3KKUA 2NQAA 1SP4B 3IHPA
chains in the Genus database with same CATH superfamily
3AI8A 1DKIA 3F75A 4BS6A 2XU3A 3DF0A 3OVXA 1MHWA 2DZYA 1QDQA 2DC7A 1PXVA 5F02A 1CSBB 1Y08A 1FH0A 2YJCA 4DMXA 4BOZA 4YYSA 2H7JA 4R3DA 4IUMA 2YJ2A 1VSNA 2DC8A 1DF0A 2B1MA 3H7DA 3CBKA 2PBHA 5EZQA 2BTWB 7PCKA 1YVBA 1CVZA 1ZCMA 3K24A 2BDLA 4BQVA 1PBHA 4BOSA 3BPMA 4K7CA 4YV8A 4MZSA 3B79A 3P5XA 3OISA 3H6SA 1UKFA 3HWNA 1ME3A 4N8WA 2VHSA 4AXLA 1GCBA 1VJVA 1NL6A 1U5IA 1F2CA 3TRKA 3OVZA 2UZJA 1ITOA 3M99A 4KLBA 4W5BA 2DCBA 1EWOA 3ERVA 3QT4A 2E00A 4XUIA 1QOLA 5K16A 3E1ZB 3HHIA 1ME4A 4QBBA 2R9CA 3BBAA 3PSEA 4OVZB 1F2BA 2G6DA 4P6EA 2CB5A 4XR7A 4PP1A 3TNXA 1CQDA 3B21A 3P5VA 1K3BB 3MHSA 2CIOA 4OELA 3U8EA 2C0YA 2XU5A 4FK5A 3KWBX 3MHHA 4M0WA 1AU3A 2PNSA 9PAPA 4CDFB 2Z84A 1CJLA 2FYEA 4BS5A 1QXPA 1JQPA 4P6GA 1MEGA 1KHPA 1PVJA 3N3KA 2AYNA 2AYOA 4YYQA 2HD5A 4OVZA 3K9MA 2F1GA 3O1GA 1CPJA 3PHWA 1YK8A 1KFXL 3IEJA 4N79A 1AYWA 2P86A 3USVA 1PPDA 3PW3A 1STFE 2DJFB 2J7QC 1AIMA 1F29A 3WXEA 3E9SA 3OF8A 1AYVA 2G8JA 3H8BA 2AIMA 4A5UA 2FQ9A 4BSQA 2DJGB 4WURA 4X6IA 2JQGR 2BU3A 2FUDA 5PADA 1PIPA 5CVOB 3MTVA 4PP2E 4BOQA 1SNKA 2AUZA 1X9YA 2IBIA 1MS6A 4FIPA 1CS8A 1KXRA 2XU4A 2E03A 1MEMA 4BOPA 1YZBA 1BQIA 8PCHA 1BY8A 3KW9A 1CV8A 4REZA 3WXGA 2AUXA 4RY2A 2B1NA 3MORA 4YYWA 2ARYA 1TL9A 1GLOA 3CH2X 1AU4A 2YJ8A 3CBJA 3MJ5A 2XU1A 1KHQA 1Y4HA 4CZWA 4YVAA 4YYUA 2AVWA 4PADA 5CHVA 1MIRA 1IWDA 1BGOA 3MTNA 1NB3A 4MM3B 2P7UA 3KFQA 3S3QA 5J94A 3PNRA 5FPWA 3S3RA 4RF1A 3N3GA 1U9VA 4IP3A 3GCBA 2HH5A 1EF7A 4YYVA 4GUAA 4DMYA 2JQFR 3P5WA 3IOQA 4OEMA 4I04A 2DCCA 3CH3X 2P0RA 3BC3A 4HWYA 3I3TA 2FO5A 2YJBA 1U9WA 3TMPA 4I05A 4MI7A 2OP3A 4ZTBA 4D8IA 2YJ9A 2DC9A 1PCIA 2E02A 4W4UA 3C9EA 3PHUA 5CVMA 2NQGA 1POPA 3KWZA 3WXFA 1EWMA 4ZUXU 3BWKA 3C0RA 4WA6A 1ICFA 5KO3A 2FT2A 2NQIA 1PPPA 3F5VA 1NLJA 1S4VA 2HXZA 2HWKA 5EGWA 4OW0A 3HD3A 2AU1A 3O0UA 4Q8GA 4AXMA 3PDFA 3BB7A 2JTCA 1F2AA 2R9OA 1NQCA 1Q6KA 3N4CA 3PBHA 1CTEA 1PPNA 4MSXA 4YYRA 3BPFA 4D8EA 3I06A 1O0EA 1TU6A 2VHFA 3OF9A 2WBFX 1HUCB 3MP2A 4QH6A 3QSDA 1YT7A 3K8UA 2R6NA 2G7YA 3BY4A 3V6CA 2IPPB 2Y5BA 2DZZA 1BP4A 4HXDB 3IMAA 2NQDB 1NB5A 2J7QA 4XZXA 1MDWA 2GFOA 