1MIRA

Rat procathepsin b
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
313
structure length
313
Chain Sequence
SDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSSWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCATHEPSIN B
publication title Structure of rat procathepsin B: model for inhibition of cysteine protease activity by the proregion.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 61
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1996-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1mirA00
3H6SA 1NQCA 3P5VA 1ICFA 1YK7A 3IMAA 2B1NA 1O0EA 2Y6EA 4Q8HA 1PXVA 5A24A 4YYUA 2R9NA 1PADA 4CDDB 2FO5A 1F2AA 3LFYA 2DCDA 3D6SA 3S3QA 3PBHA 1HUCB 2G8EA 3N3KA 3O0UA 1DEUA 4CDCB 2FTDA 1KHPA 3DF0A 2FYEA 2AYOA 1EWLA 1PPDA 1NLJA 1THEA 3RVXA 1ITOA 4K7CA 3HD3A 3BOWA 3NHEA 3QSDA 1GECE 4YYRA 3K24A 1MDWA 2AYNA 1YT7A 2WBFX 1BQIA 1AYWA 6PADA 2HH5A 3IOQA 3WXEA 3AI8A 2YJ2A 2G8JA 5EGWA 2BDZA 4HWYA 1TL9A 1K3BB 4W4UA 2XU1A 2PBHA 3H89A 2CIOA 4N4ZA 1BY8A 4FK5A 3OF9A 3P5WA 5JA7A 4XR7A 3S3RA 3V6CA 1MEGA 5CHTA 3QJ3A 1U9VA 1MEMA 1PCIA 5CVNB 2DZYA 1QXPA 1AIMA 3KSEA 1SP4B 1PPNA 2E02A 2YJ8A 1PPPA 1CTEA 4Q8GA 2GHUA 2DC7A 2E01A 2XU5A 1QMYA 3KWZA 1NL6A 4QH6A 1CQDA 1AU4A 3KW9A 1MIRA 1KFUL 5EF4A 2VHFA 2P0RA 2DCCA 3F5VA 2PREA 3K8UA 4KLBA 1CJLA 1DF0A 3I06A 1M6DA 5CVOB 3IUTA 2CB5A 4G54A 1MS6A 1STFE 4P6GA 2DJGB 2VHSA 2P7UA 3KX1A 3MHSA 2JQGR 3N4CA 2AVWA 3MTNA 4YYQA 2NQDB 1ME4A 2PADA 4YYWA 3HWNA 1MHWA 3ERVA 1ATKA 2C0YA 2AUZA 3LXSA 3OISA 3F75A 3H7DA 5CHVA 1EF7A 4BPVA 3OVZA 2F1GA 1U9XA 1VJVA 4BS5A 1JQPA 3P5XA 3USVA 1XKGA 1AECA 4N79A 4X6HA 3OF8A 3P5UA 3MHHA 4PADA 1QDQA 1IWDA 4CZWA 2AS8A 2XU3A 4I04A 3IHPA 2XU4A 5CVMA 4QBBA 1F2BA 1U9QX 3CBKA 4N8WA 4ZUXU 4BS6A 1SNKA 4I05A 1CV8A 2DCAA 5FPWA 1KFXL 5PADA 1PBHA 1CVZA 2G7YA 3RVVA 3B79A 4BQVA 4RY2A 8PCHA 2FT2A 3OVXA 4W5BA 3WXFA 2GFOA 1QOLA 3V6EA 3GCBA 2ACTA 2BDLA 2DCBA 2YJ9A 3TNXA 5JH3A 3K9MA 3IEJA 4QRGA 4CDFB 3KWBX 1AU3A 1TLOA 1AYVA 3ZUAA 4MZOA 2FQ9A 3BWKA 5J94A 2Y5BA 4OEMA 2B1MA 4FJCA 2FRQA 3O1GA 1EWOA 2AU1A 1YALA 2NQIA 2AIMA 1TU6A 1Q6KA 4OELA 3HHAA 3I3TA 1PIPA 5K16A 2IBIA 2R9OA 4YVAA 1VSNA 2ATOA 2H7JA 2DZZA 1GCBA 3CBJA 1POPA 3RVWA 2JQFR 3U8EA 4I07A 2F7DA 4XUIA 3CH3X 2R6NA 3MORA 4QRVA 1F2CA 5F02A 2OULA 4PI3A 2R9CA 1ZCMA 3BPFA 1FH0A 1AYUA 1GLOA 4CDEB 3N3GA 2E03A 4MZSA 1X9YA 1EWMA 3PDFA 1Y08A 4PP2E 2DC9A 4AXMA 3CH2X 1BP4A 4W5CA 2OZ2A 3BPMA 4BSQA 3KKUA 2YJCA 3WXGA 1PE6A 4X6JA 2OP3A 1GMYA 3PNRA 3BCNA 1BGOA 1KHQA 2HD5A 3M99A 1NPZA 