1ATKA

Crystal structure of the cysteine protease human cathepsin k in complex with the covalent inhibitor e-64
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human osteoclast cathepsin K complex with E-64.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CATHEPSIN K
total genus 66
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1996-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1atkA00
4N8WA 1U9VA 1NB3A 3F5VA 3B79A 4CDCB 1AU0A 2AYOA 3IV2A 2G8JA 3KX1A 4YYRA 1M6DA 1NL6A 2R9CA 3MHHA 1AIMA 2YJBA 1GCBA 1ZCMA 2FRQA 3P5XA 3ZUAA 4YYVA 3KWZA 4QBBA 1CB5A 2HH5A 4YV8A 1NPZA 3GCBA 3N3KA 4QRGA 1JQPA 1AECA 1BY8A 1YK7A 5CVMA 2BDLA 1KFUL 1EWOA 5CHTA 2P7UA 3C9EA 3PBHA 3QT4A 1U9XA 2AU1A 2DCDA 2G6DA 3QJ3A 4YYQA 3HHAA 3I06A 3MTNA 4RY2A 2YJ2A 3WXEA 4DMYA 1KXRA 3HD3A 3KW9A 4PP1A 2R9OA 1FH0A 2DJGB 4MZOA 1NQCA 4XUIA 4QRXA 3RVVA 3RVXA 1CPJA 3V6EA 4G54A 1PE6A 4AXLA 3K9MA 2B1NA 1YT7A 1CSBB 1S4VA 3TNXA 1PBHA 3PDFA 3ERVA 1PPOA 1EF7A 2FT2A 1CQDA 3HHIA 4P6GA 3H8BA 4P6EA 3MORA 1PPNA 2DZZA 2AVWA 2VHSA 5CVNB 2GHUA 5JA7A 1QOLA 3KFQA 1F2CA 1CJLA 4YYUA 5PADA 1K3BB 1F29A 4OEMA 1A6RA 2E03A 5F02A 1YK8A 3K24A 2FTDA 3HWNA 3BPMA 2NQIA 2PREA 4YYWA 1NB5A 2ARYA 1EWPA 3D6SA 2ATOA 2E00A 3OVZA 2F1GA 2VHFA 2FUDA 2DZYA 2XU1A 2AUZA 1STFE 7PCKA 4PP2E 2OP3A 2CB5A 3IHPA 3MHSA 1THEA 1TL9A 1AU4A 2NQGA 1QXPA 1ITOA 1YVBA 1QDQA 1MEGA 3O0UA 2CIOA 4QRVA 3KKUA 2DCCA 3S3QA 1BQIA 1AYWA 5FPWA 3BPFA 3OISA 2HHNA 2NQAA 4PADA 1F2BA 2P86A 5EF4A 1KHPA 1IWDA 2NQDB 4HWYA 3N3GA 3USVA 3OVXA 1PIPA 3P5WA 4AXMA 4BS6A 2OULA 1PXVA 3AI8A 1CTEA 1KHQA 3RVWA 2YJ9A 4BQVA 1ZIVA 2PNSA 2IBIA 4KLBA 1HUCB 3E1ZB 2XU5A 3OF8A 1ME4A 3S3RA 1Y08A 1GLOA 4CDFB 1PPPA 4X6IA 2DCAA 3IUTA 1CS8A 1DF0A 2AUXA 9PAPA 5A24A 1MHWA 3O1GA 1U9WA 4FK5A 3IEJA 1TU6A 3OF9A 2O6XA 1MEMA 3KSEA 2FO5A 3H89A 4YVAA 2ACTA 2JQGR 3BOWA 1AYVA 2AS8A 2DCBA 3H6SA 2FRAA 1EWLA 3F75A 2C0YA 3NHEA 3K8UA 2E01A 2R6NA 1SP4B 3H7DA 4W4UA 4BPVA 5CVOB 3WXFA 1PCIA 2FYEA 2YJ8A 3IMAA 4ZUXU 3LFYA 1VSNA 4WA6A 1EWMA 2DC9A 2G8EA 4YYSA 4BS5A 4MZSA 4I05A 3V6CA 2Y5BA 2G7YA 3P5UA 4FIPA 4W5CA 4CZWA 4QH6A 2FQ9A 2AYNA 3CBJA 5J94A 8PCHA 1BGOA 2PADA 1NLJA 2HD5A 1MIRA 3LXSA 3P5VA 1ME3A 2DJFB 1POPA 3U8EA 1BP4A 2E02A 4DMXA 1GMYA 3M99A 2DC7A 2BDZA 3H8CA 4BSQA 2DC6A 1TLOA 2YJCA 1MDWA 1AU3A 4I07A 1Y4HA 4I04A 1ATKA 2WBFX 1ICFA 3N4CA 2P0RA 4X6HA 2F7DA 4PI3A 2AIMA 2XU4A 2XU3A 6PADA 2OZ2A 2GFOA 1AYUA 3CBKA 5JH3A 2DC8A 2Y6EA 4Q8GA 4MSXA 4FJCA 1X9YA 3I3TA 1F2AA 4CDDB 1U9QX 4X6JA 5CHVA 3BWKA 1MS6A 4Q8HA 2R9FA 1SNKA 1CV8A 5K16A 4W5BA 4N4ZA 4OELA 3CH3X 2R9NA 2JQFR 4N79A 3BCNA 1YALA 1KFXL 1PPDA 3KWBX 1GECE 1VJVA 1CVZA 3CH2X 4K7CA 1AU2A 5EGWA 1QMYA 4XR7A 3IOQA 3QSDA 1PADA 2HXZA 1Q6KA 4CDEB 3PNRA 1XKGA 3DF0A 2H7JA 2PBHA 2R9MA 1DEUA 2B1MA 3BC3A 3WXGA 3PW3A 2IPPB 1U5IA 1O0EA