3IV2A 3V6EA 2DCAA 5EF4A 3RVVA 4RNAA 3OQCA 4G54A 1AECA 2DOSA 3O65A 5JA7A 3W30A 1U9XA 1PE6A 4P16A 5E6JA 4CDCB 2OZ2A 4RKXA 3RNVA 1CB5A 4FJCA 3H89A 1A6RA 4QRVA 3RVWA 4CDDB 5JH3A 3ZNHA 4D8BA 3HHAA 2GHUA 3RVXA 4RF0A 1ZIVA 4QRXA 1M6DA 1QMYA 2E01A 5CVNB 6PADA 2ACTA 3BOWA 3PRPA 3IFUA 2R9FA 2ATOA 3W31A 3H8CA 1GECE 4W5CA 3PT2A 3IUTA 1EWPA 3PHXA 3D6SA 2R9NA 4X6JA 1PPOA 4X6HA 1PADA 1DEUA 4PI3A 4Q8HA 2Y6EA 2FE8A 1AU0A 4MZOA 1THEA 2FRQA 2BTWA 1XKGA 2AS8A 1EWLA 2FTDA 2BDZA 2R9MA 3NHEA 2AGAA 2PADA 3BCNA 5CHTA 1AYUA 5A24A 2OULA 3QJ3A 1NPZA 3LXSA 4I07A 2JRIA 1AU2A 2O6XA 2G8EA 3ZUAA 1YK7A 2FRAA 2DCDA 4BPVA 1ATKA 3LFYA 1U9QX 1TLOA 1YALA 4BOUA 2F7DA 2PREA 3PRMA 5JZEA 4CDEB 4QRGA 2DC6A 3P5UA 4N4ZA 1GMYA 3KSEA 4PT5A 3KX1A 5EZSA 2HHNA 1KFUL 3KKUA 2NQAA 1SP4B 3IHPA
chains in the Genus database with same CATH topology
3AI8A 3F75A 4BS6A 2XU3A 3DF0A 3OVXA 1MHWA 2DZYA 1QDQA 2DC7A 1PXVA 5F02A 1CSBB 1Y08A 1FH0A 2YJCA 4DMXA 4YYSA 2H7JA 2YJ2A 1VSNA 2DC8A 1DF0A 2B1MA 3H7DA 3CBKA 2PBHA 7PCKA 1YVBA 1CVZA 1ZCMA 3K24A 2BDLA 4BQVA 1PBHA 3BPMA 4K7CA 4YV8A 4MZSA 3B79A 3P5XA 3OISA 3H6SA 3HWNA 1GX3A 1ME3A 4N8WA 2VHSA 4AXLA 1GCBA 1VJVA 1NL6A 1U5IA 1F2CA 3OVZA 1ITOA 4KLBA 3M99A 4W5BA 2DCBA 1EWOA 3ERVA 3QT4A 2E00A 4XUIA 1QOLA 5K16A 3E1ZB 3HHIA 1ME4A 4QBBA 2R9CA 1F2BA 2G6DA 4P6EA 2CB5A 4XR7A 4PP1A 3TNXA 1CQDA 3P5VA 1K3BB 3MHSA 2CIOA 4OELA 3U8EA 2C0YA 2XU5A 4FK5A 3KWBX 3MHHA 1W6FA 1AU3A 2PNSA 9PAPA 4CDFB 1CJLA 2FYEA 4BS5A 1QXPA 1JQPA 4P6GA 1MEGA 1KHPA 3N3KA 2AYNA 2AYOA 4YYQA 2HD5A 3K9MA 2F1GA 3O1GA 1CPJA 1YK8A 1KFXL 3IEJA 4N79A 1AYWA 2P86A 3USVA 4NV7A 1PPDA 3PW3A 1STFE 2DJFB 4BGFA 1AIMA 1F29A 3WXEA 3OF8A 1AYVA 2G8JA 3H8BA 1W5RA 2AIMA 2FQ9A 4BSQA 2DJGB 3LTWA 4X6IA 2JQGR 2FUDA 5PADA 1PIPA 5CVOB 4PP2E 1SNKA 2AUZA 1X9YA 2IBIA 1MS6A 4FIPA 1CS8A 1KXRA 2XU4A 2BSZA 2E03A 1MEMA 1BQIA 8PCHA 1BY8A 3KW9A 1CV8A 3WXGA 2AUXA 4RY2A 2B1NA 3MORA 4YYWA 2ARYA 1TL9A 1GLOA 3CH2X 4NV8A 1AU4A 2YJ8A 3CBJA 2XU1A 1KHQA 1Y4HA 4CZWA 4YVAA 4YYUA 2AVWA 4PADA 5CHVA 1MIRA 1IWDA 1BGOA 3MTNA 1NB3A 2P7UA 3KFQA 3S3QA 5J94A 3PNRA 5FPWA 3S3RA 3N3GA 1U9VA 3GCBA 2HH5A 1EF7A 4YYVA 4DMYA 2JQFR 3P5WA 3IOQA 