1MIRA

Rat procathepsin b
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
313
structure length
313
Chain Sequence
SDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSSWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of rat procathepsin B: model for inhibition of cysteine protease activity by the proregion.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords PROCATHEPSIN B
total genus 61
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1996-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1mirA00
2OZ2A 2DZZA 4N79A 3QJ3A 2G8JA 3PDFA 1PADA 4FK5A 1ME3A 3PW3A 9PAPA 2DCBA 2JQGR 4FIPA 2NQDB 1ME4A 1F2AA 2YJCA 1YT7A 3DF0A 1YALA 4OELA 1KXRA 1U9WA 2YJ8A 1NB3A 4MZOA 4X6IA 1NLJA 2VHFA 5K16A 3IMAA 4YV8A 4MSXA 2B1NA 4QBBA 1KFUL 2YJ9A 1PIPA 1AU4A 4QH6A 2AYOA 3U8EA 2R6NA 3OF9A 1BQIA 3KX1A 1FH0A 4N4ZA 1ICFA 1POPA 3K8UA 2DJFB 1KFXL 1PE6A 2O6XA 2AUXA 2YJ2A 4PP2E 2P86A 4G54A 3PNRA 3KFQA 4WA6A 2XU5A 1MEGA 2YJBA 1STFE 4BS6A 2NQIA 3GCBA 3HD3A 4N8WA 5CHVA 1EWOA 2FQ9A 2ARYA 1TL9A 1KHQA 4X6HA 3BWKA 3CH3X 1THEA 3AI8A 1Y4HA 3K9MA 1GLOA 3N3KA 4FJCA 8PCHA 4MZSA 2F7DA 2HHNA 2AYNA 1ZIVA 2AS8A 3PBHA 1ZCMA 1ATKA 3USVA 1EWLA 4I05A 2E00A 3RVVA 2XU4A 2R9CA 3H89A 1U9VA 1QDQA 4QRGA 3CBKA 3P5VA 3BCNA 3V6EA 1NB5A 2FT2A 3KW9A 2IPPB 1MS6A 1S4VA 3QSDA 2AIMA 2DCDA 2R9MA 2AUZA 4X6JA 3BPFA 1A6RA 5EF4A 5FPWA 1BP4A 1EWPA 1CPJA 3NHEA 3M99A 1PPNA 3LFYA 2HXZA 4ZUXU 1X9YA 4BPVA 4PADA 2FTDA 2OULA 1EWMA 1DF0A 3KKUA 1M6DA 4HWYA 3P5UA 1EF7A 3IEJA 1CB5A 2R9OA 3IUTA 3O0UA 4DMXA 2OP3A 5CVNB 5PADA 1PXVA 5J94A 1MEMA 3P5XA 5CVOB 4W5CA 3I06A 1QMYA 4CDDB 1JQPA 5EGWA 4AXMA 4BS5A 3OF8A 1AU0A 4YYSA 1K3BB 3ZUAA 3E1ZB 3RVWA 2G6DA 1PCIA 1AU2A 3HHIA 5CVMA 2NQGA 2FRAA 2E03A 2E01A 1PPDA 3F5VA 1YK8A 2AU1A 3B79A 2DC7A 1Q6KA 1XKGA 2G8EA 1YVBA 4BQVA 3KSEA 2JQFR 2GFOA 4I07A 3TNXA 4PP1A 4YVAA 1AIMA 1AYVA 2FRQA 2Y5BA 3S3RA 3V6CA 2XU1A 4K7CA 6PADA 3BOWA 3P5WA 1CJLA 1HUCB 1QXPA 4W4UA 5JA7A 1Y08A 1ITOA 2PNSA 3OVZA 4OEMA 2PREA 2IBIA 4KLBA 2R9FA 3WXGA 1CV8A 1CS8A 3C9EA 3WXFA 2FO5A 1O0EA 1VJVA 1NPZA 3O1GA 4QRVA 3KWZA 1SNKA 7PCKA 3IHPA 4AXLA 3MORA 3HWNA 3MHHA 1F2BA 1NL6A 4CDEB 2P7UA 3S3QA 4YYVA 1CVZA 1AYWA 4RY2A 1CSBB 1TU6A 3F75A 1AECA 2ACTA 1KHPA 3ERVA 1U9QX 3N3GA 2HD5A 3BPMA 4Q8GA 3CH2X 2FUDA 1GECE 3HHAA 1MIRA 5A24A 2GHUA 4YYUA 2DJGB 1DEUA 4PI3A 3BC3A 1F2CA 5JH3A 4P6EA 4QRXA 1BY8A 2PBHA 4CDFB 2DZYA 1SP4B 4CDCB 2DC8A 2PADA 4BSQA 1AU3A 1TLOA 1PPPA 1CQDA 1AYUA 4YYWA 2Y6EA 2XU3A 3CBJA 4W5BA 3WXEA 4CZWA 2ATOA 1IWDA 