chains in the Genus database with same CATH superfamily
4N8WA 1U9VA 1NB3A 3F5VA 3B79A 3IFUA 4CDCB 1AU0A 4BOPA 2AYOA 3IV2A 2G8JA 3KX1A 4YYRA 1M6DA 4RNAA 1NL6A 2R9CA 3B21A 3MHHA 1AIMA 2YJBA 1GCBA 4GUAA 1ZCMA 2FRQA 3P5XA 3ZUAA 4BOQA 4YYVA 3KWZA 4IUMA 2HWKA 4QBBA 1CB5A 2HH5A 3MP2A 4YV8A 1NPZA 3E9SA 3GCBA 3N3KA 4QRGA 4OVZA 1JQPA 1AECA 4XZXA 1BY8A 1YK7A 5CVMA 2BDLA 1KFUL 1EWOA 5CHTA 2UZJA 2P7UA 3C9EA 3PBHA 3QT4A 1U9XA 2AU1A 2DCDA 2G6DA 3QJ3A 3PRPA 4YYQA 3HHAA 2JRIA 3MTNA 3I06A 4RY2A 2AGAA 2YJ2A 3WXEA 1PVJA 4DMYA 1KXRA 3HD3A 3KW9A 4PP1A 2R9OA 1FH0A 2DJGB 3PSEA 4MZOA 1NQCA 4XUIA 4HXDB 4QRXA 3RVVA 3RVXA 1CPJA 3V6EA 3PHUA 4G54A 1PE6A 4AXLA 3K9MA 2B1NA 1YT7A 3PHXA 1CSBB 3RNVA 1S4VA 3TNXA 3W30A 1PBHA 3PDFA 3ERVA 1PPOA 1EF7A 2FT2A 1CQDA 3HHIA 4P16A 2Z84A 3H8BA 4P6GA 4P6EA 4RF1A 3MORA 1PPNA 2DZZA 2AVWA 2VHSA 3C0RA 5CVNB 4OVZB 2GHUA 5JA7A 1QOLA 3KFQA 1F2CA 1CJLA 4YYUA 1YZBA 5PADA 1K3BB 1F29A 4OEMA 4RKXA 1A6RA 2E03A 5F02A 1YK8A 3K24A 2FTDA 3HWNA 3BPMA 2NQIA 1DKIA 2PREA 4YYWA 1NB5A 2ARYA 5E6JA 1EWPA 3D6SA 2ATOA 2E00A 3OVZA 4IP3A 2F1GA 2VHFA 2FUDA 2DZYA 2XU1A 2AUZA 1STFE 7PCKA 4PP2E 2OP3A 4A5UA 2CB5A 3IHPA 3MHSA 1THEA 1TL9A 1AU4A 2NQGA 1QXPA 1ITOA 1YVBA 1QDQA 1MEGA 3O0UA 2CIOA 4QRVA 3KKUA 2DCCA 3S3QA 1BQIA 3PHWA 1AYWA 5FPWA 3BPFA 3OISA 2HHNA 2NQAA 4PADA 1F2BA 2P86A 3PRMA 4BOUA 5EF4A 1KHPA 3OQCA 1IWDA 2J7QA 4PT5A 2NQDB 4HWYA 3BB7A 3N3GA 3USVA 3OVXA 1PIPA 3P5WA 4AXMA 4BS6A 2OULA 1PXVA 3AI8A 1CTEA 1KHQA 3RVWA 2YJ9A 4BQVA 1ZIVA 2PNSA 5KO3A 4MI7A 2IBIA 4KLBA 1HUCB 4OW0A 3E1ZB 2XU5A 3OF8A 1ME4A 3S3RA 1Y08A 1GLOA 4CDFB 4D8BA 5EZQA 1PPPA 4X6IA 2DCAA 2BTWB 3IUTA 2J7QC 1CS8A 1DF0A 2AUXA 9PAPA 5A24A 1MHWA 3O1GA 1U9WA 4FK5A 3O65A 4ZTBA 3IEJA 1TU6A 3OF9A 2O6XA 1MEMA 3KSEA 2FO5A 3H89A 4YVAA 2ACTA 2JQGR 2DOSA 3BOWA 1AYVA 2AS8A 2DCBA 3H6SA 4BOZA 2FRAA 1EWLA 3F75A 2C0YA 3NHEA 3K8UA 2E01A 2R6NA 1SP4B 3H7DA 4W4UA 4BPVA 5CVOB 3WXFA 1PCIA 3PT2A 4BOSA 2FYEA 2YJ8A 3IMAA 4ZUXU 3LFYA 1VSNA 4WA6A 4MM3B 1EWMA 2DC9A 2G8EA 3TMPA 4YYSA 4BS5A 4MZSA 4I05A 3V6CA 2Y5BA 2G7YA 2JTCA 3P5UA 4FIPA 4W5CA 3MJ5A 4CZWA 4QH6A 2FQ9A 4REZA 2AYNA 3CBJA 5J94A 8PCHA 1BGOA 2PADA 1NLJA 2HD5A 1MIRA 3LXSA 3P5VA 1ME3A 2DJFB 4R3DA 