4OEMA 4I04A 2DCCA 3CH3X 2P0RA 3BC3A 4HWYA 3I3TA 2FO5A 2YJBA 1U9WA 4I05A 2OP3A 2YJ9A 2DC9A 1PCIA 2E02A 4W4UA 3C9EA 5CVMA 2NQGA 1POPA 3KWZA 3WXFA 1EWMA 4ZUXU 3BWKA 4B55A 4WA6A 1ICFA 2FT2A 2NQIA 1PPPA 3F5VA 1NLJA 1S4VA 2HXZA 5EGWA 3HD3A 2AU1A 3O0UA 4Q8GA 4AXMA 3PDFA 1F2AA 2R9OA 1NQCA 1Q6KA 3N4CA 3PBHA 1CTEA 1PPNA 4MSXA 2VFCA 4YYRA 3BPFA 3I06A 1O0EA 2VFBA 1TU6A 2VHFA 3OF9A 2WBFX 1HUCB 4QH6A 3QSDA 1YT7A 3K8UA 2R6NA 2G7YA 3V6CA 2IPPB 2Y5BA 2DZZA 1BP4A 3IMAA 2NQDB 1NB5A 1MDWA 2GFOA 3IV2A 3V6EA 2DCAA 5EF4A 3RVVA 4G54A 1AECA 5JA7A 1U9XA 1PE6A 4CDCB 2OZ2A 1CB5A 4FJCA 3H89A 1A6RA 4QRVA 3RVWA 4CDDB 5JH3A 3HHAA 2GHUA 3RVXA 1ZIVA 4QRXA 1M6DA 1QMYA 2E01A 5CVNB 6PADA 2ACTA 3BOWA 2R9FA 2ATOA 3H8CA 1GECE 4W5CA 3IUTA 1EWPA 3D6SA 2R9NA 4X6JA 1PPOA 4X6HA 1PADA 1DEUA 4PI3A 4Q8HA 2Y6EA 1AU0A 4MZOA 1THEA 2FRQA 1XKGA 2AS8A 1EWLA 2FTDA 2BDZA 4C5PA 2R9MA 3NHEA 2PADA 3BCNA 5CHTA 1AYUA 5A24A 2OULA 3QJ3A 1NPZA 3LXSA 4I07A 3D9WA 1AU2A 2O6XA 2G8EA 3ZUAA 1YK7A 2FRAA 4GUZA 2DCDA 4BPVA 1ATKA 3LFYA 1U9QX 1TLOA 1YALA 2F7DA 2PREA 4CDEB 4QRGA 2DC6A 3P5UA 4N4ZA 1GMYA 3KSEA 3KX1A 2HHNA 1KFUL 1W4TA 3KKUA 2NQAA 1E2TA 1SP4B 3IHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AI8 A;  3F75 A;  4BS6 A;  2XU3 A;  3DF0 A;  3OVX A;  1MHW A;  2DZY A;  1QDQ A;  2DC7 A;  1PXV A;  5F02 A;  1CSB B;  1Y08 A;  1FH0 A;  2YJC A;  4DMX A;  4YYS A;  2H7J A;  2YJ2 A;  1VSN A;  2DC8 A;  1DF0 A;  2B1M A;  3H7D A;  3CBK A;  2PBH A;  7PCK A;  1YVB A;  1CVZ A;  1ZCM A;  3K24 A;  2BDL A;  4BQV A;  1PBH A;  3BPM A;  4K7C A;  4YV8 A;  4MZS A;  3B79 A;  3P5X A;  3OIS A;  3H6S A;  3HWN A;  1ME3 A;  4N8W A;  2VHS A;  4AXL A;  1GCB A;  1VJV A;  1NL6 A;  1U5I A;  1F2C A;  3OVZ A;  1ITO A;  3M99 A;  4KLB A;  4W5B A;  2DCB A;  1EWO A;  3ERV A;  3QT4 A;  2E00 A;  4XUI A;  1QOL A;  5K16 A;  3E1Z B;  3HHI A;  1ME4 A;  4QBB A;  2R9C A;  1F2B A;  2G6D A;  4P6E A;  2CB5 A;  4XR7 A;  4PP1 A;  3TNX A;  1CQD A;  3P5V A;  1K3B B;  3MHS A;  2CIO A;  4OEL A;  3U8E A;  2C0Y A;  2XU5 A;  4FK5 A;  3KWB X;  3MHH A;  1AU3 A;  2PNS A;  9PAP A;  4CDF B;  1CJL A;  2FYE A;  4BS5 A;  1QXP A;  1JQP A;  4P6G A;  