1MDWA 4YYQA 1GMYA 1PBHA 2FYEA 1PPOA 3MHSA 2AVWA 2H7JA 2P0RA 3K24A 2G7YA 1BGOA 4DMYA 2B1MA 2C0YA 3H8CA 1GCBA 2DC9A 1U5IA 3IV2A 4I04A 4Q8HA 2BDZA 2CIOA 1NQCA 2E02A 3H6SA 3MTNA 1QOLA 2NQAA 5F02A 4P6GA 4YYRA 2VHSA 1CTEA 1VSNA 4XUIA 2DCAA 3QT4A 3OISA 3H7DA 2HH5A 3H8BA 3N4CA 3I3TA 2BDLA 1MHWA 1U9XA 3D6SA 2DCCA 3KWBX 2CB5A 5CHTA 3LXSA 4XR7A 2WBFX 3RVXA 1F29A 1YK7A 2DC6A 2F1GA 3IOQA 3OVXA 2R9NA
chains in the Genus database with same CATH superfamily
3RNVA 4BOPA 2OZ2A 2DZZA 4N79A 4RF1A 3QJ3A 2BTWA 4OVZA 3BBAA 2G8JA 3PDFA 1PADA 4FK5A 1ME3A 3PW3A 9PAPA 2DCBA 2JQGR 3BB7A 4D8EA 4FIPA 2NQDB 1ME4A 1F2AA 2YJCA 1YT7A 5JZEA 3DF0A 1YALA 4OELA 1KXRA 1U9WA 2YJ8A 1NB3A 4MZOA 4X6IA 1NLJA 2VHFA 5K16A 3IMAA 4YV8A 4MSXA 2B1NA 4QBBA 1KFUL 2BTWB 2YJ9A 4OVZB 1PIPA 1AU4A 4QH6A 4A5UA 2AYOA 4HXDB 4OW0A 3U8EA 2R6NA 3OF9A 1BQIA 3KX1A 1FH0A 4N4ZA 1ICFA 1POPA 3K8UA 2DJFB 1KFXL 1PE6A 2O6XA 2AUXA 2YJ2A 4PP2E 4BOQA 2P86A 4G54A 3PNRA 4P16A 3KFQA 4WA6A 4D8BA 2J7QA 2XU5A 1MEGA 2Z84A 2YJBA 1STFE 4BS6A 2NQIA 3GCBA 3HD3A 4N8WA 5CHVA 1EWOA 2AGAA 2FQ9A 2ARYA 1TL9A 1KHQA 3BWKA 4X6HA 3CH3X 4RNAA 3PRPA 1THEA 3AI8A 1Y4HA 3K9MA 3MTVA 1GLOA 3N3KA 4FJCA 8PCHA 4MZSA 2F7DA 2HHNA 2AYNA 1ZIVA 2AS8A 3BY4A 3PBHA 1ZCMA 1ATKA 3USVA 1EWLA 4RF0A 4BOSA 4I05A 2E00A 3RVVA 2XU4A 2R9CA 3H89A 1U9VA 1QDQA 4QRGA 3CBKA 4IUMA 3W31A 3P5VA 3BCNA 3V6EA 1NB5A 2FT2A 3KW9A 2IPPB 3MJ5A 4GUAA 1MS6A 1S4VA 3QSDA 2AIMA 2DCDA 2R9MA 2AUZA 4X6JA 3BPFA 1A6RA 5EF4A 5FPWA 1BP4A 1EWPA 1CPJA 3NHEA 3M99A 1PPNA 5E6JA 3LFYA 2HXZA 4ZUXU 1X9YA 4BPVA 1PVJA 4PADA 2FTDA 2OULA 5KO3A 1EWMA 1DF0A 1YZBA 3KKUA 1M6DA 4HWYA 3P5UA 1EF7A 3IEJA 1CB5A 2R9OA 3IUTA 3O0UA 4DMXA 2OP3A 5CVNB 5PADA 2FE8A 1PXVA 3PHWA 5J94A 3W30A 1MEMA 3P5XA 5CVOB 4W5CA 3I06A 1QMYA 4CDDB 1JQPA 5EGWA 4IP3A 4AXMA 3E9SA 4BS5A 3OF8A 1AU0A 4YYSA 1K3BB 3ZUAA 3E1ZB 3RVWA 2JTCA 2G6DA 1PCIA 2DOSA 1AU2A 3PSEA 3HHIA 2JRIA 5CVMA 2NQGA 2FRAA 2E03A 2E01A 1PPDA 3MP2A 3F5VA 1YK8A 2AU1A 3B79A 2DC7A 1Q6KA 1XKGA 4RKXA 2G8EA 1YVBA 4BQVA 3KSEA 2JQFR 2GFOA 4I07A 3TNXA 4PP1A 4YVAA 1AIMA 1AYVA 2FRQA 2Y5BA 3S3RA 3O65A 3V6CA 2XU1A 4K7CA 1UKFA 6PADA 3BOWA 3P5WA 1CJLA 1HUCB 1QXPA 4W4UA 5JA7A 3ZNHA 1Y08A 1ITOA 2PNSA 3OVZA 4OEMA 2PREA 2IBIA 4KLBA 2R9FA 1DKIA 3WXGA 1CV8A 4MI7A 1CS8A 4M0WA 3C9EA 3WXFA 2FO5A 1O0EA 3PT2A 1VJVA 1NPZA 3O1GA 4QRVA 3KWZA 1SNKA 5EZQA 7PCKA 3IHPA 4AXLA 3MORA 3HWNA 3MHHA 1F2BA 1NL6A 4R3DA 4CDEB 4BOUA 2P7UA 3S3QA 4YYVA 1CVZA 1AYWA 4RY2A 1CSBB 1TU6A 3F75A 1AECA 2ACTA 1KHPA 3ERVA 3PHUA 1U9QX 3N3GA 