1CSBB 1EWPA 2R9FA 2DC8A 2AUXA 1ZIVA 1PPOA 1F29A 3BC3A 3E1ZB 4PP1A 4AXLA 1S4VA 3H8BA 1U5IA 2O6XA 4QRXA 2G6DA 2NQAA 3QT4A 2E00A 4X6IA 2DC6A 3PW3A 1NB5A 1AU2A 3IV2A 1CPJA 3C9EA 1YVBA 2HXZA 4MSXA 3KFQA 2FRAA 4YYVA 2HHNA 1AU0A 2P86A 1CB5A 1CS8A 1YK8A 4DMYA 2DJFB 1U9WA 2FUDA 3HHIA 1ME3A 2PNSA 1NB3A 2R9MA 4P6EA 1Y4HA 4YV8A 2IPPB 4YYSA 4DMXA 9PAPA 7PCKA 1A6RA 4FIPA 2ARYA 1KXRA 2NQGA 2YJBA 4WA6A 3H8CA
chains in the Genus database with same CATH superfamily
3ZNHA 3H6SA 1NQCA 3P5VA 1ICFA 4A5UA 1YK7A 3IMAA 2B1NA 1O0EA 2Y6EA 4Q8HA 1PXVA 5A24A 3B21A 4YYUA 3W31A 4BOZA 2R9NA 1PADA 4CDDB 2FO5A 3PHXA 3TMPA 1F2AA 3OQCA 3LFYA 2DCDA 3D6SA 3S3QA 3PBHA 1HUCB 2G8EA 2BTWA 3N3KA 3O0UA 1DEUA 4CDCB 2FTDA 1KHPA 3DF0A 2FYEA 2AYOA 1EWLA 1PPDA 1NLJA 1THEA 3RVXA 3PSEA 1ITOA 3HD3A 4K7CA 3BOWA 3NHEA 3QSDA 1GECE 4BOPA 4YYRA 3K24A 1MDWA 2AYNA 1YT7A 2WBFX 2DOSA 1BQIA 5E6JA 1AYWA 6PADA 2HH5A 3IOQA 3MJ5A 3WXEA 3AI8A 2YJ2A 4PT5A 2G8JA 5EGWA 2BDZA 4HWYA 1TL9A 4D8EA 4HXDB 1K3BB 4W4UA 2XU1A 4OVZA 2PBHA 3H89A 2Z84A 2CIOA 4N4ZA 1BY8A 4FK5A 3OF9A 3P5WA 5JA7A 4XR7A 3S3RA 3V6CA 1MEGA 5CHTA 3QJ3A 3TRKA 1U9VA 1MEMA 4IP3A 1PCIA 5CVNB 2DZYA 1QXPA 1AIMA 3KSEA 1SP4B 1PPNA 2E02A 2YJ8A 1PPPA 4IUMA 2FE8A 1CTEA 2J7QA 4Q8GA 2GHUA 2DC7A 2E01A 3PRPA 2XU5A 1QMYA 3KWZA 1NL6A 4D8BA 3PHUA 4QH6A 1CQDA 1AU4A 3KW9A 1MIRA 1KFUL 5EF4A 3PT2A 2VHFA 2P0RA 2DCCA 2JTCA 4RF1A 4M0WA 2JRIA 3F5VA 2PREA 3K8UA 4WURA 4KLBA 1CJLA 1DF0A 3I06A 1M6DA 5CVOB 3IUTA 2CB5A 4G54A 1MS6A 1STFE 4P6GA 5JZEA 2DJGB 2BU3A 2VHSA 4RNAA 2P7UA 3KX1A 3MHSA 2JQGR 3BY4A 3N4CA 2AVWA 3MTNA 3MTVA 4YYQA 2NQDB 1ME4A 2PADA 4RF0A 3RNVA 4YYWA 3HWNA 1MHWA 3ERVA 1ATKA 2C0YA 2AUZA 3LXSA 3OISA 3F75A 3H7DA 5CHVA 1EF7A 4BPVA 3OVZA 2F1GA 1U9XA 1VJVA 4BS5A 1JQPA 3P5XA 3USVA 1XKGA 1AECA 4MM3B 4N79A 4X6HA 4REZA 3OF8A 3P5UA 3PHWA 3MHHA 4PADA 1QDQA 1IWDA 3E9SA 4CZWA 2AS8A 2XU3A 4BOUA 4I04A 3IHPA 2XU4A 5CVMA 4QBBA 1F2BA 1U9QX 3CBKA 4N8WA 2J7QC 4ZUXU 4BS6A 1SNKA 4I05A 1CV8A 2AGAA 2DCAA 1KFXL 5FPWA 5PADA 1PBHA 1CVZA 2G7YA 3RVVA 3B79A 4BQVA 4RY2A 8PCHA 2FT2A 3OVXA 4W5BA 3WXFA 2GFOA 1QOLA 3V6EA 4R3DA 2UZJA 5EZQA 3GCBA 2ACTA 2BDLA 2DCBA 2YJ9A 3TNXA 5JH3A 3K9MA 3IEJA 4QRGA 4CDFB 4P16A 3O65A 3KWBX 1AU3A 1TLOA 1AYVA 3ZUAA 4MZOA 2FQ9A 3BWKA 5J94A 2Y5BA 4OEMA 4ZTBA 3BB7A 2B1MA 4FJCA 2FRQA 1UKFA 3O1GA 1EWOA 2AU1A 1YALA 2NQIA 2AIMA 1TU6A 1Q6KA 4OELA 3HHAA 3I3TA 1PIPA 5K16A 3C0RA 2IBIA 2R9OA 4YVAA 1VSNA 3MP2A 2ATOA 2H7JA 2DZZA 1GCBA 3CBJA 1POPA 3IFUA 3RVWA 2JQFR 3U8EA 4I07A 2F7DA 4XUIA 3CH3X 2R6NA 3MORA 4QRVA 1F2CA 5F02A 2OULA 4PI3A 2R9CA 1ZCMA 3BPFA 1FH0A 1AYUA 1GLOA 4CDEB 3N3GA 3W30A 2BTWB 2E03A 4MZSA 1X9YA 1EWMA 3PDFA 1Y08A 4PP2E 2DC9A 4AXMA 3CH2X 1BP4A 4OW0A 4W5CA 2OZ2A 5EZSA 3BPMA 4BOSA 4BSQA 3KKUA 2YJCA 3WXGA 1PE6A 4X6JA 2OP3A 1GMYA 3PNRA 3BBAA 3BCNA 1BGOA 1KHQA 2HD5A 3M99A 1NPZA 1CSBB 1EWPA 2R9FA 2DC8A 2AUXA 1ZIVA 1PPOA 4D8IA 1F29A 3BC3A 3E1ZB 4PP1A 4AXLA 1S4VA 3H8BA 4OVZB 1U5IA 2O6XA 2NQAA 2G6DA 4QRXA 3QT4A 2E00A 3PRMA 4X6IA 2DC6A 3PW3A 1NB5A 4XZXA 1AU2A 3IV2A 1YZBA 1CPJA 3C9EA 1YVBA 2HXZA 4MSXA 3KFQA 2FRAA 4YYVA 2HHNA 1AU0A 2P86A 1CB5A 1CS8A 1YK8A 4DMYA 5KO3A 2DJFB 1U9WA 2FUDA 3HHIA 1ME3A 2PNSA 1NB3A 2R9MA 1DKIA 4P6EA 1Y4HA 4RKXA 4YV8A 2IPPB 4YYSA 4DMXA 4BOQA 4MI7A 9PAPA 7PCKA 4GUAA 1A6RA 4FIPA 2ARYA 1PVJA 1KXRA 2NQGA 2YJBA 2HWKA 3H8CA 4WA6A
chains in the Genus database with same CATH topology
3H6SA 1NQCA 3P5VA 1ICFA 1YK7A 3IMAA 2B1NA 1O0EA 2Y6EA 4Q8HA 1PXVA 5A24A 1E2TA 4YYUA 2R9NA 1PADA 4CDDB 2FO5A 1GX3A 1F2AA 3LFYA 2DCDA 3D6SA 3S3QA 3PBHA 1HUCB 2G8EA 3N3KA 3O0UA 1DEUA 4CDCB 2FTDA 1KHPA 3DF0A 4B55A 2FYEA 2AYOA 1EWLA 1PPDA 1NLJA 1THEA 3RVXA 1ITOA 4K7CA 3HD3A 3BOWA 3NHEA 3QSDA 1GECE 4YYRA 3K24A 1MDWA 2AYNA 1YT7A 2WBFX 3LTWA 1BQIA 1AYWA 6PADA 2HH5A 3IOQA 3WXEA 3AI8A 2YJ2A 2G8JA 5EGWA 2BDZA 4HWYA 1TL9A 1K3BB 4W4UA 2XU1A 2PBHA 3H89A 2CIOA 4N4ZA 1BY8A 4FK5A 3OF9A 3P5WA 5JA7A 4XR7A 3S3RA 3V6CA 1MEGA 5CHTA 3QJ3A 1U9VA 1MEMA 1PCIA 5CVNB 2DZYA 1QXPA 1AIMA 3KSEA 1SP4B 1PPNA 2E02A 2YJ8A 1PPPA 1CTEA 4Q8GA 2GHUA 2DC7A 2E01A 2XU5A 1QMYA 3KWZA 1NL6A 4QH6A 1CQDA 1W4TA 1AU4A 3KW9A 1MIRA 1KFUL 5EF4A 2VHFA 2P0RA 2DCCA 3F5VA 2PREA 3K8UA 2BSZA 4KLBA 1CJLA 1DF0A 3I06A 1M6DA 5CVOB 3IUTA 2CB5A 4G54A 1MS6A 1STFE 4P6GA 2DJGB 2VHSA 2P7UA 4NV8A 3KX1A 3MHSA 2JQGR 3N4CA 2AVWA 3MTNA 4YYQA 2NQDB 1ME4A 2PADA 4NV7A 4YYWA 3HWNA 1MHWA 3ERVA 1ATKA 2C0YA 2AUZA 3LXSA 3OISA 3F75A 3H7DA 5CHVA 1EF7A 4BPVA 3OVZA 2F1GA 1U9XA 1VJVA 4BS5A 1JQPA 3P5XA 3USVA 1XKGA 1AECA 4N79A 4X6HA 3OF8A 3P5UA 3MHHA 4PADA 1QDQA 1IWDA 4CZWA 2AS8A 2XU3A 4I04A 3IHPA 2XU4A 5CVMA 4QBBA 1F2BA 1U9QX 3CBKA 4N8WA 4ZUXU 4BS6A 1SNKA 4I05A 1CV8A 2DCAA 5FPWA 1KFXL 5PADA 1PBHA 1CVZA 2G7YA 3RVVA 3B79A 4BQVA 4RY2A 8PCHA 2FT2A 3OVXA 4W5BA 3WXFA 2GFOA 1QOLA 3V6EA 3GCBA 2ACTA 2BDLA 2DCBA 2YJ9A 3TNXA 5JH3A 3K9MA 3IEJA 4QRGA 4CDFB 3KWBX 1AU3A 1TLOA 1AYVA 3ZUAA 4MZOA 2FQ9A 3BWKA 5J94A 2Y5BA 4OEMA 2B1MA 4FJCA 2FRQA 3O1GA 1EWOA 2AU1A 1YALA 4BGFA 1W5RA 2NQIA 2AIMA 1TU6A 1Q6KA 4OELA 3HHAA 3I3TA 1PIPA 5K16A 2IBIA 2R9OA 