4D8IA 1POPA 2BTWA 1UKFA 3U8EA 1BP4A 2E02A 4DMXA 1GMYA 3M99A 2DC7A 3ZNHA 2BDZA 3H8CA 4BSQA 5JZEA 2DC6A 1TLOA 2YJCA 1MDWA 1AU3A 4I07A 1Y4HA 3TRKA 3MTVA 1ATKA 4I04A 2WBFX 1ICFA 3N4CA 5EZSA 2P0RA 4X6HA 2F7DA 2BU3A 2AIMA 4PI3A 2XU4A 2XU3A 6PADA 2OZ2A 2GFOA 1AYUA 3CBKA 5JH3A 2DC8A 2Y6EA 3W31A 4Q8GA 4MSXA 4FJCA 1X9YA 3I3TA 1F2AA 4CDDB 1U9QX 4X6JA 5CHVA 3BWKA 1MS6A 4Q8HA 2R9FA 1SNKA 1CV8A 4RF0A 5K16A 4W5BA 4N4ZA 4OELA 3CH3X 2R9NA 2JQFR 3BY4A 4N79A 3BBAA 3BCNA 1YALA 1KFXL 1PPDA 3KWBX 1GECE 1VJVA 1CVZA 3CH2X 4M0WA 4WURA 2FE8A 4K7CA 1AU2A 5EGWA 1QMYA 4XR7A 3IOQA 3QSDA 1PADA 2HXZA 1Q6KA 4CDEB 4D8EA 3PNRA 1XKGA 3DF0A 2H7JA 2PBHA 2R9MA 1DEUA 2B1MA 3BC3A 3WXGA 3PW3A 2IPPB 1U5IA 1O0EA
chains in the Genus database with same CATH topology
4N8WA 1U9VA 1NB3A 3F5VA 3B79A 4CDCB 1AU0A 2AYOA 3IV2A 2G8JA 3KX1A 4YYRA 1M6DA 1NL6A 2R9CA 3MHHA 1AIMA 2YJBA 1GCBA 1ZCMA 2FRQA 3P5XA 3ZUAA 4YYVA 3KWZA 1W5RA 3LTWA 4QBBA 1CB5A 2HH5A 4YV8A 1NPZA 3GCBA 3N3KA 4QRGA 1JQPA 1AECA 1BY8A 1YK7A 5CVMA 1W6FA 2BDLA 1KFUL 1EWOA 5CHTA 2P7UA 3C9EA 3PBHA 3QT4A 1U9XA 2AU1A 2DCDA 2G6DA 3QJ3A 4YYQA 3HHAA 3I06A 3MTNA 4RY2A 2YJ2A 3WXEA 4DMYA 1KXRA 3HD3A 3KW9A 4PP1A 2R9OA 1FH0A 2DJGB 4MZOA 1NQCA 4XUIA 4QRXA 3RVVA 3RVXA 1CPJA 3V6EA 4G54A 1PE6A 4AXLA 3K9MA 2B1NA 1YT7A 1CSBB 1S4VA 3TNXA 1PBHA 3PDFA 3ERVA 1PPOA 1EF7A 2FT2A 2BSZA 1CQDA 3HHIA 4P6GA 3H8BA 4P6EA 3MORA 1PPNA 2DZZA 2AVWA 2VHSA 5CVNB 2GHUA 5JA7A 1QOLA 3KFQA 1F2CA 1CJLA 4YYUA 5PADA 1K3BB 1F29A 4OEMA 1A6RA 2E03A 5F02A 1YK8A 3K24A 2FTDA 3HWNA 3BPMA 2NQIA 2PREA 4YYWA 1NB5A 2ARYA 1EWPA 3D6SA 2ATOA 2E00A 3OVZA 2F1GA 2VHFA 2FUDA 2DZYA 2XU1A 2AUZA 1STFE 7PCKA 4NV7A 4PP2E 2OP3A 2CB5A 3IHPA 3MHSA 1THEA 1TL9A 1AU4A 2NQGA 4BGFA 1QXPA 1ITOA 1YVBA 1QDQA 1MEGA 3O0UA 2CIOA 4QRVA 3KKUA 2DCCA 3S3QA 1BQIA 1AYWA 5FPWA 3BPFA 3OISA 2HHNA 2NQAA 4PADA 1F2BA 2P86A 5EF4A 1KHPA 1IWDA 2NQDB 4HWYA 3N3GA 3USVA 3OVXA 1PIPA 3P5WA 4AXMA 4BS6A 2OULA 1W4TA 1PXVA 3AI8A 1CTEA 1KHQA 3RVWA 2YJ9A 4BQVA 1ZIVA 2PNSA 4C5PA 2IBIA 4KLBA 1HUCB 3E1ZB 2XU5A 3OF8A 1ME4A 3S3RA 1Y08A 1GLOA 4CDFB 1PPPA 4X6IA 2DCAA 3IUTA 1CS8A 1DF0A 2AUXA 9PAPA 5A24A 1MHWA 3O1GA 1U9WA 4FK5A 3IEJA 1TU6A 3OF9A 2O6XA 1MEMA 3KSEA 2FO5A 3H89A 4YVAA 2ACTA 2JQGR 3BOWA 1AYVA 2AS8A 2DCBA 3H6SA 2FRAA 1EWLA 3F75A 2C0YA 3NHEA 3K8UA 2E01A 2R6NA 1SP4B 3H7DA 4W4UA 4BPVA 5CVOB 3WXFA 1PCIA 2FYEA 2YJ8A 3IMAA 4ZUXU 3LFYA 1VSNA 4WA6A 1EWMA 2DC9A 2G8EA 4YYSA 4BS5A 4MZSA 4I05A 2VFCA 3V6CA 2Y5BA 2G7YA 3P5UA 4FIPA 4W5CA 4CZWA 4QH6A 