2HD5A 3BPMA 4Q8GA 3CH2X 5EZSA 2UZJA 2FUDA 1GECE 3HHAA 1MIRA 3IFUA 5A24A 2GHUA 4YYUA 2DJGB 4D8IA 1DEUA 4PI3A 3BC3A 1F2CA 5JH3A 4ZTBA 4P6EA 4QRXA 3PHXA 1BY8A 4PT5A 2PBHA 4CDFB 2DZYA 1SP4B 4CDCB 2BU3A 4BOZA 2DC8A 2PADA 3PRMA 4BSQA 1AU3A 1TLOA 1PPPA 1CQDA 1AYUA 4YYWA 2Y6EA 2XU3A 3CBJA 4W5BA 3WXEA 4CZWA 2ATOA 1IWDA 1MDWA 4YYQA 1GMYA 1PBHA 2FYEA 1PPOA 3MHSA 3C0RA 2AVWA 2H7JA 2P0RA 3K24A 2G7YA 3OQCA 4XZXA 1BGOA 4DMYA 2B1MA 2C0YA 3H8CA 1GCBA 2DC9A 1U5IA 3IV2A 4I04A 4Q8HA 2BDZA 2CIOA 1NQCA 2E02A 3H6SA 3B21A 3MTNA 1QOLA 2NQAA 5F02A 3TMPA 4P6GA 4YYRA 2VHSA 1CTEA 1VSNA 4REZA 3TRKA 4XUIA 2DCAA 3QT4A 4MM3B 3OISA 3H7DA 2HH5A 3H8BA 3N4CA 2J7QC 3I3TA 2BDLA 1MHWA 1U9XA 3D6SA 2DCCA 3KWBX 2CB5A 5CHTA 3LXSA 4XR7A 4WURA 2WBFX 3RVXA 2HWKA 1F29A 1YK7A 2DC6A 2F1GA 3IOQA 3OVXA 2R9NA
chains in the Genus database with same CATH topology
2OZ2A 2DZZA 4N79A 3QJ3A 2VFCA 2G8JA 3PDFA 1PADA 1W6FA 4FK5A 1ME3A 3PW3A 9PAPA 2DCBA 2JQGR 4FIPA 2NQDB 1ME4A 1W5RA 1F2AA 2YJCA 1YT7A 3DF0A 1YALA 4OELA 1KXRA 1U9WA 2YJ8A 1NB3A 4MZOA 4X6IA 1NLJA 2VHFA 5K16A 3IMAA 4YV8A 4MSXA 2B1NA 4QBBA 1KFUL 2YJ9A 1PIPA 1AU4A 4QH6A 2AYOA 3U8EA 2R6NA 3OF9A 1BQIA 3KX1A 1FH0A 4N4ZA 1ICFA 1POPA 3K8UA 2DJFB 1KFXL 1PE6A 2O6XA 2AUXA 2YJ2A 4PP2E 2P86A 4G54A 3PNRA 3KFQA 4WA6A 2XU5A 1MEGA 2YJBA 1STFE 4BS6A 2NQIA 3GCBA 3HD3A 2VFBA 4N8WA 5CHVA 1EWOA 2FQ9A 2ARYA 1TL9A 1KHQA 4X6HA 3BWKA 3CH3X 1THEA 3AI8A 1Y4HA 3K9MA 1GLOA 3N3KA 4FJCA 8PCHA 4MZSA 2F7DA 2HHNA 2AYNA 1ZIVA 2AS8A 3PBHA 1ZCMA 1ATKA 3USVA 1EWLA 4I05A 2E00A 3RVVA 2XU4A 2R9CA 3H89A 1U9VA 1QDQA 4QRGA 3CBKA 3P5VA 3BCNA 3V6EA 1NB5A 2FT2A 3KW9A 2IPPB 1MS6A 1S4VA 3QSDA 2AIMA 2DCDA 2R9MA 2AUZA 4X6JA 3BPFA 1A6RA 5EF4A 5FPWA 1BP4A 1EWPA 1CPJA 3NHEA 3M99A 1PPNA 3LFYA 2HXZA 4ZUXU 1X9YA 4BPVA 4PADA 2FTDA 2OULA 1EWMA 1DF0A 3KKUA 1M6DA 4HWYA 3P5UA 1EF7A 3IEJA 1CB5A 2R9OA 3IUTA 3O0UA 4DMXA 2OP3A 5CVNB 5PADA 1PXVA 5J94A 1MEMA 3P5XA 5CVOB 4W5CA 3I06A 1QMYA 4CDDB 1JQPA 5EGWA 4AXMA 4BS5A 3OF8A 1AU0A 4YYSA 1K3BB 1GX3A 3ZUAA 3E1ZB 3RVWA 4C5PA 2G6DA 1PCIA 1AU2A 3HHIA 5CVMA 2NQGA 2FRAA 2E03A 4B55A 2E01A 1PPDA 3F5VA 1YK8A 2AU1A 3B79A 2DC7A 1Q6KA 1XKGA 2BSZA 2G8EA 1YVBA 4BQVA 3KSEA 2JQFR 2GFOA 4I07A 3TNXA 4PP1A 4YVAA 1AIMA 1AYVA 2FRQA 2Y5BA 3S3RA 3D9WA 3V6CA 4GUZA 2XU1A 4K7CA 6PADA 3BOWA 3P5WA 1CJLA 1HUCB 1QXPA 4W4UA 5JA7A 1Y08A 1ITOA 2PNSA 3OVZA 4OEMA 2PREA 2IBIA 4KLBA 2R9FA 3WXGA 1CV8A 1CS8A 3C9EA 3WXFA 2FO5A 1O0EA 1VJVA 1NPZA 3O1GA 4QRVA 3KWZA 1SNKA 7PCKA 3IHPA 4AXLA 3MORA 3HWNA 3MHHA 1F2BA 