4YVAA 1VSNA 2ATOA 2H7JA 2DZZA 1GCBA 3CBJA 1POPA 2VFBA 3RVWA 2JQFR 3U8EA 4I07A 2F7DA 4XUIA 3CH3X 2R6NA 3D9WA 3MORA 4QRVA 1F2CA 5F02A 2OULA 4PI3A 2R9CA 1ZCMA 3BPFA 1FH0A 1AYUA 1GLOA 4CDEB 3N3GA 2E03A 4MZSA 1X9YA 1EWMA 3PDFA 1Y08A 4PP2E 2DC9A 4AXMA 3CH2X 1BP4A 4W5CA 4GUZA 2OZ2A 3BPMA 4BSQA 3KKUA 2YJCA 3WXGA 1PE6A 4X6JA 2OP3A 4C5PA 1GMYA 3PNRA 3BCNA 1BGOA 1KHQA 2HD5A 3M99A 1NPZA 1CSBB 1EWPA 2R9FA 2DC8A 2AUXA 1ZIVA 1PPOA 1F29A 3BC3A 3E1ZB 4PP1A 4AXLA 1S4VA 3H8BA 1U5IA 2O6XA 2NQAA 2G6DA 4QRXA 3QT4A 2E00A 4X6IA 2DC6A 3PW3A 1NB5A 1AU2A 3IV2A 1CPJA 2VFCA 3C9EA 1YVBA 2HXZA 4MSXA 3KFQA 2FRAA 4YYVA 2HHNA 1AU0A 2P86A 1CB5A 1CS8A 1YK8A 4DMYA 2DJFB 1U9WA 2FUDA 3HHIA 1ME3A 2PNSA 1NB3A 2R9MA 4P6EA 1Y4HA 4YV8A 1W6FA 2IPPB 4YYSA 4DMXA 9PAPA 7PCKA 1A6RA 4FIPA 2ARYA 1KXRA 2NQGA 2YJBA 4WA6A 3H8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6S A;  1NQC A;  3P5V A;  1ICF A;  1YK7 A;  3IMA A;  2B1N A;  1O0E A;  2Y6E A;  4Q8H A;  1PXV A;  5A24 A;  4YYU A;  2R9N A;  1PAD A;  4CDD B;  2FO5 A;  1F2A A;  3LFY A;  2DCD A;  3D6S A;  3S3Q A;  3PBH A;  1HUC B;  2G8E A;  3N3K A;  3O0U A;  1DEU A;  4CDC B;  2FTD A;  1KHP A;  3DF0 A;  2FYE A;  2AYO A;  1EWL A;  1PPD A;  1NLJ A;  1THE A;  3RVX A;  1ITO A;  4K7C A;  3HD3 A;  3BOW A;  3NHE A;  3QSD A;  1GEC E;  4YYR A;  3K24 A;  1MDW A;  2AYN A;  1YT7 A;  2WBF X;  1BQI A;  1AYW A;  6PAD A;  2HH5 A;  3IOQ A;  3WXE A;  3AI8 A;  2YJ2 A;  2G8J A;  5EGW A;  2BDZ A;  4HWY A;  1TL9 A;  1K3B B;  4W4U A;  2XU1 A;  2PBH A;  3H89 A;  2CIO A;  4N4Z A;  1BY8 A;  4FK5 A;  3OF9 A;  3P5W A;  5JA7 A;  4XR7 A;  3S3R A;  3V6C A;  1MEG A;  5CHT A;  3QJ3 A;  1U9V A;  1MEM A;  1PCI A;  5CVN B;  2DZY A;  1QXP A;  1AIM A;  3KSE A;  1SP4 B;  1PPN A;  2E02 A;  2YJ8 A;  1PPP A;  1CTE A;  4Q8G A;  2GHU A;  2DC7 A;  2E01 A;  2XU5 A;  1QMY A;  3KWZ A;  1NL6 A;  4QH6 A;  1CQD A;  1AU4 A;  3KW9 A;  1MIR A;  1KFU L;  5EF4 A;  2VHF A;  2P0R A;  2DCC A;  3F5V A;  2PRE A;  3K8U A;  4KLB A;  1CJL A;  1DF0 A;  3I06 A;  1M6D A;  5CVO B;  3IUT A;  2CB5 A;  4G54 A;  1MS6 A;  1STF E;  4P6G A;  2DJG B;  2VHS A;  2P7U A;  3KX1 A;  3MHS A;  2JQG R;  3N4C A;  2AVW A;  3MTN A;  4YYQ A;  2NQD B;  1ME4 A;  2PAD A;  4YYW A;  3HWN A;  1MHW A;  3ERV A;  1ATK A;  2C0Y A;  2AUZ A;  3LXS A;  3OIS A;  3F75 A;  3H7D A;  5CHV A;  1EF7 A;  4BPV A;  3OVZ A;  2F1G A;  1U9X A;  1VJV A;  4BS5 A;  1JQP A;  3P5X A;  3USV A;  1XKG A;  1AEC A;  4N79 A;  4X6H A;  3OF8 A;  3P5U A;  3MHH A;  4PAD A;  1QDQ A;  1IWD A;  4CZW A;  2AS8 A;  2XU3 A;  4I04 A;  3IHP A;  2XU4 A;  5CVM A;  4QBB A;  1F2B A;  1U9Q X;  3CBK A;  4N8W A;  4ZUX U;  4BS6 A;  1SNK A;  4I05 A;  1CV8 A;  2DCA A;  5FPW A;  1KFX L;  5PAD A;  1PBH A;  1CVZ A;  2G7Y A;  3RVV A;  3B79 A;  4BQV A;  4RY2 A;  8PCH A;  2FT2 A;  3OVX A;  4W5B A;  3WXF A;  2GFO A;  1QOL A;  3V6E A;  3GCB A;  2ACT A;  2BDL A;  2DCB A;  2YJ9 A;  3TNX A;  5JH3 A;  3K9M A;  3IEJ A;  4QRG A;  4CDF B;  3KWB X;  1AU3 A;  1TLO A;  1AYV A;  3ZUA A;  4MZO A;  2FQ9 A;  3BWK A;  5J94 A;  2Y5B A;  4OEM A;  2B1M A;  4FJC A;  2FRQ A;  3O1G A;  1EWO A;  2AU1 A;  1YAL A;  2NQI A;  2AIM A;  1TU6 A;  1Q6K A;  4OEL A;  3HHA A;  3I3T A;  1PIP A;  5K16 A;  2IBI A;  2R9O A;  4YVA A;  1VSN A;  2ATO A;  2H7J A;  2DZZ A;  1GCB A;  3CBJ A;  1POP A;  3RVW A;  2JQF R;  3U8E A;  4I07 A;  2F7D A;  4XUI A;  3CH3 X;  2R6N A;  3MOR A;  4QRV A;  1F2C A;  5F02 A;  2OUL A;  4PI3 A;  2R9C A;  1ZCM A;  3BPF A;  1FH0 A;  1AYU A;  1GLO A;  4CDE B;  3N3G A;  2E03 A;  4MZS A;  1X9Y A;  1EWM A;  3PDF A;  1Y08 A;  4PP2 E;  2DC9 A;  4AXM A;  3CH2 X;  1BP4 A;  4W5C A;  2OZ2 A;  3BPM A;  4BSQ A;  3KKU A;  2YJC A;  3WXG A;  1PE6 A;  4X6J A;  2OP3 A;  1GMY A;  3PNR A;  3BCN A;  1BGO A;  1KHQ A;  2HD5 A;  3M99 A;  1NPZ A;  1CSB B;  1EWP A;  2R9F A;  2DC8 A;  2AUX A;  1ZIV A;  1PPO A;  1F29 A;  3BC3 A;  3E1Z B;  4PP1 A;  4AXL A;  1S4V A;  3H8B A;  1U5I A;  2O6X A;  4QRX A;  2G6D A;  2NQA A;  3QT4 A;  2E00 A;  4X6I A;  2DC6 A;  3PW3 A;  1NB5 A;  1AU2 A;  3IV2 A;  1CPJ A;  3C9E A;  1YVB A;  2HXZ A;  4MSX A;  3KFQ A;  2FRA A;  4YYV A;  2HHN A;  1AU0 A;  2P86 A;  1CB5 A;  1CS8 A;  1YK8 A;  4DMY A;  2DJF B;  1U9W A;  2FUD A;  3HHI A;  1ME3 A;  2PNS A;  1NB3 A;  2R9M A;  4P6E A;  1Y4H A;  4YV8 A;  2IPP B;  4YYS A;  4DMX A;  9PAP A;  7PCK A;  1A6R A;  4FIP A;  2ARY A;  1KXR A;  2NQG A;  2YJB A;  4WA6 A;  3H8C A; 
#chains in the Genus database with same CATH topology
 3ZNH A;  3H6S A;  1NQC A;  3P5V A;  1ICF A;  4A5U A;  1YK7 A;  3IMA A;  2B1N A;  1O0E A;  2Y6E A;  4Q8H A;  1PXV A;  5A24 A;  3B21 A;  4YYU A;  3W31 A;  4BOZ A;  2R9N A;  1PAD A;  4CDD B;  2FO5 A;  3PHX A;  3TMP A;  1F2A A;  3OQC A;  3LFY A;  2DCD A;  3D6S A;  3S3Q A;  3PBH A;  1HUC B;  2G8E A;  2BTW A;  3N3K A;  3O0U A;  1DEU A;  4CDC B;  2FTD A;  1KHP A;  3DF0 A;  2FYE A;  2AYO A;  1EWL A;  1PPD A;  1NLJ A;  1THE A;  3RVX A;  3PSE A;  1ITO A;  3HD3 A;  4K7C A;  3BOW A;  3NHE A;  3QSD A;  1GEC E;  4BOP A;  4YYR A;  