1MIRA

Rat procathepsin b
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
313
structure length
313
Chain Sequence
b'SDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSSWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCATHEPSIN B
publication title Structure of rat procathepsin B: model for inhibition of cysteine protease activity by the proregion.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 61
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1996-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1mirA00
4BSQA 1PADA 1PIPA 4N79A 1SNKA 2XU1A 3IEJA 1YK7A 1PBHA 1CS8A 3P5VA 4CDDB 2R6NA 4XR7A 4I07A 3ZUAA 2VHFA 5K16A 1Y4HA 2Y5BA 3AI8A 3MTNA 3QSDA 3KWZA 4OEMA 2P0RA 4KLBA 8PCHA 4BS5A 2DC6A 2DCBA 4CDEB 1U9QX 2VHSA 1ME3A 4CZWA 3S3QA 2WBFX 1BQIA 3MHHA 1K3BB 3U8EA 2AIMA 3USVA 4FJCA 5CHTA 4BS6A 3PDFA 1ITOA 1KHPA 1MDWA 2NQIA 4CDFB 3CBJA 1AYUA 3PW3A 2F7DA 1IWDA 3KX1A 5JH3A 4K7CA 4QRVA 2AS8A 1U9VA 4MZOA 3K8UA 2HD5A 3BCNA 1BGOA 1PPDA 2Y6EA 1PPNA 2R9FA 2ACTA 2FTDA 3LFYA 2AU1A 1NL6A 1QOLA 4CDCB 3N3KA 2XU3A 2R9MA 2C0YA 3QT4A 2DCDA 1PPPA 1A6RA 4YYRA 1CV8A 1TU6A 1ICFA 2PADA 1QMYA 3MHSA 2YJCA 2IBIA 1EWPA 4BPVA 1M6DA 4FK5A 3P5WA 2YJ2A 2O6XA 1CB5A 3QJ3A 2E02A 1O0EA 1F2BA 1AU2A 2B1MA 3IUTA 4BQVA 4DMYA 4YYQA 4YV8A 2NQAA 4W5CA 3D6SA 2AYNA 2GFOA 9PAPA 1THEA 3WXGA 2FQ9A 5CVMA 1BP4A 1MEGA 2BDZA 1MIRA 4DMXA 3I3TA 2FT2A 1MEMA 4XUIA 5JA7A 4P6GA 3O1GA 3GCBA 3F5VA 1BY8A 2FUDA 3PNRA 1PE6A 2IPPB 4G54A 4N4ZA 1FH0A 3C9EA 5PADA 1U9WA 1PPOA 1CQDA 2DC9A 1F2CA 2GHUA 3DF0A 3IHPA 2PNSA 3V6EA 1ME4A 2FRAA 3IOQA 1PCIA 2XU5A 1KXRA 3HHIA 2DZYA 4FIPA 4N8WA 2AUZA 2E01A 3HWNA 2R9CA 2CIOA 1YK8A 1CVZA 3H6SA 3S3RA 1YVBA 4YYUA 4PP2E 2YJ9A 1KFXL 2DJGB 3I06A 4WA6A 1AIMA 2FYEA 1ZIVA 3RVWA 1STFE 3RVXA 2G8EA 3BC3A 3CBKA 1HUCB 2OZ2A 2OP3A 1NLJA 4MZSA 2OULA 4W4UA 2DCAA 3BWKA 1MHWA 1CJLA 1CPJA 4W5BA 5A24A 3HD3A 1F29A 4QRGA 1YALA 5CVNB 4Q8HA 3OF8A 1PXVA 2HH5A 4Q8GA 3BOWA 2CB5A 1AU4A 1Q6KA 4PP1A 3OISA 3N4CA 1CTEA 1SP4B 2R9NA 3M99A 4OELA 2FRQA 4PI3A 3KFQA 5EF4A 1EWLA 1F2AA 3H89A 5FPWA 5EGWA 2B1NA 1Y08A 1AU3A 3OF9A 1XKGA 2PBHA 2HXZA 2BDLA 3NHEA 3KW9A 2R9OA 3O0UA 3MORA 2F1GA 4QH6A 3P5XA 3B79A 4AXMA 4YYWA 3WXEA 1VJVA 4AXLA 2NQDB 1ZCMA 4X6HA 4X6JA 4YYSA 3IMAA 2DZZA 4ZUXU 2NQGA 4PADA 3LXSA 6PADA 3CH3X 4I04A 3H7DA 3CH2X 1GECE 3F75A 3RVVA 4X6IA 2G6DA 2YJBA 1CSBB 1QXPA 1TL9A 2G7YA 1EF7A 4P6EA 3BPMA 2FO5A 4RY2A 3ERVA 2DJFB 1AYVA 2DC7A 1DEUA 2AUXA 2AYOA 1QDQA 1AU0A 2P7UA 3K9MA 3KKUA 5CHVA 3TNXA 1YT7A 