1NL6A 1W4TA 4CDEB 2P7UA 3S3QA 4YYVA 1CVZA 1AYWA 4RY2A 1CSBB 1TU6A 3F75A 1AECA 2ACTA 1KHPA 3ERVA 1U9QX 3N3GA 2HD5A 3BPMA 4Q8GA 3CH2X 2FUDA 1GECE 3HHAA 1MIRA 5A24A 2GHUA 4YYUA 2DJGB 1DEUA 4PI3A 3BC3A 1F2CA 5JH3A 4P6EA 4QRXA 1BY8A 2PBHA 4CDFB 2DZYA 1SP4B 4CDCB 3LTWA 2DC8A 2PADA 4BSQA 1AU3A 1TLOA 1PPPA 1CQDA 1AYUA 4YYWA 2Y6EA 2XU3A 3CBJA 4W5BA 3WXEA 4CZWA 2ATOA 1IWDA 1MDWA 4YYQA 1GMYA 1PBHA 2FYEA 1PPOA 3MHSA 2AVWA 4NV7A 2H7JA 2P0RA 3K24A 2G7YA 1BGOA 1E2TA 4DMYA 2B1MA 2C0YA 3H8CA 1GCBA 2DC9A 1U5IA 3IV2A 4I04A 4Q8HA 2BDZA 2CIOA 1NQCA 2E02A 3H6SA 3MTNA 1QOLA 2NQAA 5F02A 4P6GA 4BGFA 4YYRA 2VHSA 1CTEA 1VSNA 4XUIA 2DCAA 3QT4A 3OISA 3H7DA 2HH5A 3H8BA 3N4CA 4NV8A 3I3TA 2BDLA 1MHWA 1U9XA 3D6SA 2DCCA 3KWBX 2CB5A 5CHTA 3LXSA 4XR7A 2WBFX 3RVXA 1F29A 1YK7A 2DC6A 2F1GA 3IOQA 3OVXA 2R9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZ2 A;  2DZZ A;  4N79 A;  3QJ3 A;  2G8J A;  3PDF A;  1PAD A;  4FK5 A;  1ME3 A;  3PW3 A;  9PAP A;  2DCB A;  2JQG R;  4FIP A;  2NQD B;  1ME4 A;  1F2A A;  2YJC A;  1YT7 A;  3DF0 A;  1YAL A;  4OEL A;  1KXR A;  1U9W A;  2YJ8 A;  1NB3 A;  4MZO A;  4X6I A;  1NLJ A;  2VHF A;  5K16 A;  3IMA A;  4YV8 A;  4MSX A;  2B1N A;  4QBB A;  1KFU L;  2YJ9 A;  1PIP A;  1AU4 A;  4QH6 A;  2AYO A;  3U8E A;  2R6N A;  3OF9 A;  1BQI A;  3KX1 A;  1FH0 A;  4N4Z A;  1ICF A;  1POP A;  3K8U A;  2DJF B;  1KFX L;  1PE6 A;  2O6X A;  2AUX A;  2YJ2 A;  4PP2 E;  2P86 A;  4G54 A;  3PNR A;  3KFQ A;  4WA6 A;  2XU5 A;  1MEG A;  2YJB A;  1STF E;  4BS6 A;  2NQI A;  3GCB A;  3HD3 A;  4N8W A;  5CHV A;  1EWO A;  2FQ9 A;  2ARY A;  1TL9 A;  1KHQ A;  4X6H A;  3BWK A;  3CH3 X;  1THE A;  3AI8 A;  1Y4H A;  3K9M A;  1GLO A;  3N3K A;  4FJC A;  8PCH A;  4MZS A;  2F7D A;  2HHN A;  2AYN A;  1ZIV A;  2AS8 A;  3PBH A;  1ZCM A;  1ATK A;  3USV A;  1EWL A;  4I05 A;  2E00 A;  3RVV A;  2XU4 A;  2R9C A;  3H89 A;  1U9V A;  1QDQ A;  4QRG A;  3CBK A;  3P5V A;  3BCN A;  3V6E A;  1NB5 A;  2FT2 A;  3KW9 A;  2IPP B;  1MS6 A;  1S4V A;  3QSD A;  2AIM A;  2DCD A;  2R9M A;  2AUZ A;  4X6J A;  3BPF A;  1A6R A;  5EF4 A;  5FPW A;  1BP4 A;  1EWP A;  1CPJ A;  3NHE A;  3M99 A;  1PPN A;  3LFY A;  2HXZ A;  4ZUX U;  1X9Y A;  4BPV A;  4PAD A;  2FTD A;  2OUL A;  1EWM A;  1DF0 A;  3KKU A;  1M6D A;  4HWY A;  3P5U A;  1EF7 A;  3IEJ A;  1CB5 A;  2R9O A;  3IUT A;  3O0U A;  4DMX A;  2OP3 A;  5CVN B;  5PAD A;  1PXV A;  5J94 A;  1MEM A;  3P5X A;  5CVO B;  4W5C A;  3I06 A;  1QMY A;  4CDD B;  1JQP A;  5EGW A;  4AXM A;  4BS5 A;  3OF8 A;  