3K24 A;  1MDW A;  2AYN A;  1YT7 A;  2WBF X;  2DOS A;  1BQI A;  5E6J A;  1AYW A;  6PAD A;  2HH5 A;  3IOQ A;  3MJ5 A;  3WXE A;  3AI8 A;  2YJ2 A;  4PT5 A;  2G8J A;  5EGW A;  2BDZ A;  4HWY A;  1TL9 A;  4D8E A;  4HXD B;  1K3B B;  4W4U A;  2XU1 A;  4OVZ A;  2PBH A;  3H89 A;  2Z84 A;  2CIO A;  4N4Z A;  1BY8 A;  4FK5 A;  3OF9 A;  3P5W A;  5JA7 A;  4XR7 A;  3S3R A;  3V6C A;  1MEG A;  5CHT A;  3QJ3 A;  3TRK A;  1U9V A;  1MEM A;  4IP3 A;  1PCI A;  5CVN B;  2DZY A;  1QXP A;  1AIM A;  3KSE A;  1SP4 B;  1PPN A;  2E02 A;  2YJ8 A;  1PPP A;  4IUM A;  2FE8 A;  1CTE A;  2J7Q A;  4Q8G A;  2GHU A;  2DC7 A;  2E01 A;  3PRP A;  2XU5 A;  1QMY A;  3KWZ A;  1NL6 A;  4D8B A;  3PHU A;  4QH6 A;  1CQD A;  1AU4 A;  3KW9 A;  1MIR A;  1KFU L;  5EF4 A;  3PT2 A;  2VHF A;  2P0R A;  2DCC A;  2JTC A;  4RF1 A;  4M0W A;  2JRI A;  3F5V A;  2PRE A;  3K8U A;  4WUR A;  4KLB A;  1CJL A;  1DF0 A;  3I06 A;  1M6D A;  5CVO B;  3IUT A;  2CB5 A;  4G54 A;  1MS6 A;  1STF E;  4P6G A;  5JZE A;  2DJG B;  2BU3 A;  2VHS A;  4RNA A;  2P7U A;  3KX1 A;  3MHS A;  2JQG R;  3BY4 A;  3N4C A;  2AVW A;  3MTN A;  3MTV A;  4YYQ A;  2NQD B;  1ME4 A;  2PAD A;  4RF0 A;  3RNV A;  4YYW A;  3HWN A;  1MHW A;  3ERV A;  1ATK A;  2C0Y A;  2AUZ A;  3LXS A;  3OIS A;  3F75 A;  3H7D A;  5CHV A;  1EF7 A;  4BPV A;  3OVZ A;  2F1G A;  1U9X A;  1VJV A;  4BS5 A;  1JQP A;  3P5X A;  3USV A;  1XKG A;  1AEC A;  4MM3 B;  4N79 A;  4X6H A;  4REZ A;  3OF8 A;  3P5U A;  3PHW A;  3MHH A;  4PAD A;  1QDQ A;  1IWD A;  3E9S A;  4CZW A;  2AS8 A;  2XU3 A;  4BOU A;  4I04 A;  3IHP A;  2XU4 A;  5CVM A;  4QBB A;  1F2B A;  1U9Q X;  3CBK A;  4N8W A;  2J7Q C;  4ZUX U;  4BS6 A;  1SNK A;  4I05 A;  1CV8 A;  2AGA A;  2DCA A;  1KFX L;  5FPW A;  5PAD A;  1PBH A;  1CVZ A;  2G7Y A;  3RVV A;  3B79 A;  4BQV A;  4RY2 A;  8PCH A;  2FT2 A;  3OVX A;  4W5B A;  3WXF A;  2GFO A;  1QOL A;  3V6E A;  4R3D A;  2UZJ A;  5EZQ A;  3GCB A;  2ACT A;  2BDL A;  2DCB A;  2YJ9 A;  3TNX A;  5JH3 A;  3K9M A;  3IEJ A;  4QRG A;  4CDF B;  4P16 A;  3O65 A;  3KWB X;  1AU3 A;  1TLO A;  1AYV A;  3ZUA A;  4MZO A;  2FQ9 A;  3BWK A;  5J94 A;  2Y5B A;  4OEM A;  4ZTB A;  3BB7 A;  2B1M A;  4FJC A;  2FRQ A;  1UKF A;  3O1G A;  1EWO A;  2AU1 A;  1YAL A;  2NQI A;  2AIM A;  1TU6 A;  1Q6K A;  4OEL A;  3HHA A;  3I3T A;  1PIP A;  5K16 A;  3C0R A;  2IBI A;  2R9O A;  4YVA A;  1VSN A;  3MP2 A;  2ATO A;  2H7J A;  2DZZ A;  1GCB A;  3CBJ A;  1POP A;  3IFU A;  3RVW A;  2JQF R;  3U8E A;  4I07 A;  2F7D A;  4XUI A;  3CH3 X;  