3PBHA 1VSNA 4YVAA 1POPA 1JQPA 3N3GA 3OVXA 2DC8A 2XU4A 2H7JA 1KFUL 7PCKA 2JQFR 2P86A 3KSEA 1S4VA 1GMYA 4MSXA 3IV2A 1KHQA 2YJ8A 2ATOA 3HHAA 1U9XA 3WXFA 5F02A 5CVOB 1TLOA 1EWOA 1DF0A 3BPFA 1GLOA 1GCBA 2E03A 3K24A 2E00A 1EWMA 2PREA 1AECA 2DCCA 2JQGR 4YYVA 4QBBA 1NB5A 3OVZA 1NQCA 1X9YA 3KWBX 1ATKA 4I05A 1NB3A 3H8BA 1MS6A 2AVWA 3H8CA 3V6CA 2G8JA 2ARYA 1AYWA 3P5UA 4QRXA 4HWYA 2HHNA 3E1ZB 1NPZA 5J94A 1U5IA
chains in the Genus database with same CATH superfamily
4BSQA 1PADA 1PIPA 4N79A 1SNKA 2XU1A 3BB7A 3IEJA 1YK7A 1PBHA 1CS8A 3P5VA 4CDDB 2R6NA 4XR7A 4I07A 3ZUAA 4BOSA 2VHFA 5K16A 4OW0A 1Y4HA 2Y5BA 3AI8A 3MTNA 3QSDA 3KWZA 3MJ5A 4OEMA 2P0RA 4KLBA 8PCHA 4BS5A 2DC6A 2DCBA 4CDEB 1U9QX 2VHSA 1ME3A 3PRPA 4CZWA 5KO3A 3S3QA 3E9SA 2WBFX 1BQIA 3MHHA 1K3BB 3U8EA 2AIMA 4IP3A 3USVA 4FJCA 5CHTA 4BS6A 4OVZB 4A5UA 3O65A 3PDFA 1ITOA 1KHPA 1MDWA 2NQIA 4CDFB 5EZSA 3CBJA 1AYUA 3PW3A 2F7DA 1IWDA 3KX1A 5JH3A 4K7CA 4QRVA 2AS8A 1U9VA 4MZOA 3K8UA 4WURA 2HD5A 3PSEA 3BCNA 1BGOA 3BBAA 1PPDA 2Y6EA 5EZQA 1PPNA 2R9FA 3PT2A 2ACTA 2FTDA 3LFYA 2AU1A 1NL6A 1QOLA 4CDCB 3N3KA 2XU3A 2BTWA 2R9MA 2C0YA 3QT4A 4GUAA 2DCDA 1PPPA 4R3DA 1A6RA 4YYRA 1CV8A 1TU6A 1ICFA 2PADA 1QMYA 3MHSA 2YJCA 2IBIA 1EWPA 4BPVA 1M6DA 3TMPA 4FK5A 3P5WA 2YJ2A 2O6XA 1CB5A 3QJ3A 2E02A 1O0EA 1F2BA 2BTWB 1AU2A 2B1MA 3IUTA 4BQVA 4DMYA 3B21A 4YYQA 2Z84A 4YV8A 2NQAA 4W5CA 3D6SA 2AYNA 4D8EA 2GFOA 2JTCA 9PAPA 1THEA 4RKXA 3WXGA 2FQ9A 2HWKA 5CVMA 1BP4A 4OVZA 1MEGA 2BDZA 1MIRA 4DMXA 3I3TA 4ZTBA 2FT2A 1MEMA 4XUIA 4M0WA 2AGAA 5JA7A 4P6GA 3O1GA 3GCBA 3F5VA 1BY8A 2FUDA 3PNRA 1PE6A 2IPPB 4G54A 4N4ZA 1FH0A 4HXDB 3C9EA 3PHXA 5PADA 1U9WA 1PPOA 1CQDA 2DC9A 1F2CA 4BOZA 2GHUA 3DF0A 3IHPA 2PNSA 3V6EA 1ME4A 2FRAA 3IOQA 1PCIA 2XU5A 1KXRA 3HHIA 2FE8A 2DZYA 4FIPA 4N8WA 2AUZA 2E01A 3HWNA 2R9CA 2CIOA 4REZA 3BY4A 1YK8A 1CVZA 3H6SA 3S3RA 1YVBA 4YYUA 4PP2E 2YJ9A 1KFXL 3MTVA 2DJGB 3I06A 3PRMA 4WA6A 1AIMA 2FYEA 1ZIVA 4BOUA 3RVWA 1STFE 2DOSA 3RVXA 2G8EA 3BC3A 3CBKA 1HUCB 2OZ2A 2OP3A 1NLJA 4MZSA 2OULA 4W4UA 2DCAA 3BWKA 1MHWA 1CJLA 1CPJA 4W5BA 5A24A 3HD3A 1F29A 4QRGA 1YALA 5CVNB 4Q8HA 5JZEA 3OF8A 1PXVA 2HH5A 2UZJA 4Q8GA 3BOWA 3PHWA 2CB5A 4PT5A 2J7QA 1AU4A 1Q6KA 4PP1A 3OISA 3N4CA 3ZNHA 1CTEA 4BOPA 1SP4B 2R9NA 3M99A 4OELA 4RNAA 2FRQA 4PI3A 3KFQA 5EF4A 1EWLA 1F2AA 3H89A 5FPWA 3IFUA 5EGWA 2B1NA 4MM3B 4RF0A 1Y08A 1AU3A 3OF9A 1XKGA 2PBHA 1PVJA 2HXZA 2BDLA 3NHEA 3KW9A 2R9OA 3O0UA 3MORA 2F1GA 4QH6A 3P5XA 3B79A 4AXMA 4YYWA 3WXEA 1VJVA 4MI7A 4AXLA 2NQDB 1ZCMA 4X6HA 3OQCA 4X6JA 