1AU0 A;  4YYS A;  1K3B B;  3ZUA A;  3E1Z B;  3RVW A;  2G6D A;  1PCI A;  1AU2 A;  3HHI A;  5CVM A;  2NQG A;  2FRA A;  2E03 A;  2E01 A;  1PPD A;  3F5V A;  1YK8 A;  2AU1 A;  3B79 A;  2DC7 A;  1Q6K A;  1XKG A;  2G8E A;  1YVB A;  4BQV A;  3KSE A;  2JQF R;  2GFO A;  4I07 A;  3TNX A;  4PP1 A;  4YVA A;  1AIM A;  1AYV A;  2FRQ A;  2Y5B A;  3S3R A;  3V6C A;  2XU1 A;  4K7C A;  6PAD A;  3BOW A;  3P5W A;  1CJL A;  1HUC B;  1QXP A;  4W4U A;  5JA7 A;  1Y08 A;  1ITO A;  2PNS A;  3OVZ A;  4OEM A;  2PRE A;  2IBI A;  4KLB A;  2R9F A;  3WXG A;  1CV8 A;  1CS8 A;  3C9E A;  3WXF A;  2FO5 A;  1O0E A;  1VJV A;  1NPZ A;  3O1G A;  4QRV A;  3KWZ A;  1SNK A;  7PCK A;  3IHP A;  4AXL A;  3MOR A;  3HWN A;  3MHH A;  1F2B A;  1NL6 A;  4CDE B;  2P7U A;  3S3Q A;  4YYV A;  1CVZ A;  1AYW A;  4RY2 A;  1CSB B;  1TU6 A;  3F75 A;  1AEC A;  2ACT A;  1KHP A;  3ERV A;  1U9Q X;  3N3G A;  2HD5 A;  3BPM A;  4Q8G A;  3CH2 X;  2FUD A;  1GEC E;  3HHA A;  1MIR A;  5A24 A;  2GHU A;  4YYU A;  2DJG B;  1DEU A;  4PI3 A;  3BC3 A;  1F2C A;  5JH3 A;  4P6E A;  4QRX A;  1BY8 A;  2PBH A;  4CDF B;  2DZY A;  1SP4 B;  4CDC B;  2DC8 A;  2PAD A;  4BSQ A;  1AU3 A;  1TLO A;  1PPP A;  1CQD A;  1AYU A;  4YYW A;  2Y6E A;  2XU3 A;  3CBJ A;  4W5B A;  3WXE A;  4CZW A;  2ATO A;  1IWD A;  1MDW A;  4YYQ A;  1GMY A;  1PBH A;  2FYE A;  1PPO A;  3MHS A;  2AVW A;  2H7J A;  2P0R A;  3K24 A;  2G7Y A;  1BGO A;  4DMY A;  2B1M A;  2C0Y A;  3H8C A;  1GCB A;  2DC9 A;  1U5I A;  3IV2 A;  4I04 A;  4Q8H A;  2BDZ A;  2CIO A;  1NQC A;  2E02 A;  3H6S A;  3MTN A;  1QOL A;  2NQA A;  5F02 A;  4P6G A;  4YYR A;  2VHS A;  1CTE A;  1VSN A;  4XUI A;  2DCA A;  3QT4 A;  3OIS A;  3H7D A;  2HH5 A;  3H8B A;  3N4C A;  3I3T A;  2BDL A;  1MHW A;  1U9X A;  3D6S A;  2DCC A;  3KWB X;  2CB5 A;  5CHT A;  3LXS A;  4XR7 A;  2WBF X;  3RVX A;  1F29 A;  1YK7 A;  2DC6 A;  2F1G A;  3IOQ A;  3OVX A;  2R9N A; 
#chains in the Genus database with same CATH topology
 3RNV A;  4BOP A;  2OZ2 A;  2DZZ A;  4N79 A;  4RF1 A;  3QJ3 A;  2BTW A;  4OVZ A;  3BBA A;  2G8J A;  3PDF A;  1PAD A;  4FK5 A;  1ME3 A;  3PW3 A;  9PAP A;  2DCB A;  2JQG R;  3BB7 A;  4D8E A;  4FIP A;  2NQD B;  1ME4 A;  1F2A A;  2YJC A;  1YT7 A;  5JZE A;  3DF0 A;  1YAL A;  4OEL A;  1KXR A;  1U9W A;  2YJ8 A;  1NB3 A;  4MZO A;  4X6I A;  1NLJ A;  2VHF A;  5K16 A;  3IMA A;  4YV8 A;  4MSX A;  2B1N A;  4QBB A;  1KFU L;  2BTW B;  2YJ9 A;  4OVZ B;  1PIP A;  1AU4 A;  4QH6 A;  4A5U A;  2AYO A;  4HXD B;  4OW0 A;  3U8E A;  2R6N A;  3OF9 