2R6N A;  3MOR A;  4QRV A;  1F2C A;  5F02 A;  2OUL A;  4PI3 A;  2R9C A;  1ZCM A;  3BPF A;  1FH0 A;  1AYU A;  1GLO A;  4CDE B;  3N3G A;  3W30 A;  2BTW B;  2E03 A;  4MZS A;  1X9Y A;  1EWM A;  3PDF A;  1Y08 A;  4PP2 E;  2DC9 A;  4AXM A;  3CH2 X;  1BP4 A;  4OW0 A;  4W5C A;  2OZ2 A;  5EZS A;  3BPM A;  4BOS A;  4BSQ A;  3KKU A;  2YJC A;  3WXG A;  1PE6 A;  4X6J A;  2OP3 A;  1GMY A;  3PNR A;  3BBA A;  3BCN A;  1BGO A;  1KHQ A;  2HD5 A;  3M99 A;  1NPZ A;  1CSB B;  1EWP A;  2R9F A;  2DC8 A;  2AUX A;  1ZIV A;  1PPO A;  4D8I A;  1F29 A;  3BC3 A;  3E1Z B;  4PP1 A;  4AXL A;  1S4V A;  3H8B A;  4OVZ B;  1U5I A;  2O6X A;  2NQA A;  2G6D A;  4QRX A;  3QT4 A;  2E00 A;  3PRM A;  4X6I A;  2DC6 A;  3PW3 A;  1NB5 A;  4XZX A;  1AU2 A;  3IV2 A;  1YZB A;  1CPJ A;  3C9E A;  1YVB A;  2HXZ A;  4MSX A;  3KFQ A;  2FRA A;  4YYV A;  2HHN A;  1AU0 A;  2P86 A;  1CB5 A;  1CS8 A;  1YK8 A;  4DMY A;  5KO3 A;  2DJF B;  1U9W A;  2FUD A;  3HHI A;  1ME3 A;  2PNS A;  1NB3 A;  2R9M A;  1DKI A;  4P6E A;  1Y4H A;  4RKX A;  4YV8 A;  2IPP B;  4YYS A;  4DMX A;  4BOQ A;  4MI7 A;  9PAP A;  7PCK A;  4GUA A;  1A6R A;  4FIP A;  2ARY A;  1PVJ A;  1KXR A;  2NQG A;  2YJB A;  2HWK A;  3H8C A;  4WA6 A; 
#chains in the Genus database with same CATH homology
 3H6S A;  1NQC A;  3P5V A;  1ICF A;  1YK7 A;  3IMA A;  2B1N A;  1O0E A;  2Y6E A;  4Q8H A;  1PXV A;  5A24 A;  1E2T A;  4YYU A;  2R9N A;  1PAD A;  4CDD B;  2FO5 A;  1GX3 A;  1F2A A;  3LFY A;  2DCD A;  3D6S A;  3S3Q A;  3PBH A;  1HUC B;  2G8E A;  3N3K A;  3O0U A;  1DEU A;  4CDC B;  2FTD A;  1KHP A;  3DF0 A;  4B55 A;  2FYE A;  2AYO A;  1EWL A;  1PPD A;  1NLJ A;  1THE A;  3RVX A;  1ITO A;  4K7C A;  3HD3 A;  3BOW A;  3NHE A;  3QSD A;  1GEC E;  4YYR A;  3K24 A;  1MDW A;  2AYN A;  1YT7 A;  2WBF X;  3LTW A;  1BQI A;  1AYW A;  6PAD A;  2HH5 A;  3IOQ A;  3WXE A;  3AI8 A;  2YJ2 A;  2G8J A;  5EGW A;  2BDZ A;  4HWY A;  1TL9 A;  1K3B B;  4W4U A;  2XU1 A;  2PBH A;  3H89 A;  2CIO A;  4N4Z A;  1BY8 A;  4FK5 A;  3OF9 A;  3P5W A;  5JA7 A;  4XR7 A;  3S3R A;  3V6C A;  1MEG A;  5CHT A;  3QJ3 A;  1U9V A;  1MEM A;  1PCI A;  5CVN B;  2DZY A;  1QXP A;  1AIM A;  3KSE A;  1SP4 B;  1PPN A;  2E02 A;  2YJ8 A;  1PPP A;  1CTE A;  4Q8G A;  2GHU A;  2DC7 A;  2E01 A;  2XU5 A;  1QMY A;  3KWZ A;  1NL6 A;  4QH6 A;  1CQD A;  1W4T A;  1AU4 A;  3KW9 A;  1MIR A;  1KFU L;  5EF4 A;  2VHF A;  2P0R A;  2DCC A;  3F5V A;  2PRE A;  3K8U A;  2BSZ A;  4KLB A;  1CJL A;  1DF0 A;  3I06 A;  1M6D A;  5CVO B;  3IUT A;  2CB5 