4YYSA 1YZBA 2JRIA 3IMAA 2DZZA 4ZUXU 4D8BA 2NQGA 4PADA 3LXSA 3W31A 6PADA 3CH3X 4I04A 3H7DA 3CH2X 1GECE 3TRKA 3F75A 3RVVA 4X6IA 2G6DA 2YJBA 1CSBB 4BOQA 1QXPA 1TL9A 2G7YA 1EF7A 4P6EA 1UKFA 3BPMA 2FO5A 4RY2A 3ERVA 2DJFB 1AYVA 4D8IA 2DC7A 1DEUA 2AUXA 2AYOA 1QDQA 1AU0A 2P7UA 3K9MA 3KKUA 5CHVA 4RF1A 1DKIA 3TNXA 1YT7A 3PBHA 1VSNA 4YVAA 1POPA 3C0RA 1JQPA 3N3GA 3OVXA 2DC8A 2XU4A 2H7JA 1KFUL 7PCKA 2JQFR 2P86A 3PHUA 3KSEA 1S4VA 1GMYA 4MSXA 3IV2A 1KHQA 3W30A 2YJ8A 2ATOA 3HHAA 3RNVA 1U9XA 3WXFA 5F02A 5CVOB 1TLOA 1EWOA 1DF0A 3BPFA 1GLOA 1GCBA 2E03A 3K24A 2E00A 1EWMA 2PREA 1AECA 2DCCA 2JQGR 4P16A 4YYVA 4QBBA 1NB5A 3OVZA 1NQCA 1X9YA 3KWBX 5E6JA 1ATKA 4I05A 1NB3A 3H8BA 1MS6A 2AVWA 3H8CA 4IUMA 3V6CA 2G8JA 2ARYA 1AYWA 3P5UA 2BU3A 2J7QC 4QRXA 4XZXA 4HWYA 2HHNA 3E1ZB 1NPZA 5J94A 1U5IA 3MP2A
chains in the Genus database with same CATH topology
4BSQA 1PADA 1PIPA 4N79A 1SNKA 2XU1A 3IEJA 1YK7A 1PBHA 1CS8A 3P5VA 4CDDB 2R6NA 4XR7A 4I07A 3ZUAA 2VHFA 3D9WA 5K16A 1Y4HA 2Y5BA 3AI8A 3MTNA 3QSDA 3KWZA 4OEMA 2P0RA 4KLBA 8PCHA 4BS5A 2DC6A 2DCBA 4CDEB 1U9QX 2VHSA 1ME3A 4CZWA 3S3QA 2WBFX 1BQIA 3MHHA 1K3BB 3U8EA 2AIMA 3USVA 4FJCA 5CHTA 4BS6A 3PDFA 1ITOA 1KHPA 1MDWA 2NQIA 4CDFB 3CBJA 1AYUA 3PW3A 2F7DA 1IWDA 3KX1A 4B55A 5JH3A 4K7CA 4QRVA 2AS8A 1U9VA 4MZOA 3K8UA 2HD5A 1E2TA 3BCNA 1BGOA 1PPDA 2Y6EA 1PPNA 2R9FA 2ACTA 2FTDA 3LFYA 2AU1A 4C5PA 1NL6A 1QOLA 4CDCB 3N3KA 2XU3A 2R9MA 2C0YA 3QT4A 2DCDA 1PPPA 1A6RA 4YYRA 1CV8A 1TU6A 1ICFA 2PADA 1QMYA 3MHSA 2YJCA 2IBIA 1EWPA 4BPVA 1M6DA 4FK5A 3P5WA 2YJ2A 2O6XA 1CB5A 3QJ3A 2E02A 1O0EA 1F2BA 1AU2A 2B1MA 3IUTA 4BQVA 4DMYA 4YYQA 4YV8A 2NQAA 4W5CA 3D6SA 2AYNA 2GFOA 9PAPA 1THEA 4GUZA 3WXGA 2FQ9A 5CVMA 1BP4A 1MEGA 2BDZA 1MIRA 4DMXA 3I3TA 2FT2A 1MEMA 4XUIA 5JA7A 4P6GA 3O1GA 3GCBA 3F5VA 1BY8A 2FUDA 3PNRA 1PE6A 2VFCA 2IPPB 4G54A 4N4ZA 1FH0A 3C9EA 5PADA 1U9WA 1PPOA 1CQDA 2DC9A 1F2CA 2GHUA 3DF0A 3IHPA 2PNSA 3V6EA 1ME4A 2FRAA 3IOQA 1PCIA 2XU5A 1KXRA 3HHIA 4NV8A 2DZYA 4FIPA 4N8WA 2AUZA 2E01A 3HWNA 2R9CA 2CIOA 1YK8A 1CVZA 3H6SA 3S3RA 1YVBA 4YYUA 4PP2E 2YJ9A 1KFXL 2DJGB 3I06A 4WA6A 1AIMA 2FYEA 1ZIVA 3RVWA 1STFE 4BGFA 3RVXA 2G8EA 3BC3A 3CBKA 1HUCB 2OZ2A 2OP3A 1NLJA 4MZSA 2OULA 4W4UA 2DCAA 3BWKA 1MHWA 1CJLA 1CPJA 4W5BA 5A24A 3HD3A 1F29A 1W5RA 4QRGA 1YALA 5CVNB 4Q8HA 4NV7A 3OF8A 1PXVA 2HH5A 4Q8GA 3BOWA 2CB5A 1AU4A 1Q6KA 4PP1A 3OISA 3N4CA 1CTEA 1SP4B 2R9NA 3M99A 4OELA 2FRQA 4PI3A 1W4TA 3KFQA 5EF4A 1EWLA 1F2AA 3H89A 5FPWA 5EGWA 2B1NA 1Y08A 1AU3A 3OF9A 1XKGA 2PBHA 2HXZA 2BDLA 3NHEA 