A;  1BQI A;  3KX1 A;  1FH0 A;  4N4Z A;  1ICF A;  1POP A;  3K8U A;  2DJF B;  1KFX L;  1PE6 A;  2O6X A;  2AUX A;  2YJ2 A;  4PP2 E;  4BOQ A;  2P86 A;  4G54 A;  3PNR A;  4P16 A;  3KFQ A;  4WA6 A;  4D8B A;  2J7Q A;  2XU5 A;  1MEG A;  2Z84 A;  2YJB A;  1STF E;  4BS6 A;  2NQI A;  3GCB A;  3HD3 A;  4N8W A;  5CHV A;  1EWO A;  2AGA A;  2FQ9 A;  2ARY A;  1TL9 A;  1KHQ A;  3BWK A;  4X6H A;  3CH3 X;  4RNA A;  3PRP A;  1THE A;  3AI8 A;  1Y4H A;  3K9M A;  3MTV A;  1GLO A;  3N3K A;  4FJC A;  8PCH A;  4MZS A;  2F7D A;  2HHN A;  2AYN A;  1ZIV A;  2AS8 A;  3BY4 A;  3PBH A;  1ZCM A;  1ATK A;  3USV A;  1EWL A;  4RF0 A;  4BOS A;  4I05 A;  2E00 A;  3RVV A;  2XU4 A;  2R9C A;  3H89 A;  1U9V A;  1QDQ A;  4QRG A;  3CBK A;  4IUM A;  3W31 A;  3P5V A;  3BCN A;  3V6E A;  1NB5 A;  2FT2 A;  3KW9 A;  2IPP B;  3MJ5 A;  4GUA A;  1MS6 A;  1S4V A;  3QSD A;  2AIM A;  2DCD A;  2R9M A;  2AUZ A;  4X6J A;  3BPF A;  1A6R A;  5EF4 A;  5FPW A;  1BP4 A;  1EWP A;  1CPJ A;  3NHE A;  3M99 A;  1PPN A;  5E6J A;  3LFY A;  2HXZ A;  4ZUX U;  1X9Y A;  4BPV A;  1PVJ A;  4PAD A;  2FTD A;  2OUL A;  5KO3 A;  1EWM A;  1DF0 A;  1YZB A;  3KKU A;  1M6D A;  4HWY A;  3P5U A;  1EF7 A;  3IEJ A;  1CB5 A;  2R9O A;  3IUT A;  3O0U A;  4DMX A;  2OP3 A;  5CVN B;  5PAD A;  2FE8 A;  1PXV A;  3PHW A;  5J94 A;  3W30 A;  1MEM A;  3P5X A;  5CVO B;  4W5C A;  3I06 A;  1QMY A;  4CDD B;  1JQP A;  5EGW A;  4IP3 A;  4AXM A;  3E9S A;  4BS5 A;  3OF8 A;  1AU0 A;  4YYS A;  1K3B B;  3ZUA A;  3E1Z B;  3RVW A;  2JTC A;  2G6D A;  1PCI A;  2DOS A;  1AU2 A;  3PSE A;  3HHI A;  2JRI A;  5CVM A;  2NQG A;  2FRA A;  2E03 A;  2E01 A;  1PPD A;  3MP2 A;  3F5V A;  1YK8 A;  2AU1 A;  3B79 A;  2DC7 A;  1Q6K A;  1XKG A;  4RKX A;  2G8E A;  1YVB A;  4BQV A;  3KSE A;  2JQF R;  2GFO A;  4I07 A;  3TNX A;  4PP1 A;  4YVA A;  1AIM A;  1AYV A;  2FRQ A;  2Y5B A;  3S3R A;  3O65 A;  3V6C A;  2XU1 A;  4K7C A;  1UKF A;  6PAD A;  3BOW A;  3P5W A;  1CJL A;  1HUC B;  1QXP A;  4W4U A;  5JA7 A;  3ZNH A;  1Y08 A;  1ITO A;  2PNS A;  3OVZ A;  4OEM A;  2PRE A;  2IBI A;  4KLB A;  2R9F A;  1DKI A;  3WXG A;  1CV8 A;  4MI7 A;  1CS8 A;  4M0W A;  3C9E A;  3WXF A;  2FO5 A;  1O0E A;  3PT2 A;  1VJV A;  1NPZ A;  3O1G A;  4QRV A;  3KWZ A;  1SNK A;  5EZQ A;  7PCK A;  3IHP A;  4AXL A;  3MOR A;  3HWN A;  3MHH A;  1F2B A;  1NL6 A;  4R3D A;  4CDE B;  4BOU A;  2P7U A;  3S3Q A;  4YYV A;  1CVZ A;  1AYW A;  4RY2 A;  1CSB B;  1TU6 A;  3F75 A;  1AEC A;  2ACT A;  1KHP A;  3ERV A;  3PHU A;  1U9Q X;  3N3G