1MEG A;  1KHP A;  3N3K A;  2AYN A;  2AYO A;  4YYQ A;  2HD5 A;  3K9M A;  2F1G A;  3O1G A;  1CPJ A;  1YK8 A;  1KFX L;  3IEJ A;  4N79 A;  1AYW A;  2P86 A;  3USV A;  1PPD A;  3PW3 A;  1STF E;  2DJF B;  1AIM A;  1F29 A;  3WXE A;  3OF8 A;  1AYV A;  2G8J A;  3H8B A;  2AIM A;  2FQ9 A;  4BSQ A;  2DJG B;  4X6I A;  2JQG R;  2FUD A;  5PAD A;  1PIP A;  5CVO B;  4PP2 E;  1SNK A;  2AUZ A;  1X9Y A;  2IBI A;  1MS6 A;  4FIP A;  1CS8 A;  1KXR A;  2XU4 A;  2E03 A;  1MEM A;  1BQI A;  8PCH A;  1BY8 A;  3KW9 A;  1CV8 A;  3WXG A;  2AUX A;  4RY2 A;  2B1N A;  3MOR A;  4YYW A;  2ARY A;  1TL9 A;  1GLO A;  3CH2 X;  1AU4 A;  2YJ8 A;  3CBJ A;  2XU1 A;  1KHQ A;  1Y4H A;  4CZW A;  4YVA A;  4YYU A;  2AVW A;  4PAD A;  5CHV A;  1MIR A;  1IWD A;  1BGO A;  3MTN A;  1NB3 A;  2P7U A;  3KFQ A;  3S3Q A;  5J94 A;  3PNR A;  5FPW A;  3S3R A;  3N3G A;  1U9V A;  3GCB A;  2HH5 A;  1EF7 A;  4YYV A;  4DMY A;  2JQF R;  3P5W A;  3IOQ A;  4OEM A;  4I04 A;  2DCC A;  3CH3 X;  2P0R A;  3BC3 A;  4HWY A;  3I3T A;  2FO5 A;  2YJB A;  1U9W A;  4I05 A;  2OP3 A;  2YJ9 A;  2DC9 A;  1PCI A;  2E02 A;  4W4U A;  3C9E A;  5CVM A;  2NQG A;  1POP A;  3KWZ A;  3WXF A;  1EWM A;  4ZUX U;  3BWK A;  4WA6 A;  1ICF A;  2FT2 A;  2NQI A;  1PPP A;  3F5V A;  1NLJ A;  1S4V A;  2HXZ A;  5EGW A;  3HD3 A;  2AU1 A;  3O0U A;  4Q8G A;  4AXM A;  3PDF A;  1F2A A;  2R9O A;  1NQC A;  1Q6K A;  3N4C A;  3PBH A;  1CTE A;  1PPN A;  4MSX A;  4YYR A;  3BPF A;  3I06 A;  1O0E A;  1TU6 A;  2VHF A;  3OF9 A;  2WBF X;  1HUC B;  4QH6 A;  3QSD A;  1YT7 A;  3K8U A;  2R6N A;  2G7Y A;  3V6C A;  2IPP B;  2Y5B A;  2DZZ A;  1BP4 A;  3IMA A;  2NQD B;  1NB5 A;  1MDW A;  2GFO A;  3IV2 A;  3V6E A;  2DCA A;  5EF4 A;  3RVV A;  4G54 A;  1AEC A;  5JA7 A;  1U9X A;  1PE6 A;  4CDC B;  2OZ2 A;  1CB5 A;  4FJC A;  3H89 A;  1A6R A;  4QRV A;  3RVW A;  4CDD B;  5JH3 A;  3HHA A;  2GHU A;  3RVX A;  1ZIV A;  4QRX A;  1M6D A;  1QMY A;  2E01 A;  5CVN B;  6PAD A;  2ACT A;  3BOW A;  2R9F A;  2ATO A;  3H8C A;  1GEC E;  4W5C A;  3IUT A;  1EWP A;  3D6S A;  2R9N A;  4X6J A;  1PPO A;  4X6H A;  1PAD A;  1DEU A;  4PI3 A;  4Q8H A;  2Y6E A;  1AU0 A;  4MZO A;  1THE A;  2FRQ A;  1XKG A;  2AS8 A;  1EWL A;  2FTD A;  2BDZ A;  2R9M A;  3NHE A;  2PAD A;  3BCN A;  5CHT A;  1AYU A;  5A24 A;  2OUL A;  3QJ3 A;  1NPZ A;  3LXS A;  4I07 A;  1AU2 A;  2O6X A;  2G8E A;  3ZUA A;  1YK7 A;  2FRA A;  2DCD A;  4BPV A;  1ATK A;  3LFY A;  1U9Q X;  1TLO A;  1YAL A;  2F7D A;  2PRE A;  4CDE B;  4QRG A;  2DC6 A;  3P5U A;  4N4Z A;  1GMY A;  3KSE A;  3KX1 A;  2HHN A;  1KFU L;  3KKU A;  2NQA A;  1SP4 B;  3IHP A; 
#chains in the Genus database with same CATH topology
 3AI8 A;  1DKI A;  3F75 A;  4BS6 A;  2XU3 A;  3DF0 A;  3OVX A;  1MHW A;  2DZY A;  1QDQ A;  2DC7 A;  1PXV A;  5F02 A;  1CSB B;  1Y08 A;  1FH0 A;  2YJC A;  4DMX A;  4BOZ A;  4YYS A;  2H7J A;  4R3D A;  4IUM A;  2YJ2 A;  1VSN A;  2DC8 A;  1DF0 A;  2B1M A;  3H7D A;  3CBK A;  2PBH A;  5EZQ A;  2BTW B;  7PCK A;  1YVB A;  1CVZ A;  1ZCM A;  3K24 A;  2BDL A;  4BQV A;  1PBH A;  4BOS A;  3BPM A;  4K7C A;  4YV8 A;  4MZS A;  3B79 A;  3P5X A;  3OIS A;  3H6S A;  1UKF A;  3HWN A;  1ME3 A;  4N8W A;  2VHS A;  4AXL A;  1GCB A;  1VJV A;  1NL6 A;  1U5I A;  1F2C A;  3TRK A;  3OVZ A;  2UZJ A;  1ITO A;  3M99 A;  4KLB A;  4W5B A;  2DCB A;  1EWO A;  3ERV A;  3QT4 A;  2E00 A;  4XUI A;  1QOL A;  5K16 A;  3E1Z B;  3HHI A;  1ME4 A;  4QBB A;  2R9C A;  3BBA A;  3PSE A;  4OVZ B;  1F2B A;  2G6D A;  4P6E A;  2CB5 A;  4XR7 A;  4PP1 A;  3TNX A;  1CQD A;  3B21 A;  3P5V A;  1K3B B;  3MHS A;  2CIO A;  4OEL A;  3U8E A;  2C0Y A;  2XU5 A;  4FK5 A;  3KWB X;  3MHH A;  4M0W A;  1AU3 A;  2PNS A;  9PAP A;  4CDF B;  2Z84 A;  1CJL A;  2FYE A;  4BS5 A;  1QXP A;  1JQP A;  4P6G A;  1MEG A;  1KHP A;  1PVJ A;  3N3K A;  2AYN A;  2AYO A;  4YYQ A;  2HD5 A;  4OVZ A;  3K9M A;  2F1G A;  3O1G A;  1CPJ A;  3PHW A;  1YK8 A;  1KFX L;  3IEJ A;  4N79 A;  1AYW A;  2P86 A;  3USV A;  1PPD A;  3PW3 A;  1STF E;  2DJF B;  2J7Q C;  1AIM A;  1F29 A;  3WXE A;  3E9S A;  3OF8 A;  1AYV A;  2G8J A;  3H8B A;  2AIM A;  4A5U A;  2FQ9 A;  4BSQ A;  2DJG B;  4WUR A;  4X6I A;  2JQG R;  2BU3 A;  2FUD A;  5PAD A;  1PIP A;  5CVO B;  3MTV A;  4PP2 E;  4BOQ A;  1SNK A;  2AUZ A;  1X9Y A;  2IBI A;  1MS6 A;  4FIP A;  1CS8 A;  1KXR