2FQ9A 2AYNA 3CBJA 5J94A 8PCHA 4B55A 1BGOA 2PADA 1NLJA 2HD5A 1MIRA 3LXSA 3P5VA 1ME3A 2DJFB 1POPA 3U8EA 1BP4A 2E02A 4DMXA 1GMYA 3M99A 2DC7A 2BDZA 3H8CA 4BSQA 2DC6A 1TLOA 4NV8A 2YJCA 1MDWA 1AU3A 4I07A 1Y4HA 4I04A 1ATKA 2WBFX 1ICFA 3N4CA 1E2TA 2P0RA 4X6HA 2F7DA 2VFBA 4PI3A 2AIMA 2XU4A 2XU3A 6PADA 2OZ2A 2GFOA 1AYUA 3CBKA 5JH3A 2DC8A 2Y6EA 4Q8GA 4MSXA 4FJCA 1X9YA 3I3TA 1F2AA 4CDDB 1U9QX 4X6JA 5CHVA 3BWKA 1MS6A 4Q8HA 2R9FA 1SNKA 3D9WA 1CV8A 5K16A 4W5BA 4N4ZA 4OELA 3CH3X 2R9NA 2JQFR 4N79A 3BCNA 1YALA 1KFXL 1PPDA 3KWBX 1GECE 1VJVA 1CVZA 3CH2X 4K7CA 1AU2A 5EGWA 1QMYA 4XR7A 3IOQA 3QSDA 1PADA 2HXZA 1Q6KA 4CDEB 3PNRA 1XKGA 3DF0A 4GUZA 2H7JA 2PBHA 2R9MA 1DEUA 2B1MA 3BC3A 3WXGA 3PW3A 2IPPB 1U5IA 1O0EA 1GX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N8W A;  1U9V A;  1NB3 A;  3F5V A;  3B79 A;  4CDC B;  1AU0 A;  2AYO A;  3IV2 A;  2G8J A;  3KX1 A;  4YYR A;  1M6D A;  1NL6 A;  2R9C A;  3MHH A;  1AIM A;  2YJB A;  1GCB A;  1ZCM A;  2FRQ A;  3P5X A;  3ZUA A;  4YYV A;  3KWZ A;  4QBB A;  1CB5 A;  2HH5 A;  4YV8 A;  1NPZ A;  3GCB A;  3N3K A;  4QRG A;  1JQP A;  1AEC A;  1BY8 A;  1YK7 A;  5CVM A;  2BDL A;  1KFU L;  1EWO A;  5CHT A;  2P7U A;  3C9E A;  3PBH A;  3QT4 A;  1U9X A;  2AU1 A;  2DCD A;  2G6D A;  3QJ3 A;  4YYQ A;  3HHA A;  3I06 A;  3MTN A;  4RY2 A;  2YJ2 A;  3WXE A;  4DMY A;  1KXR A;  3HD3 A;  3KW9 A;  4PP1 A;  2R9O A;  1FH0 A;  2DJG B;  4MZO A;  1NQC A;  4XUI A;  4QRX A;  3RVV A;  3RVX A;  1CPJ A;  3V6E A;  4G54 A;  1PE6 A;  4AXL A;  3K9M A;  2B1N A;  1YT7 A;  1CSB B;  1S4V A;  3TNX A;  1PBH A;  3PDF A;  3ERV A;  1PPO A;  1EF7 A;  2FT2 A;  1CQD A;  3HHI A;  4P6G A;  3H8B A;  4P6E A;  3MOR A;  1PPN A;  2DZZ A;  2AVW A;  2VHS A;  5CVN B;  2GHU A;  5JA7 A;  1QOL A;  3KFQ A;  1F2C A;  1CJL A;  4YYU A;  5PAD A;  1K3B B;  1F29 A;  4OEM A;  1A6R A;  2E03 A;  5F02 A;  1YK8 A;  3K24 A;  2FTD A;  3HWN A;  3BPM A;  2NQI A;  2PRE A;  4YYW A;  1NB5 A;  2ARY A;  1EWP A;  3D6S A;  2ATO A;  2E00 A;  3OVZ A;  2F1G A;  2VHF A;  2FUD A;  2DZY A;  2XU1 A;  2AUZ A;  1STF E;  7PCK A;  4PP2 E;  2OP3 A;  2CB5 A;  3IHP A;  3MHS A;  1THE A;  1TL9 A;  1AU4 A;  2NQG A;  1QXP A;  1ITO A;  1YVB A;  1QDQ A;  1MEG A;  3O0U A;  2CIO A;  4QRV A;  3KKU A;  2DCC A;  3S3Q A;  1BQI A;  1AYW A;  5FPW A;  3BPF A;  3OIS A;  2HHN A;  2NQA A;  4PAD A;  1F2B A;  2P86 A;  5EF4 A;  1KHP A;  1IWD A;  2NQD B;  4HWY A;  3N3G A;  3USV A;  3OVX A;  1PIP A;  3P5W A;  4AXM A;  4BS6 A;  2OUL A;  1PXV