A;  4G54 A;  1MS6 A;  1STF E;  4P6G A;  2DJG B;  2VHS A;  2P7U A;  4NV8 A;  3KX1 A;  3MHS A;  2JQG R;  3N4C A;  2AVW A;  3MTN A;  4YYQ A;  2NQD B;  1ME4 A;  2PAD A;  4NV7 A;  4YYW A;  3HWN A;  1MHW A;  3ERV A;  1ATK A;  2C0Y A;  2AUZ A;  3LXS A;  3OIS A;  3F75 A;  3H7D A;  5CHV A;  1EF7 A;  4BPV A;  3OVZ A;  2F1G A;  1U9X A;  1VJV A;  4BS5 A;  1JQP A;  3P5X A;  3USV A;  1XKG A;  1AEC A;  4N79 A;  4X6H A;  3OF8 A;  3P5U A;  3MHH A;  4PAD A;  1QDQ A;  1IWD A;  4CZW A;  2AS8 A;  2XU3 A;  4I04 A;  3IHP A;  2XU4 A;  5CVM A;  4QBB A;  1F2B A;  1U9Q X;  3CBK A;  4N8W A;  4ZUX U;  4BS6 A;  1SNK A;  4I05 A;  1CV8 A;  2DCA A;  5FPW A;  1KFX L;  5PAD A;  1PBH A;  1CVZ A;  2G7Y A;  3RVV A;  3B79 A;  4BQV A;  4RY2 A;  8PCH A;  2FT2 A;  3OVX A;  4W5B A;  3WXF A;  2GFO A;  1QOL A;  3V6E A;  3GCB A;  2ACT A;  2BDL A;  2DCB A;  2YJ9 A;  3TNX A;  5JH3 A;  3K9M A;  3IEJ A;  4QRG A;  4CDF B;  3KWB X;  1AU3 A;  1TLO A;  1AYV A;  3ZUA A;  4MZO A;  2FQ9 A;  3BWK A;  5J94 A;  2Y5B A;  4OEM A;  2B1M A;  4FJC A;  2FRQ A;  3O1G A;  1EWO A;  2AU1 A;  1YAL A;  4BGF A;  1W5R A;  2NQI A;  2AIM A;  1TU6 A;  1Q6K A;  4OEL A;  3HHA A;  3I3T A;  1PIP A;  5K16 A;  2IBI A;  2R9O A;  4YVA A;  1VSN A;  2ATO A;  2H7J A;  2DZZ A;  1GCB A;  3CBJ A;  1POP A;  2VFB A;  3RVW A;  2JQF R;  3U8E A;  4I07 A;  2F7D A;  4XUI A;  3CH3 X;  2R6N A;  3D9W A;  3MOR A;  4QRV A;  1F2C A;  5F02 A;  2OUL A;  4PI3 A;  2R9C A;  1ZCM A;  3BPF A;  1FH0 A;  1AYU A;  1GLO A;  4CDE B;  3N3G A;  2E03 A;  4MZS A;  1X9Y A;  1EWM A;  3PDF A;  1Y08 A;  4PP2 E;  2DC9 A;  4AXM A;  3CH2 X;  1BP4 A;  4W5C A;  4GUZ A;  2OZ2 A;  3BPM A;  4BSQ A;  3KKU A;  2YJC A;  3WXG A;  1PE6 A;  4X6J A;  2OP3 A;  4C5P A;  1GMY A;  3PNR A;  3BCN A;  1BGO A;  1KHQ A;  2HD5 A;  3M99 A;  1NPZ A;  1CSB B;  1EWP A;  2R9F A;  2DC8 A;  2AUX A;  1ZIV A;  1PPO A;  1F29 A;  3BC3 A;  3E1Z B;  4PP1 A;  4AXL A;  1S4V A;  3H8B A;  1U5I A;  2O6X A;  2NQA A;  2G6D A;  4QRX A;  3QT4 A;  2E00 A;  4X6I A;  2DC6 A;  3PW3 A;  1NB5 A;  1AU2 A;  3IV2 A;  1CPJ A;  2VFC A;  3C9E A;  1YVB A;  2HXZ A;  4MSX A;  3KFQ A;  2FRA A;  4YYV A;  2HHN A;  1AU0 A;  2P86 A;  1CB5 A;  1CS8 A;  1YK8 A;  4DMY A;  2DJF B;  1U9W A;  2FUD A;  3HHI A;  1ME3 A;  2PNS A;  1NB3 A;  2R9M A;  4P6E A;  1Y4H A;  4YV8 A;  1W6F A;  2IPP B;  4YYS A;  4DMX A;  9PAP A;  7PCK A;  1A6R A;  4FIP A;  2ARY A;  1KXR A;  2NQG A;  2YJB A;  4WA6 A;  3H8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...