3KW9A 2R9OA 2BSZA 3O0UA 3MORA 2F1GA 4QH6A 3P5XA 3B79A 4AXMA 4YYWA 3WXEA 1VJVA 4AXLA 2NQDB 1ZCMA 4X6HA 4X6JA 4YYSA 3IMAA 1GX3A 2DZZA 4ZUXU 2NQGA 4PADA 3LXSA 6PADA 3CH3X 4I04A 3H7DA 1W6FA 3CH2X 1GECE 3F75A 3RVVA 4X6IA 2G6DA 2YJBA 1CSBB 1QXPA 1TL9A 2G7YA 1EF7A 4P6EA 3LTWA 3BPMA 2FO5A 4RY2A 2VFBA 3ERVA 2DJFB 1AYVA 2DC7A 1DEUA 2AUXA 2AYOA 1QDQA 1AU0A 2P7UA 3K9MA 3KKUA 5CHVA 3TNXA 1YT7A 3PBHA 1VSNA 4YVAA 1POPA 1JQPA 3N3GA 3OVXA 2DC8A 2XU4A 2H7JA 1KFUL 7PCKA 2JQFR 2P86A 3KSEA 1S4VA 1GMYA 4MSXA 3IV2A 1KHQA 2YJ8A 2ATOA 3HHAA 1U9XA 3WXFA 5F02A 5CVOB 1TLOA 1EWOA 1DF0A 3BPFA 1GLOA 1GCBA 2E03A 3K24A 2E00A 1EWMA 2PREA 1AECA 2DCCA 2JQGR 4YYVA 4QBBA 1NB5A 3OVZA 1NQCA 1X9YA 3KWBX 1ATKA 4I05A 1NB3A 3H8BA 1MS6A 2AVWA 3H8CA 3V6CA 2G8JA 2ARYA 1AYWA 3P5UA 4QRXA 4HWYA 2HHNA 3E1ZB 1NPZA 5J94A 1U5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSQ A;  1PAD A;  1PIP A;  4N79 A;  1SNK A;  2XU1 A;  3IEJ A;  1YK7 A;  1PBH A;  1CS8 A;  3P5V A;  4CDD B;  2R6N A;  4XR7 A;  4I07 A;  3ZUA A;  2VHF A;  5K16 A;  1Y4H A;  2Y5B A;  3AI8 A;  3MTN A;  3QSD A;  3KWZ A;  4OEM A;  2P0R A;  4KLB A;  8PCH A;  4BS5 A;  2DC6 A;  2DCB A;  4CDE B;  1U9Q X;  2VHS A;  1ME3 A;  4CZW A;  3S3Q A;  2WBF X;  1BQI A;  3MHH A;  1K3B B;  3U8E A;  2AIM A;  3USV A;  4FJC A;  5CHT A;  4BS6 A;  3PDF A;  1ITO A;  1KHP A;  1MDW A;  2NQI A;  4CDF B;  3CBJ A;  1AYU A;  3PW3 A;  2F7D A;  1IWD A;  3KX1 A;  5JH3 A;  4K7C A;  4QRV A;  2AS8 A;  1U9V A;  4MZO A;  3K8U A;  2HD5 A;  3BCN A;  1BGO A;  1PPD A;  2Y6E A;  1PPN A;  2R9F A;  2ACT A;  2FTD A;  3LFY A;  2AU1 A;  1NL6 A;  1QOL A;  4CDC B;  3N3K A;  2XU3 A;  2R9M A;  2C0Y A;  3QT4 A;  2DCD A;  1PPP A;  1A6R A;  4YYR A;  1CV8 A;  1TU6 A;  1ICF A;  2PAD A;  1QMY A;  3MHS A;  2YJC A;  2IBI A;  1EWP A;  4BPV A;  1M6D A;  4FK5 A;  3P5W A;  2YJ2 A;  2O6X A;  1CB5 A;  3QJ3 A;  2E02 A;  1O0E A;  1F2B A;  1AU2 A;  2B1M A;  3IUT A;  4BQV A;  4DMY A;  4YYQ A;  4YV8 A;  2NQA A;  4W5C A;  3D6S A;  2AYN A;  2GFO A;  9PAP A;  1THE A;  3WXG A;  2FQ9 A;  5CVM A;  1BP4 A;  1MEG A;  2BDZ A;  1MIR A;  4DMX A;  3I3T A;  2FT2 A;  1MEM A;  4XUI A;  5JA7 A;  4P6G A;  3O1G A;  3GCB A;  3F5V A;  1BY8 A;  2FUD A;  3PNR A;  1PE6 A;  2IPP B;  4G54 A;  4N4Z A;  1FH0 A;  3C9E A;  5PAD A;  1U9W A;  1PPO A;  1CQD A;  2DC9 A;  1F2C A;  2GHU A;  3DF0 A;  3IHP A;  2PNS A;  3V6E A;  1ME4 A;  2FRA A;  3IOQ A;  1PCI A;  2XU5 A;  1KXR A;  3HHI A;  2DZY A;  4FIP A;  4N8W A;  2AUZ A;  2E01 A;  3HWN A;  2R9C