A;  2XU4 A;  2E03 A;  1MEM A;  4BOP A;  1YZB A;  1BQI A;  8PCH A;  1BY8 A;  3KW9 A;  1CV8 A;  4REZ A;  3WXG A;  2AUX A;  4RY2 A;  2B1N A;  3MOR A;  4YYW A;  2ARY A;  1TL9 A;  1GLO A;  3CH2 X;  1AU4 A;  2YJ8 A;  3CBJ A;  3MJ5 A;  2XU1 A;  1KHQ A;  1Y4H A;  4CZW A;  4YVA A;  4YYU A;  2AVW A;  4PAD A;  5CHV A;  1MIR A;  1IWD A;  1BGO A;  3MTN A;  1NB3 A;  4MM3 B;  2P7U A;  3KFQ A;  3S3Q A;  5J94 A;  3PNR A;  5FPW A;  3S3R A;  4RF1 A;  3N3G A;  1U9V A;  4IP3 A;  3GCB A;  2HH5 A;  1EF7 A;  4YYV A;  4GUA A;  4DMY A;  2JQF R;  3P5W A;  3IOQ A;  4OEM A;  4I04 A;  2DCC A;  3CH3 X;  2P0R A;  3BC3 A;  4HWY A;  3I3T A;  2FO5 A;  2YJB A;  1U9W A;  3TMP A;  4I05 A;  4MI7 A;  2OP3 A;  4ZTB A;  4D8I A;  2YJ9 A;  2DC9 A;  1PCI A;  2E02 A;  4W4U A;  3C9E A;  3PHU A;  5CVM A;  2NQG A;  1POP A;  3KWZ A;  3WXF A;  1EWM A;  4ZUX U;  3BWK A;  3C0R A;  4WA6 A;  1ICF A;  5KO3 A;  2FT2 A;  2NQI A;  1PPP A;  3F5V A;  1NLJ A;  1S4V A;  2HXZ A;  2HWK A;  5EGW A;  4OW0 A;  3HD3 A;  2AU1 A;  3O0U A;  4Q8G A;  4AXM A;  3PDF A;  3BB7 A;  2JTC A;  1F2A A;  2R9O A;  1NQC A;  1Q6K A;  3N4C A;  3PBH A;  1CTE A;  1PPN A;  4MSX A;  4YYR A;  3BPF A;  4D8E A;  3I06 A;  1O0E A;  1TU6 A;  2VHF A;  3OF9 A;  2WBF X;  1HUC B;  3MP2 A;  4QH6 A;  3QSD A;  1YT7 A;  3K8U A;  2R6N A;  2G7Y A;  3BY4 A;  3V6C A;  2IPP B;  2Y5B A;  2DZZ A;  1BP4 A;  4HXD B;  3IMA A;  2NQD B;  1NB5 A;  2J7Q A;  4XZX A;  1MDW A;  2GFO A;  3IV2 A;  3V6E A;  2DCA A;  5EF4 A;  3RVV A;  4RNA A;  3OQC A;  4G54 A;  1AEC A;  2DOS A;  3O65 A;  5JA7 A;  3W30 A;  1U9X A;  1PE6 A;  4P16 A;  5E6J A;  4CDC B;  2OZ2 A;  4RKX A;  3RNV A;  1CB5 A;  4FJC A;  3H89 A;  1A6R A;  4QRV A;  3RVW A;  4CDD B;  5JH3 A;  3ZNH A;  4D8B A;  3HHA A;  2GHU A;  3RVX A;  4RF0 A;  1ZIV A;  4QRX A;  1M6D A;  1QMY A;  2E01 A;  5CVN B;  6PAD A;  2ACT A;  3BOW A;  3PRP A;  3IFU A;  2R9F A;  2ATO A;  3W31 A;  3H8C A;  1GEC E;  4W5C A;  3PT2 A;  3IUT A;  1EWP A;  3PHX A;  3D6S A;  2R9N A;  4X6J A;  1PPO A;  4X6H A;  1PAD A;  1DEU A;  4PI3 A;  4Q8H A;  2Y6E A;  2FE8 A;  1AU0 A;  4MZO A;  1THE A;  2FRQ A;  2BTW A;  1XKG A;  