A;  3AI8 A;  1CTE A;  1KHQ A;  3RVW A;  2YJ9 A;  4BQV A;  1ZIV A;  2PNS A;  2IBI A;  4KLB A;  1HUC B;  3E1Z B;  2XU5 A;  3OF8 A;  1ME4 A;  3S3R A;  1Y08 A;  1GLO A;  4CDF B;  1PPP A;  4X6I A;  2DCA A;  3IUT A;  1CS8 A;  1DF0 A;  2AUX A;  9PAP A;  5A24 A;  1MHW A;  3O1G A;  1U9W A;  4FK5 A;  3IEJ A;  1TU6 A;  3OF9 A;  2O6X A;  1MEM A;  3KSE A;  2FO5 A;  3H89 A;  4YVA A;  2ACT A;  2JQG R;  3BOW A;  1AYV A;  2AS8 A;  2DCB A;  3H6S A;  2FRA A;  1EWL A;  3F75 A;  2C0Y A;  3NHE A;  3K8U A;  2E01 A;  2R6N A;  1SP4 B;  3H7D A;  4W4U A;  4BPV A;  5CVO B;  3WXF A;  1PCI A;  2FYE A;  2YJ8 A;  3IMA A;  4ZUX U;  3LFY A;  1VSN A;  4WA6 A;  1EWM A;  2DC9 A;  2G8E A;  4YYS A;  4BS5 A;  4MZS A;  4I05 A;  3V6C A;  2Y5B A;  2G7Y A;  3P5U A;  4FIP A;  4W5C A;  4CZW A;  4QH6 A;  2FQ9 A;  2AYN A;  3CBJ A;  5J94 A;  8PCH A;  1BGO A;  2PAD A;  1NLJ A;  2HD5 A;  1MIR A;  3LXS A;  3P5V A;  1ME3 A;  2DJF B;  1POP A;  3U8E A;  1BP4 A;  2E02 A;  4DMX A;  1GMY A;  3M99 A;  2DC7 A;  2BDZ A;  3H8C A;  4BSQ A;  2DC6 A;  1TLO A;  2YJC A;  1MDW A;  1AU3 A;  4I07 A;  1Y4H A;  4I04 A;  1ATK A;  2WBF X;  1ICF A;  3N4C A;  2P0R A;  4X6H A;  2F7D A;  4PI3 A;  2AIM A;  2XU4 A;  2XU3 A;  6PAD A;  2OZ2 A;  2GFO A;  1AYU A;  3CBK A;  5JH3 A;  2DC8 A;  2Y6E A;  4Q8G A;  4MSX A;  4FJC A;  1X9Y A;  3I3T A;  1F2A A;  4CDD B;  1U9Q X;  4X6J A;  5CHV A;  3BWK A;  1MS6 A;  4Q8H A;  2R9F A;  1SNK A;  1CV8 A;  5K16 A;  4W5B A;  4N4Z A;  4OEL A;  3CH3 X;  2R9N A;  2JQF R;  4N79 A;  3BCN A;  1YAL A;  1KFX L;  1PPD A;  3KWB X;  1GEC E;  1VJV A;  1CVZ A;  3CH2 X;  4K7C A;  1AU2 A;  5EGW A;  1QMY A;  4XR7 A;  3IOQ A;  3QSD A;  1PAD A;  2HXZ A;  1Q6K A;  4CDE B;  3PNR A;  1XKG A;  3DF0 A;  2H7J A;  2PBH A;  2R9M A;  1DEU A;  2B1M A;  3BC3 A;  3WXG A;  3PW3 A;  2IPP B;  1U5I A;  1O0E A; 
#chains in the Genus database with same CATH topology
 4N8W A;  1U9V A;  1NB3 A;  3F5V A;  3B79 A;  3IFU A;  4CDC B;  1AU0 A;  4BOP A;  2AYO A;  3IV2 A;  2G8J A;  3KX1 A;  4YYR A;  1M6D A;  4RNA A;  1NL6 A;  2R9C A;  3B21 A;  3MHH A;  1AIM A;  2YJB A;  1GCB A;  4GUA A;  1ZCM A;  2FRQ A;  3P5X A;  3ZUA A;  4BOQ A;  4YYV A;  3KWZ A;  4IUM A;  2HWK A;  4QBB A;  1CB5 A;  2HH5 A;  3MP2 A;  4YV8 A;  1NPZ A;  3E9S A;  3GCB A;  3N3K A;  4QRG A;  4OVZ A;  1JQP A;  1AEC A;  4XZX A;  1BY8 A;  1YK7 A;  5CVM A;  2BDL A;  1KFU L;  1EWO A;  5CHT A;  2UZJ A;  2P7U A;  3C9E A;  3PBH A;  3QT4 A;  1U9X A;  2AU1 A;  2DCD A;  2G6D A;  