A;  2CIO A;  1YK8 A;  1CVZ A;  3H6S A;  3S3R A;  1YVB A;  4YYU A;  4PP2 E;  2YJ9 A;  1KFX L;  2DJG B;  3I06 A;  4WA6 A;  1AIM A;  2FYE A;  1ZIV A;  3RVW A;  1STF E;  3RVX A;  2G8E A;  3BC3 A;  3CBK A;  1HUC B;  2OZ2 A;  2OP3 A;  1NLJ A;  4MZS A;  2OUL A;  4W4U A;  2DCA A;  3BWK A;  1MHW A;  1CJL A;  1CPJ A;  4W5B A;  5A24 A;  3HD3 A;  1F29 A;  4QRG A;  1YAL A;  5CVN B;  4Q8H A;  3OF8 A;  1PXV A;  2HH5 A;  4Q8G A;  3BOW A;  2CB5 A;  1AU4 A;  1Q6K A;  4PP1 A;  3OIS A;  3N4C A;  1CTE A;  1SP4 B;  2R9N A;  3M99 A;  4OEL A;  2FRQ A;  4PI3 A;  3KFQ A;  5EF4 A;  1EWL A;  1F2A A;  3H89 A;  5FPW A;  5EGW A;  2B1N A;  1Y08 A;  1AU3 A;  3OF9 A;  1XKG A;  2PBH A;  2HXZ A;  2BDL A;  3NHE A;  3KW9 A;  2R9O A;  3O0U A;  3MOR A;  2F1G A;  4QH6 A;  3P5X A;  3B79 A;  4AXM A;  4YYW A;  3WXE A;  1VJV A;  4AXL A;  2NQD B;  1ZCM A;  4X6H A;  4X6J A;  4YYS A;  3IMA A;  2DZZ A;  4ZUX U;  2NQG A;  4PAD A;  3LXS A;  6PAD A;  3CH3 X;  4I04 A;  3H7D A;  3CH2 X;  1GEC E;  3F75 A;  3RVV A;  4X6I A;  2G6D A;  2YJB A;  1CSB B;  1QXP A;  1TL9 A;  2G7Y A;  1EF7 A;  4P6E A;  3BPM A;  2FO5 A;  4RY2 A;  3ERV A;  2DJF B;  1AYV A;  2DC7 A;  1DEU A;  2AUX A;  2AYO A;  1QDQ A;  1AU0 A;  2P7U A;  3K9M A;  3KKU A;  5CHV A;  3TNX A;  1YT7 A;  3PBH A;  1VSN A;  4YVA A;  1POP A;  1JQP A;  3N3G A;  3OVX A;  2DC8 A;  2XU4 A;  2H7J A;  1KFU L;  7PCK A;  2JQF R;  2P86 A;  3KSE A;  1S4V A;  1GMY A;  4MSX A;  3IV2 A;  1KHQ A;  2YJ8 A;  2ATO A;  3HHA A;  1U9X A;  3WXF A;  5F02 A;  5CVO B;  1TLO A;  1EWO A;  1DF0 A;  3BPF A;  1GLO A;  1GCB A;  2E03 A;  3K24 A;  2E00 A;  1EWM A;  2PRE A;  1AEC A;  2DCC A;  2JQG R;  4YYV A;  4QBB A;  1NB5 A;  3OVZ A;  1NQC A;  1X9Y A;  3KWB X;  1ATK A;  4I05 A;  1NB3 A;  3H8B A;  1MS6 A;  2AVW A;  3H8C A;  3V6C A;  2G8J A;  2ARY A;  1AYW A;  3P5U A;  4QRX A;  4HWY A;  2HHN A;  3E1Z B;  1NPZ A;  5J94 A;  1U5I A; 
#chains in the Genus database with same CATH topology
 4BSQ A;  1PAD A;  1PIP A;  4N79 A;  1SNK A;  2XU1 A;  3BB7 A;  3IEJ A;  1YK7 A;  1PBH A;  1CS8 A;  3P5V A;  4CDD B;  2R6N A;  4XR7 A;  4I07 A;  3ZUA A;  4BOS A;  2VHF A;  5K16 A;  4OW0 A;  1Y4H A;  2Y5B A;  3AI8 A;  3MTN A;  3QSD A;  3KWZ A;  3MJ5 A;  4OEM A;  2P0R A;  4KLB A;  8PCH A;  4BS5 A;  2DC6 A;  2DCB A;  4CDE B;  1U9Q X;  2VHS A;  1ME3 A;  3PRP A;  4CZW A;  5KO3 A;  3S3Q A;  3E9S A;  2WBF X;  1BQI A;  3MHH A;  1K3B B;  3U8E A;  2AIM A;  4IP3 A;  3USV A;  4FJC A;  5CHT A;  4BS6 A;  4OVZ B;  4A5U A;  3O65 A;  