2AS8 A;  1EWL A;  2FTD A;  2BDZ A;  2R9M A;  3NHE A;  2AGA A;  2PAD A;  3BCN A;  5CHT A;  1AYU A;  5A24 A;  2OUL A;  3QJ3 A;  1NPZ A;  3LXS A;  4I07 A;  2JRI A;  1AU2 A;  2O6X A;  2G8E A;  3ZUA A;  1YK7 A;  2FRA A;  2DCD A;  4BPV A;  1ATK A;  3LFY A;  1U9Q X;  1TLO A;  1YAL A;  4BOU A;  2F7D A;  2PRE A;  3PRM A;  5JZE A;  4CDE B;  4QRG A;  2DC6 A;  3P5U A;  4N4Z A;  1GMY A;  3KSE A;  4PT5 A;  3KX1 A;  5EZS A;  2HHN A;  1KFU L;  3KKU A;  2NQA A;  1SP4 B;  3IHP A; 
#chains in the Genus database with same CATH homology
 3AI8 A;  3F75 A;  4BS6 A;  2XU3 A;  3DF0 A;  3OVX A;  1MHW A;  2DZY A;  1QDQ A;  2DC7 A;  1PXV A;  5F02 A;  1CSB B;  1Y08 A;  1FH0 A;  2YJC A;  4DMX A;  4YYS A;  2H7J A;  2YJ2 A;  1VSN A;  2DC8 A;  1DF0 A;  2B1M A;  3H7D A;  3CBK A;  2PBH A;  7PCK A;  1YVB A;  1CVZ A;  1ZCM A;  3K24 A;  2BDL A;  4BQV A;  1PBH A;  3BPM A;  4K7C A;  4YV8 A;  4MZS A;  3B79 A;  3P5X A;  3OIS A;  3H6S A;  3HWN A;  1GX3 A;  1ME3 A;  4N8W A;  2VHS A;  4AXL A;  1GCB A;  1VJV A;  1NL6 A;  1U5I A;  1F2C A;  3OVZ A;  1ITO A;  4KLB A;  3M99 A;  4W5B A;  2DCB A;  1EWO A;  3ERV A;  3QT4 A;  2E00 A;  4XUI A;  1QOL A;  5K16 A;  3E1Z B;  3HHI A;  1ME4 A;  4QBB A;  2R9C A;  1F2B A;  2G6D A;  4P6E A;  2CB5 A;  4XR7 A;  4PP1 A;  3TNX A;  1CQD A;  3P5V A;  1K3B B;  3MHS A;  2CIO A;  4OEL A;  3U8E A;  2C0Y A;  2XU5 A;  4FK5 A;  3KWB X;  3MHH A;  1W6F A;  1AU3 A;  2PNS A;  9PAP A;  4CDF B;  1CJL A;  2FYE A;  4BS5 A;  1QXP A;  1JQP A;  4P6G A;  1MEG A;  1KHP A;  3N3K A;  2AYN A;  2AYO A;  4YYQ A;  2HD5 A;  3K9M A;  2F1G A;  3O1G A;  1CPJ A;  1YK8 A;  1KFX L;  3IEJ A;  4N79 A;  1AYW A;  2P86 A;  3USV A;  4NV7 A;  1PPD A;  3PW3 A;  1STF E;  2DJF B;  4BGF A;  1AIM A;  1F29 A;  3WXE A;  3OF8 A;  1AYV A;  2G8J A;  3H8B A;  1W5R A;  2AIM A;  2FQ9 A;  4BSQ A;  2DJG B;  3LTW A;  4X6I A;  2JQG R;  2FUD A;  5PAD A;  1PIP A;  5CVO B;  4PP2 E;  1SNK A;  2AUZ A;  1X9Y A;  2IBI A;  1MS6 A;  4FIP A;  1CS8 A;  1KXR A;  2XU4 A;  2BSZ A;  2E03 A;  1MEM A;  1BQI A;  8PCH A;  1BY8 A;  3KW9 A;  1CV8 A;  3WXG A;  2AUX A;  4RY2 A;  2B1N A;  3MOR A;  4YYW A;  2ARY