3QJ3 A;  3PRP A;  4YYQ A;  3HHA A;  2JRI A;  3MTN A;  3I06 A;  4RY2 A;  2AGA A;  2YJ2 A;  3WXE A;  1PVJ A;  4DMY A;  1KXR A;  3HD3 A;  3KW9 A;  4PP1 A;  2R9O A;  1FH0 A;  2DJG B;  3PSE A;  4MZO A;  1NQC A;  4XUI A;  4HXD B;  4QRX A;  3RVV A;  3RVX A;  1CPJ A;  3V6E A;  3PHU A;  4G54 A;  1PE6 A;  4AXL A;  3K9M A;  2B1N A;  1YT7 A;  3PHX A;  1CSB B;  3RNV A;  1S4V A;  3TNX A;  3W30 A;  1PBH A;  3PDF A;  3ERV A;  1PPO A;  1EF7 A;  2FT2 A;  1CQD A;  3HHI A;  4P16 A;  2Z84 A;  3H8B A;  4P6G A;  4P6E A;  4RF1 A;  3MOR A;  1PPN A;  2DZZ A;  2AVW A;  2VHS A;  3C0R A;  5CVN B;  4OVZ B;  2GHU A;  5JA7 A;  1QOL A;  3KFQ A;  1F2C A;  1CJL A;  4YYU A;  1YZB A;  5PAD A;  1K3B B;  1F29 A;  4OEM A;  4RKX A;  1A6R A;  2E03 A;  5F02 A;  1YK8 A;  3K24 A;  2FTD A;  3HWN A;  3BPM A;  2NQI A;  1DKI A;  2PRE A;  4YYW A;  1NB5 A;  2ARY A;  5E6J A;  1EWP A;  3D6S A;  2ATO A;  2E00 A;  3OVZ A;  4IP3 A;  2F1G A;  2VHF A;  2FUD A;  2DZY A;  2XU1 A;  2AUZ A;  1STF E;  7PCK A;  4PP2 E;  2OP3 A;  4A5U A;  2CB5 A;  3IHP A;  3MHS A;  1THE A;  1TL9 A;  1AU4 A;  2NQG A;  1QXP A;  1ITO A;  1YVB A;  1QDQ A;  1MEG A;  3O0U A;  2CIO A;  4QRV A;  3KKU A;  2DCC A;  3S3Q A;  1BQI A;  3PHW A;  1AYW A;  5FPW A;  3BPF A;  3OIS A;  2HHN A;  2NQA A;  4PAD A;  1F2B A;  2P86 A;  3PRM A;  4BOU A;  5EF4 A;  1KHP A;  3OQC A;  1IWD A;  2J7Q A;  4PT5 A;  2NQD B;  4HWY A;  3BB7 A;  3N3G A;  3USV A;  3OVX A;  1PIP A;  3P5W A;  4AXM A;  4BS6 A;  2OUL A;  1PXV A;  3AI8 A;  1CTE A;  1KHQ A;  3RVW A;  2YJ9 A;  4BQV A;  1ZIV A;  2PNS A;  5KO3 A;  4MI7 A;  2IBI A;  4KLB A;  1HUC B;  4OW0 A;  3E1Z B;  2XU5 A;  3OF8 A;  1ME4 A;  3S3R A;  1Y08 A;  1GLO A;  4CDF B;  4D8B A;  5EZQ A;  1PPP A;  4X6I A;  2DCA A;  2BTW B;  3IUT A;  2J7Q C;  1CS8 A;  1DF0 A;  2AUX A;  9PAP A;  5A24 A;  1MHW A;  3O1G A;  1U9W A;  4FK5 A;  3O65 A;  4ZTB A;  3IEJ A;  1TU6 A;  3OF9 A;  2O6X A;  1MEM A;  3KSE A;  2FO5 A;  3H89 A;  4YVA A;  2ACT A;  2JQG R;  2DOS A;  3BOW A;  1AYV A;  2AS8 A;  2DCB A;  3H6S A;  4BOZ A;  2FRA A;  1EWL A;  3F75 A;  2C0Y A;  3NHE A;  3K8U A;  2E01 A;  2R6N A;  1SP4 B;  3H7D A;  4W4U A;  4BPV A;  5CVO B;  3WXF A;  1PCI A;  3PT2 A;  4BOS A;  2FYE A;  2YJ8 A;  3IMA A;  4ZUX U;  3LFY A;  1VSN A;  4WA6 A;  4MM3 B;  1EWM A;  2DC9 A;  2G8E A;  3TMP A;  4YYS A;  4BS5 A;  4MZS A;  4I05 A;  3V6C A;  2Y5B A;  2G7Y A;  2JTC A;  3P5U A;  4FIP A;  4W5C A;  3MJ5 A;  4CZW A;  4QH6 A;  2FQ9 A;  4REZ A;  2AYN A;  3CBJ A;  5J94 A;  8PCH A;  1BGO A;  2PAD A;  1NLJ A;  2HD5 A;  1MIR A;  3LXS A;  3P5V A;  1ME3 A;  2DJF B;  4R3D A;  4D8I A;  1POP A;  2BTW A;  1UKF A;  3U8E A;  1BP4 A;  2E02 A;  4DMX A;  1GMY A;  3M99 A;  2DC7 A;  3ZNH A;  2BDZ A;  3H8C A;  4BSQ A;  5JZE A;  2DC6 A;  1TLO A;  2YJC A;  1MDW A;  1AU3 A;  4I07 A;  1Y4H A;  3TRK A;  3MTV A;  1ATK A;  4I04 A;  2WBF X;  1ICF A;  3N4C A;  5EZS A;  2P0R A;  4X6H A;  2F7D A;  2BU3 A;  2AIM A;  4PI3 A;  2XU4 A;  2XU3 A;  6PAD A;  2OZ2 A;  2GFO A;  1AYU A;  3CBK A;  5JH3 A;  2DC8 A;  2Y6E A;  3W31 A;  4Q8G A;  4MSX A;  4FJC A;  1X9Y A;  3I3T A;  1F2A A;  4CDD B;  1U9Q X;  4X6J A;  5CHV A;  3BWK A;  1MS6 A;  4Q8H A;  2R9F A;  1SNK A;  1CV8 A;  4RF0 A;  5K16 A;  4W5B A;  4N4Z A;  4OEL A;  3CH3 X;  2R9N A;  2JQF R;  3BY4 A;  4N79 A;  3BBA A;  3BCN A;  1YAL A;  1KFX L;  1PPD A;  3KWB X;  1GEC E;  1VJV A;  1CVZ A;  3CH2 X;  4M0W A;  4WUR A;  2FE8 A;  4K7C A;  1AU2 A;  5EGW A;  1QMY A;  4XR7 A;  3IOQ A;  3QSD A;  1PAD A;  2HXZ A;  1Q6K A;  4CDE B;  4D8E A;  3PNR A;  1XKG A;  3DF0 A;  2H7J A;  2PBH A;  2R9M A;  1DEU A;  2B1M A;  3BC3 A;  3WXG A;  3PW3 A;  2IPP B;  1U5I A;  1O0E A; 
#chains in the Genus database with same CATH homology
 4N8W A;  1U9V A;  1NB3 A;  3F5V A;  3B79 A;  4CDC B;  1AU0 A;  2AYO A;  3IV2 A;  2G8J A;  3KX1 A;  4YYR A;  1M6D A;  1NL6 A;  2R9C A;  3MHH A;  1AIM A;  2YJB A;  1GCB A;  1ZCM A;  2FRQ A;  3P5X A;  3ZUA A;  4YYV A;  3KWZ A;  1W5R A;  3LTW A;  4QBB A;  1CB5 A;  2HH5 A;  4YV8 A;  1NPZ A;  3GCB A;  3N3K A;  4QRG A;  1JQP A;  1AEC A;  1BY8 A;  1YK7 A;  5CVM A;  1W6F A;  2BDL A;  1KFU L;  1EWO A;  5CHT A;  2P7U A;  3C9E A;  3PBH A;  3QT4 A;  1U9X A;  2AU1 A;  2DCD A;  2G6D A;  3QJ3 A;  4YYQ A;  3HHA A;  3I06 A;  3MTN A;  4RY2 A;  2YJ2 A;  3WXE A;  4DMY A;  1KXR A;  3HD3 A;  3KW9 A;  4PP1 A;  2R9O A;  1FH0 A;  2DJG B;  4MZO A;  1NQC A;  4XUI A;  4QRX A;  3RVV A;  3RVX A;  1CPJ A;  3V6E A;  4G54 A;  1PE6 A;  4AXL A;  3K9M A;  2B1N A;  1YT7 A;  1CSB B;  1S4V A;  3TNX A;  1PBH A;  3PDF A;  3ERV A;  1PPO A;  1EF7 A;  2FT2 A;  2BSZ A;  1CQD A;  3HHI A;  4P6G A;  3H8B A;  4P6E A;  3MOR A;  1PPN A;  2DZZ A;  2AVW A;  2VHS A;  5CVN B;  2GHU A;  5JA7 A;  1QOL A;  3KFQ A;  1F2C A;  1CJL A;  4YYU A;  5PAD A;  1K3B B;  1F29 A;  4OEM A;  1A6R A;  2E03 A;  5F02 A;  1YK8 A;  3K24 A;  2FTD A;  3HWN A;  3BPM A;  2NQI A;  2PRE A;  4YYW A;  1NB5 A;  2ARY A;  1EWP A;  3D6S A;  2ATO A;  2E00 A;  3OVZ A;  