3PDF A;  1ITO A;  1KHP A;  1MDW A;  2NQI A;  4CDF B;  5EZS A;  3CBJ A;  1AYU A;  3PW3 A;  2F7D A;  1IWD A;  3KX1 A;  5JH3 A;  4K7C A;  4QRV A;  2AS8 A;  1U9V A;  4MZO A;  3K8U A;  4WUR A;  2HD5 A;  3PSE A;  3BCN A;  1BGO A;  3BBA A;  1PPD A;  2Y6E A;  5EZQ A;  1PPN A;  2R9F A;  3PT2 A;  2ACT A;  2FTD A;  3LFY A;  2AU1 A;  1NL6 A;  1QOL A;  4CDC B;  3N3K A;  2XU3 A;  2BTW A;  2R9M A;  2C0Y A;  3QT4 A;  4GUA A;  2DCD A;  1PPP A;  4R3D A;  1A6R A;  4YYR A;  1CV8 A;  1TU6 A;  1ICF A;  2PAD A;  1QMY A;  3MHS A;  2YJC A;  2IBI A;  1EWP A;  4BPV A;  1M6D A;  3TMP A;  4FK5 A;  3P5W A;  2YJ2 A;  2O6X A;  1CB5 A;  3QJ3 A;  2E02 A;  1O0E A;  1F2B A;  2BTW B;  1AU2 A;  2B1M A;  3IUT A;  4BQV A;  4DMY A;  3B21 A;  4YYQ A;  2Z84 A;  4YV8 A;  2NQA A;  4W5C A;  3D6S A;  2AYN A;  4D8E A;  2GFO A;  2JTC A;  9PAP A;  1THE A;  4RKX A;  3WXG A;  2FQ9 A;  2HWK A;  5CVM A;  1BP4 A;  4OVZ A;  1MEG A;  2BDZ A;  1MIR A;  4DMX A;  3I3T A;  4ZTB A;  2FT2 A;  1MEM A;  4XUI A;  4M0W A;  2AGA A;  5JA7 A;  4P6G A;  3O1G A;  3GCB A;  3F5V A;  1BY8 A;  2FUD A;  3PNR A;  1PE6 A;  2IPP B;  4G54 A;  4N4Z A;  1FH0 A;  4HXD B;  3C9E A;  3PHX A;  5PAD A;  1U9W A;  1PPO A;  1CQD A;  2DC9 A;  1F2C A;  4BOZ A;  2GHU A;  3DF0 A;  3IHP A;  2PNS A;  3V6E A;  1ME4 A;  2FRA A;  3IOQ A;  1PCI A;  2XU5 A;  1KXR A;  3HHI A;  2FE8 A;  2DZY A;  4FIP A;  4N8W A;  2AUZ A;  2E01 A;  3HWN A;  2R9C A;  2CIO A;  4REZ A;  3BY4 A;  1YK8 A;  1CVZ A;  3H6S A;  3S3R A;  1YVB A;  4YYU A;  4PP2 E;  2YJ9 A;  1KFX L;  3MTV A;  2DJG B;  3I06 A;  3PRM A;  4WA6 A;  1AIM A;  2FYE A;  1ZIV A;  4BOU A;  3RVW A;  1STF E;  2DOS A;  3RVX A;  2G8E A;  3BC3 A;  3CBK A;  1HUC B;  2OZ2 A;  2OP3 A;  1NLJ A;  4MZS A;  2OUL A;  4W4U A;  2DCA A;  3BWK A;  1MHW A;  1CJL A;  1CPJ A;  4W5B A;  5A24 A;  3HD3 A;  1F29 A;  4QRG A;  1YAL A;  5CVN B;  4Q8H A;  5JZE A;  3OF8 A;  1PXV A;  2HH5 A;  2UZJ A;  4Q8G A;  3BOW A;  3PHW A;  2CB5 A;  4PT5 A;  2J7Q A;  1AU4 A;  1Q6K A;  4PP1 A;  3OIS A;  3N4C A;  3ZNH A;  1CTE A;  4BOP A;  1SP4 B;  2R9N A;  3M99 A;  4OEL A;  4RNA A;  2FRQ A;  4PI3 A;  3KFQ A;  5EF4 A;  1EWL A;  1F2A A;  3H89 A;  5FPW A;  3IFU A;  5EGW A;  2B1N A;  4MM3 B;  4RF0 A;  1Y08 A;  1AU3 A;  3OF9 A;  1XKG A;  2PBH A;  1PVJ A;  2HXZ A;  2BDL A;  3NHE A;  3KW9 A;  2R9O A;  3O0U A;  3MOR A;  2F1G A;  4QH6 A;  3P5X A;  3B79 A;  4AXM A;  4YYW A;  3WXE A;  1VJV A;  4MI7 A;  4AXL A;  2NQD B;  1ZCM A;  4X6H A;  3OQC A;  4X6J A;  4YYS A;  