A;  1TL9 A;  1GLO A;  3CH2 X;  4NV8 A;  1AU4 A;  2YJ8 A;  3CBJ A;  2XU1 A;  1KHQ A;  1Y4H A;  4CZW A;  4YVA A;  4YYU A;  2AVW A;  4PAD A;  5CHV A;  1MIR A;  1IWD A;  1BGO A;  3MTN A;  1NB3 A;  2P7U A;  3KFQ A;  3S3Q A;  5J94 A;  3PNR A;  5FPW A;  3S3R A;  3N3G A;  1U9V A;  3GCB A;  2HH5 A;  1EF7 A;  4YYV A;  4DMY A;  2JQF R;  3P5W A;  3IOQ A;  4OEM A;  4I04 A;  2DCC A;  3CH3 X;  2P0R A;  3BC3 A;  4HWY A;  3I3T A;  2FO5 A;  2YJB A;  1U9W A;  4I05 A;  2OP3 A;  2YJ9 A;  2DC9 A;  1PCI A;  2E02 A;  4W4U A;  3C9E A;  5CVM A;  2NQG A;  1POP A;  3KWZ A;  3WXF A;  1EWM A;  4ZUX U;  3BWK A;  4B55 A;  4WA6 A;  1ICF A;  2FT2 A;  2NQI A;  1PPP A;  3F5V A;  1NLJ A;  1S4V A;  2HXZ A;  5EGW A;  3HD3 A;  2AU1 A;  3O0U A;  4Q8G A;  4AXM A;  3PDF A;  1F2A A;  2R9O A;  1NQC A;  1Q6K A;  3N4C A;  3PBH A;  1CTE A;  1PPN A;  4MSX A;  2VFC A;  4YYR A;  3BPF A;  3I06 A;  1O0E A;  2VFB A;  1TU6 A;  2VHF A;  3OF9 A;  2WBF X;  1HUC B;  4QH6 A;  3QSD A;  1YT7 A;  3K8U A;  2R6N A;  2G7Y A;  3V6C A;  2IPP B;  2Y5B A;  2DZZ A;  1BP4 A;  3IMA A;  2NQD B;  1NB5 A;  1MDW A;  2GFO A;  3IV2 A;  3V6E A;  2DCA A;  5EF4 A;  3RVV A;  4G54 A;  1AEC A;  5JA7 A;  1U9X A;  1PE6 A;  4CDC B;  2OZ2 A;  1CB5 A;  4FJC A;  3H89 A;  1A6R A;  4QRV A;  3RVW A;  4CDD B;  5JH3 A;  3HHA A;  2GHU A;  3RVX A;  1ZIV A;  4QRX A;  1M6D A;  1QMY A;  2E01 A;  5CVN B;  6PAD A;  2ACT A;  3BOW A;  2R9F A;  2ATO A;  3H8C A;  1GEC E;  4W5C A;  3IUT A;  1EWP A;  3D6S A;  2R9N A;  4X6J A;  1PPO A;  4X6H A;  1PAD A;  1DEU A;  4PI3 A;  4Q8H A;  2Y6E A;  1AU0 A;  4MZO A;  1THE A;  2FRQ A;  1XKG A;  2AS8 A;  1EWL A;  2FTD A;  2BDZ A;  4C5P A;  2R9M A;  3NHE A;  2PAD A;  3BCN A;  5CHT A;  1AYU A;  5A24 A;  2OUL A;  3QJ3 A;  1NPZ A;  3LXS A;  4I07 A;  3D9W A;  1AU2 A;  2O6X A;  2G8E A;  3ZUA A;  1YK7 A;  2FRA A;  4GUZ A;  2DCD A;  4BPV A;  1ATK A;  3LFY A;  1U9Q X;  1TLO A;  1YAL A;  2F7D A;  2PRE A;  4CDE B;  4QRG A;  2DC6 A;  3P5U A;  4N4Z A;  1GMY A;  3KSE A;  3KX1 A;  2HHN A;  1KFU L;  1W4T A;  3KKU A;  2NQA A;  1E2T A;  1SP4 B;  3IHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...