2F1G A;  2VHF A;  2FUD A;  2DZY A;  2XU1 A;  2AUZ A;  1STF E;  7PCK A;  4NV7 A;  4PP2 E;  2OP3 A;  2CB5 A;  3IHP A;  3MHS A;  1THE A;  1TL9 A;  1AU4 A;  2NQG A;  4BGF A;  1QXP A;  1ITO A;  1YVB A;  1QDQ A;  1MEG A;  3O0U A;  2CIO A;  4QRV A;  3KKU A;  2DCC A;  3S3Q A;  1BQI A;  1AYW A;  5FPW A;  3BPF A;  3OIS A;  2HHN A;  2NQA A;  4PAD A;  1F2B A;  2P86 A;  5EF4 A;  1KHP A;  1IWD A;  2NQD B;  4HWY A;  3N3G A;  3USV A;  3OVX A;  1PIP A;  3P5W A;  4AXM A;  4BS6 A;  2OUL A;  1W4T A;  1PXV A;  3AI8 A;  1CTE A;  1KHQ A;  3RVW A;  2YJ9 A;  4BQV A;  1ZIV A;  2PNS A;  4C5P A;  2IBI A;  4KLB A;  1HUC B;  3E1Z B;  2XU5 A;  3OF8 A;  1ME4 A;  3S3R A;  1Y08 A;  1GLO A;  4CDF B;  1PPP A;  4X6I A;  2DCA A;  3IUT A;  1CS8 A;  1DF0 A;  2AUX A;  9PAP A;  5A24 A;  1MHW A;  3O1G A;  1U9W A;  4FK5 A;  3IEJ A;  1TU6 A;  3OF9 A;  2O6X A;  1MEM A;  3KSE A;  2FO5 A;  3H89 A;  4YVA A;  2ACT A;  2JQG R;  3BOW A;  1AYV A;  2AS8 A;  2DCB A;  3H6S A;  2FRA A;  1EWL A;  3F75 A;  2C0Y A;  3NHE A;  3K8U A;  2E01 A;  2R6N A;  1SP4 B;  3H7D A;  4W4U A;  4BPV A;  5CVO B;  3WXF A;  1PCI A;  2FYE A;  2YJ8 A;  3IMA A;  4ZUX U;  3LFY A;  1VSN A;  4WA6 A;  1EWM A;  2DC9 A;  2G8E A;  4YYS A;  4BS5 A;  4MZS A;  4I05 A;  2VFC A;  3V6C A;  2Y5B A;  2G7Y A;  3P5U A;  4FIP A;  4W5C A;  4CZW A;  4QH6 A;  2FQ9 A;  2AYN A;  3CBJ A;  5J94 A;  8PCH A;  4B55 A;  1BGO A;  2PAD A;  1NLJ A;  2HD5 A;  1MIR A;  3LXS A;  3P5V A;  1ME3 A;  2DJF B;  1POP A;  3U8E A;  1BP4 A;  2E02 A;  4DMX A;  1GMY A;  3M99 A;  2DC7 A;  2BDZ A;  3H8C A;  4BSQ A;  2DC6 A;  1TLO A;  4NV8 A;  2YJC A;  1MDW A;  1AU3 A;  4I07 A;  1Y4H A;  4I04 A;  1ATK A;  2WBF X;  1ICF A;  3N4C A;  1E2T A;  2P0R A;  4X6H A;  2F7D A;  2VFB A;  4PI3 A;  2AIM A;  2XU4 A;  2XU3 A;  6PAD A;  2OZ2 A;  2GFO A;  1AYU A;  3CBK A;  5JH3 A;  2DC8 A;  2Y6E A;  4Q8G A;  4MSX A;  4FJC A;  1X9Y A;  3I3T A;  1F2A A;  4CDD B;  1U9Q X;  4X6J A;  5CHV A;  3BWK A;  1MS6 A;  4Q8H A;  2R9F A;  1SNK A;  3D9W A;  1CV8 A;  5K16 A;  4W5B A;  4N4Z A;  4OEL A;  3CH3 X;  2R9N A;  2JQF R;  4N79 A;  3BCN A;  1YAL A;  1KFX L;  1PPD A;  3KWB X;  1GEC E;  1VJV A;  1CVZ A;  3CH2 X;  4K7C A;  1AU2 A;  5EGW A;  1QMY A;  4XR7 A;  3IOQ A;  3QSD A;  1PAD A;  2HXZ A;  1Q6K A;  4CDE B;  3PNR A;  1XKG A;  3DF0 A;  4GUZ A;  2H7J A;  2PBH A;  2R9M A;  1DEU A;  2B1M A;  3BC3 A;  3WXG A;  3PW3 A;  2IPP B;  1U5I A;  1O0E A;  1GX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...