1YZB A;  2JRI A;  3IMA A;  2DZZ A;  4ZUX U;  4D8B A;  2NQG A;  4PAD A;  3LXS A;  3W31 A;  6PAD A;  3CH3 X;  4I04 A;  3H7D A;  3CH2 X;  1GEC E;  3TRK A;  3F75 A;  3RVV A;  4X6I A;  2G6D A;  2YJB A;  1CSB B;  4BOQ A;  1QXP A;  1TL9 A;  2G7Y A;  1EF7 A;  4P6E A;  1UKF A;  3BPM A;  2FO5 A;  4RY2 A;  3ERV A;  2DJF B;  1AYV A;  4D8I A;  2DC7 A;  1DEU A;  2AUX A;  2AYO A;  1QDQ A;  1AU0 A;  2P7U A;  3K9M A;  3KKU A;  5CHV A;  4RF1 A;  1DKI A;  3TNX A;  1YT7 A;  3PBH A;  1VSN A;  4YVA A;  1POP A;  3C0R A;  1JQP A;  3N3G A;  3OVX A;  2DC8 A;  2XU4 A;  2H7J A;  1KFU L;  7PCK A;  2JQF R;  2P86 A;  3PHU A;  3KSE A;  1S4V A;  1GMY A;  4MSX A;  3IV2 A;  1KHQ A;  3W30 A;  2YJ8 A;  2ATO A;  3HHA A;  3RNV A;  1U9X A;  3WXF A;  5F02 A;  5CVO B;  1TLO A;  1EWO A;  1DF0 A;  3BPF A;  1GLO A;  1GCB A;  2E03 A;  3K24 A;  2E00 A;  1EWM A;  2PRE A;  1AEC A;  2DCC A;  2JQG R;  4P16 A;  4YYV A;  4QBB A;  1NB5 A;  3OVZ A;  1NQC A;  1X9Y A;  3KWB X;  5E6J A;  1ATK A;  4I05 A;  1NB3 A;  3H8B A;  1MS6 A;  2AVW A;  3H8C A;  4IUM A;  3V6C A;  2G8J A;  2ARY A;  1AYW A;  3P5U A;  2BU3 A;  2J7Q C;  4QRX A;  4XZX A;  4HWY A;  2HHN A;  3E1Z B;  1NPZ A;  5J94 A;  1U5I A;  3MP2 A; 
#chains in the Genus database with same CATH homology
 4BSQ A;  1PAD A;  1PIP A;  4N79 A;  1SNK A;  2XU1 A;  3IEJ A;  1YK7 A;  1PBH A;  1CS8 A;  3P5V A;  4CDD B;  2R6N A;  4XR7 A;  4I07 A;  3ZUA A;  2VHF A;  3D9W A;  5K16 A;  1Y4H A;  2Y5B A;  3AI8 A;  3MTN A;  3QSD A;  3KWZ A;  4OEM A;  2P0R A;  4KLB A;  8PCH A;  4BS5 A;  2DC6 A;  2DCB A;  4CDE B;  1U9Q X;  2VHS A;  1ME3 A;  4CZW A;  3S3Q A;  2WBF X;  1BQI A;  3MHH A;  1K3B B;  3U8E A;  2AIM A;  3USV A;  4FJC A;  5CHT A;  4BS6 A;  3PDF A;  1ITO A;  1KHP A;  1MDW A;  2NQI A;  4CDF B;  3CBJ A;  1AYU A;  3PW3 A;  2F7D A;  1IWD A;  3KX1 A;  4B55 A;  5JH3 A;  4K7C A;  4QRV A;  2AS8 A;  1U9V A;  4MZO A;  3K8U A;  2HD5 A;  1E2T A;  3BCN A;  1BGO A;  1PPD A;  2Y6E A;  1PPN A;  2R9F A;  2ACT A;  2FTD A;  3LFY A;  2AU1 A;  4C5P A;  1NL6 A;  1QOL A;  4CDC B;  3N3K A;  2XU3 A;  2R9M A;  2C0Y A;  3QT4 A;  2DCD A;  1PPP A;  1A6R A;  4YYR A;  1CV8 A;  1TU6 A;  1ICF A;  2PAD A;  1QMY A;  3MHS A;  2YJC A;  2IBI A;  1EWP A;  4BPV A;  1M6D A;  4FK5 A;  3P5W A;  2YJ2 A;  2O6X A;  1CB5 A;  3QJ3 A;  2E02 A;  1O0E A;  1F2B A;  1AU2 A;  2B1M A;  3IUT A;  4BQV A;  4DMY A;  4YYQ A;  4YV8 A;  2NQA A;  4W5C A;  3D6S A;  2AYN A;  2GFO A;  9PAP A;  1THE A;  4GUZ A;  3WXG A;  2FQ9 A;  5CVM A;  