A;  2HD5 A;  3BPM A;  4Q8G A;  3CH2 X;  5EZS A;  2UZJ A;  2FUD A;  1GEC E;  3HHA A;  1MIR A;  3IFU A;  5A24 A;  2GHU A;  4YYU A;  2DJG B;  4D8I A;  1DEU A;  4PI3 A;  3BC3 A;  1F2C A;  5JH3 A;  4ZTB A;  4P6E A;  4QRX A;  3PHX A;  1BY8 A;  4PT5 A;  2PBH A;  4CDF B;  2DZY A;  1SP4 B;  4CDC B;  2BU3 A;  4BOZ A;  2DC8 A;  2PAD A;  3PRM A;  4BSQ A;  1AU3 A;  1TLO A;  1PPP A;  1CQD A;  1AYU A;  4YYW A;  2Y6E A;  2XU3 A;  3CBJ A;  4W5B A;  3WXE A;  4CZW A;  2ATO A;  1IWD A;  1MDW A;  4YYQ A;  1GMY A;  1PBH A;  2FYE A;  1PPO A;  3MHS A;  3C0R A;  2AVW A;  2H7J A;  2P0R A;  3K24 A;  2G7Y A;  3OQC A;  4XZX A;  1BGO A;  4DMY A;  2B1M A;  2C0Y A;  3H8C A;  1GCB A;  2DC9 A;  1U5I A;  3IV2 A;  4I04 A;  4Q8H A;  2BDZ A;  2CIO A;  1NQC A;  2E02 A;  3H6S A;  3B21 A;  3MTN A;  1QOL A;  2NQA A;  5F02 A;  3TMP A;  4P6G A;  4YYR A;  2VHS A;  1CTE A;  1VSN A;  4REZ A;  3TRK A;  4XUI A;  2DCA A;  3QT4 A;  4MM3 B;  3OIS A;  3H7D A;  2HH5 A;  3H8B A;  3N4C A;  2J7Q C;  3I3T A;  2BDL A;  1MHW A;  1U9X A;  3D6S A;  2DCC A;  3KWB X;  2CB5 A;  5CHT A;  3LXS A;  4XR7 A;  4WUR A;  2WBF X;  3RVX A;  2HWK A;  1F29 A;  1YK7 A;  2DC6 A;  2F1G A;  3IOQ A;  3OVX A;  2R9N A; 
#chains in the Genus database with same CATH homology
 2OZ2 A;  2DZZ A;  4N79 A;  3QJ3 A;  2VFC A;  2G8J A;  3PDF A;  1PAD A;  1W6F A;  4FK5 A;  1ME3 A;  3PW3 A;  9PAP A;  2DCB A;  2JQG R;  4FIP A;  2NQD B;  1ME4 A;  1W5R A;  1F2A A;  2YJC A;  1YT7 A;  3DF0 A;  1YAL A;  4OEL A;  1KXR A;  1U9W A;  2YJ8 A;  1NB3 A;  4MZO A;  4X6I A;  1NLJ A;  2VHF A;  5K16 A;  3IMA A;  4YV8 A;  4MSX A;  2B1N A;  4QBB A;  1KFU L;  2YJ9 A;  1PIP A;  1AU4 A;  4QH6 A;  2AYO A;  3U8E A;  2R6N A;  3OF9 A;  1BQI A;  3KX1 A;  1FH0 A;  4N4Z A;  1ICF A;  1POP A;  3K8U A;  2DJF B;  1KFX L;  1PE6 A;  2O6X A;  2AUX A;  2YJ2 A;  4PP2 E;  2P86 A;  4G54 A;  3PNR A;  3KFQ A;  4WA6 A;  2XU5 A;  1MEG A;  2YJB A;  1STF E;  4BS6 A;  2NQI A;  3GCB A;  3HD3 A;  2VFB A;  4N8W A;  5CHV A;  1EWO A;  2FQ9 A;  2ARY A;  1TL9 A;  1KHQ A;  4X6H A;  3BWK A;  3CH3 X;  1THE A;  3AI8 A;  1Y4H A;  3K9M A;  1GLO A;  3N3K A;  4FJC A;  8PCH A;  4MZS A;  2F7D A;  2HHN A;  2AYN A;  1ZIV A;  2AS8 A;  3PBH A;  1ZCM A;  1ATK A;  3USV A;  1EWL A;  4I05 A;  2E00 A;  3RVV A;  2XU4 A;  2R9C A;  3H89 A;  1U9V A;  1QDQ A;  4QRG A;  3CBK A;  3P5V A;  3BCN A;  3V6E A;  1NB5 A;  2FT2 A;  3KW9 A;  2IPP B;  1MS6 A;  1S4V A;  3QSD A;  2AIM A;  2DCD A;  2R9M A;  2AUZ A;  4X6J A;  3BPF A;  1A6R