1BP4 A;  1MEG A;  2BDZ A;  1MIR A;  4DMX A;  3I3T A;  2FT2 A;  1MEM A;  4XUI A;  5JA7 A;  4P6G A;  3O1G A;  3GCB A;  3F5V A;  1BY8 A;  2FUD A;  3PNR A;  1PE6 A;  2VFC A;  2IPP B;  4G54 A;  4N4Z A;  1FH0 A;  3C9E A;  5PAD A;  1U9W A;  1PPO A;  1CQD A;  2DC9 A;  1F2C A;  2GHU A;  3DF0 A;  3IHP A;  2PNS A;  3V6E A;  1ME4 A;  2FRA A;  3IOQ A;  1PCI A;  2XU5 A;  1KXR A;  3HHI A;  4NV8 A;  2DZY A;  4FIP A;  4N8W A;  2AUZ A;  2E01 A;  3HWN A;  2R9C A;  2CIO A;  1YK8 A;  1CVZ A;  3H6S A;  3S3R A;  1YVB A;  4YYU A;  4PP2 E;  2YJ9 A;  1KFX L;  2DJG B;  3I06 A;  4WA6 A;  1AIM A;  2FYE A;  1ZIV A;  3RVW A;  1STF E;  4BGF A;  3RVX A;  2G8E A;  3BC3 A;  3CBK A;  1HUC B;  2OZ2 A;  2OP3 A;  1NLJ A;  4MZS A;  2OUL A;  4W4U A;  2DCA A;  3BWK A;  1MHW A;  1CJL A;  1CPJ A;  4W5B A;  5A24 A;  3HD3 A;  1F29 A;  1W5R A;  4QRG A;  1YAL A;  5CVN B;  4Q8H A;  4NV7 A;  3OF8 A;  1PXV A;  2HH5 A;  4Q8G A;  3BOW A;  2CB5 A;  1AU4 A;  1Q6K A;  4PP1 A;  3OIS A;  3N4C A;  1CTE A;  1SP4 B;  2R9N A;  3M99 A;  4OEL A;  2FRQ A;  4PI3 A;  1W4T A;  3KFQ A;  5EF4 A;  1EWL A;  1F2A A;  3H89 A;  5FPW A;  5EGW A;  2B1N A;  1Y08 A;  1AU3 A;  3OF9 A;  1XKG A;  2PBH A;  2HXZ A;  2BDL A;  3NHE A;  3KW9 A;  2R9O A;  2BSZ A;  3O0U A;  3MOR A;  2F1G A;  4QH6 A;  3P5X A;  3B79 A;  4AXM A;  4YYW A;  3WXE A;  1VJV A;  4AXL A;  2NQD B;  1ZCM A;  4X6H A;  4X6J A;  4YYS A;  3IMA A;  1GX3 A;  2DZZ A;  4ZUX U;  2NQG A;  4PAD A;  3LXS A;  6PAD A;  3CH3 X;  4I04 A;  3H7D A;  1W6F A;  3CH2 X;  1GEC E;  3F75 A;  3RVV A;  4X6I A;  2G6D A;  2YJB A;  1CSB B;  1QXP A;  1TL9 A;  2G7Y A;  1EF7 A;  4P6E A;  3LTW A;  3BPM A;  2FO5 A;  4RY2 A;  2VFB A;  3ERV A;  2DJF B;  1AYV A;  2DC7 A;  1DEU A;  2AUX A;  2AYO A;  1QDQ A;  1AU0 A;  2P7U A;  3K9M A;  3KKU A;  5CHV A;  3TNX A;  1YT7 A;  3PBH A;  1VSN A;  4YVA A;  1POP A;  1JQP A;  3N3G A;  3OVX A;  2DC8 A;  2XU4 A;  2H7J A;  1KFU L;  7PCK A;  2JQF R;  2P86 A;  3KSE A;  1S4V A;  1GMY A;  4MSX A;  3IV2 A;  1KHQ A;  2YJ8 A;  2ATO A;  3HHA A;  1U9X A;  3WXF A;  5F02 A;  5CVO B;  1TLO A;  1EWO A;  1DF0 A;  3BPF A;  1GLO A;  1GCB A;  2E03 A;  3K24 A;  2E00 A;  1EWM A;  2PRE A;  1AEC A;  2DCC A;  2JQG R;  4YYV A;  4QBB A;  1NB5 A;  3OVZ A;  1NQC A;  1X9Y A;  3KWB X;  1ATK A;  4I05 A;  1NB3 A;  3H8B A;  1MS6 A;  2AVW A;  3H8C A;  3V6C A;  2G8J A;  2ARY A;  1AYW A;  3P5U A;  4QRX A;  4HWY A;  2HHN A;  3E1Z B;  1NPZ A;  5J94 A;  1U5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...