A;  5EF4 A;  5FPW A;  1BP4 A;  1EWP A;  1CPJ A;  3NHE A;  3M99 A;  1PPN A;  3LFY A;  2HXZ A;  4ZUX U;  1X9Y A;  4BPV A;  4PAD A;  2FTD A;  2OUL A;  1EWM A;  1DF0 A;  3KKU A;  1M6D A;  4HWY A;  3P5U A;  1EF7 A;  3IEJ A;  1CB5 A;  2R9O A;  3IUT A;  3O0U A;  4DMX A;  2OP3 A;  5CVN B;  5PAD A;  1PXV A;  5J94 A;  1MEM A;  3P5X A;  5CVO B;  4W5C A;  3I06 A;  1QMY A;  4CDD B;  1JQP A;  5EGW A;  4AXM A;  4BS5 A;  3OF8 A;  1AU0 A;  4YYS A;  1K3B B;  1GX3 A;  3ZUA A;  3E1Z B;  3RVW A;  4C5P A;  2G6D A;  1PCI A;  1AU2 A;  3HHI A;  5CVM A;  2NQG A;  2FRA A;  2E03 A;  4B55 A;  2E01 A;  1PPD A;  3F5V A;  1YK8 A;  2AU1 A;  3B79 A;  2DC7 A;  1Q6K A;  1XKG A;  2BSZ A;  2G8E A;  1YVB A;  4BQV A;  3KSE A;  2JQF R;  2GFO A;  4I07 A;  3TNX A;  4PP1 A;  4YVA A;  1AIM A;  1AYV A;  2FRQ A;  2Y5B A;  3S3R A;  3D9W A;  3V6C A;  4GUZ A;  2XU1 A;  4K7C A;  6PAD A;  3BOW A;  3P5W A;  1CJL A;  1HUC B;  1QXP A;  4W4U A;  5JA7 A;  1Y08 A;  1ITO A;  2PNS A;  3OVZ A;  4OEM A;  2PRE A;  2IBI A;  4KLB A;  2R9F A;  3WXG A;  1CV8 A;  1CS8 A;  3C9E A;  3WXF A;  2FO5 A;  1O0E A;  1VJV A;  1NPZ A;  3O1G A;  4QRV A;  3KWZ A;  1SNK A;  7PCK A;  3IHP A;  4AXL A;  3MOR A;  3HWN A;  3MHH A;  1F2B A;  1NL6 A;  1W4T A;  4CDE B;  2P7U A;  3S3Q A;  4YYV A;  1CVZ A;  1AYW A;  4RY2 A;  1CSB B;  1TU6 A;  3F75 A;  1AEC A;  2ACT A;  1KHP A;  3ERV A;  1U9Q X;  3N3G A;  2HD5 A;  3BPM A;  4Q8G A;  3CH2 X;  2FUD A;  1GEC E;  3HHA A;  1MIR A;  5A24 A;  2GHU A;  4YYU A;  2DJG B;  1DEU A;  4PI3 A;  3BC3 A;  1F2C A;  5JH3 A;  4P6E A;  4QRX A;  1BY8 A;  2PBH A;  4CDF B;  2DZY A;  1SP4 B;  4CDC B;  3LTW A;  2DC8 A;  2PAD A;  4BSQ A;  1AU3 A;  1TLO A;  1PPP A;  1CQD A;  1AYU A;  4YYW A;  2Y6E A;  2XU3 A;  3CBJ A;  4W5B A;  3WXE A;  4CZW A;  2ATO A;  1IWD A;  1MDW A;  4YYQ A;  1GMY A;  1PBH A;  2FYE A;  1PPO A;  3MHS A;  2AVW A;  4NV7 A;  2H7J A;  2P0R A;  3K24 A;  2G7Y A;  1BGO A;  1E2T A;  4DMY A;  2B1M A;  2C0Y A;  3H8C A;  1GCB A;  2DC9 A;  1U5I A;  3IV2 A;  4I04 A;  4Q8H A;  2BDZ A;  2CIO A;  1NQC A;  2E02 A;  3H6S A;  3MTN A;  1QOL A;  2NQA A;  5F02 A;  4P6G A;  4BGF A;  4YYR A;  2VHS A;  1CTE A;  1VSN A;  4XUI A;  2DCA A;  3QT4 A;  3OIS A;  3H7D A;  2HH5 A;  3H8B A;  3N4C A;  4NV8 A;  3I3T A;  2BDL A;  1MHW A;  1U9X A;  3D6S A;  2DCC A;  3KWB X;  2CB5 A;  5CHT A;  3LXS A;  4XR7 A;  2WBF X;  3RVX A;  1F29 A;  1YK7 A;  2DC6 A;  2F1G A;  3IOQ A;  3OVX A;  2R9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...