1MIRA

Rat procathepsin b
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
313
structure length
313
Chain Sequence
SDDMINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSSWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVSGGVYNSHIGCLPYTIPPCEHHVNGARPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGIENGVPYWLVANSWNADWGDNGFFKILRGENHCGIESEIVAGIPRTQQYWGRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of rat procathepsin B: model for inhibition of cysteine protease activity by the proregion.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords PROCATHEPSIN B
total genus 61
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 1996-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1mirA00
1MDWA 3KSEA 3DF0A 2VHFA 1ITOA 1CJLA 1MEMA 4QBBA 1AIMA 3N4CA 1QXPA 2FO5A 3BPFA 4N79A 1GECE 2ATOA 1POPA 2HD5A 3P5VA 4PP2E 1BQIA 1KFUL 4X6HA 1THEA 4X6IA 3F75A 3V6EA 4X6JA 2P0RA 3BWKA 2ARYA 4N4ZA 3P5XA 3BOWA 2PREA 1O0EA 3RVVA 4W4UA 1Y08A 2DCAA 3D6SA 5CVNB 4YYRA 4DMXA 2IBIA 2H7JA 1ZIVA 1U9VA 4W5BA 3TNXA 2R9MA 2E02A 2DZZA 5CHVA 4MZSA 1IWDA 3WXGA 5JH3A 3B79A 2FQ9A 1Q6KA 1PPOA 3OF9A 4Q8GA 4YYVA 3WXFA 2AUXA 2GHUA 3MHHA 2BDZA 2YJ8A 3KKUA 2R6NA 3WXEA 2XU5A 1X9YA 4BQVA 4I04A 1K3BB 1AU0A 1AU3A 3O1GA 4FK5A 2E01A 3M99A 3ERVA 2G6DA 3KFQA 3S3QA 1TL9A 1KHPA 4PP1A 4BPVA 1VJVA 5K16A 3K24A 3KWBX 4I05A 2NQDB 3MTNA 4MSXA 3IV2A 1CS8A 4Q8HA 2O6XA 1AYVA 2G8EA 1AYUA 2DCDA 1YT7A 2P86A 5J94A 2HXZA 1F2AA 2NQIA 5JA7A 1U9XA 1XKGA 3E1ZB 2CIOA 3AI8A 1MS6A 8PCHA 3IHPA 3P5UA 4I07A 3BCNA 5EF4A 1CPJA 1GLOA 2FYEA 2OULA 1ME3A 1PPNA 1SNKA 7PCKA 1KXRA 5CVMA 2DCBA 1F29A 4DMYA 1NLJA 2XU3A 3H8CA 3RVWA 5EGWA 1U9QX 4YVAA 2FT2A 4PADA 3HHIA 4CDEB 1CV8A 3K9MA 3N3KA 1EWOA 2E00A 3PNRA 3KWZA 5PADA 9PAPA 2Y5BA 2P7UA 3OVZA 2AVWA 1CQDA 3I3TA 1YK7A 4K7CA 2DC8A 4XUIA 2C0YA 3KW9A 1MEGA 1PPPA 1PADA 3LFYA 5CHTA 3IOQA 1U5IA 4CDFB 2B1NA 4P6EA 2FRQA 3BC3A 2AS8A 1KFXL 1AYWA 2HHNA 2NQGA 1PXVA 2ACTA 4WA6A 1DF0A 3OISA 1M6DA 2DC9A 3U8EA 1MHWA 3LXSA 4N8WA 3I06A 3QT4A 2B1MA 1FH0A 1KHQA 3P5WA 1PE6A 4YYUA 1YK8A 1MIRA 2FTDA 1EWPA 3QSDA 4AXLA 1CTEA 3N3GA 2AUZA 1NL6A 4YYQA 1ICFA 3CBJA 5F02A 3K8UA 3BPMA 3RVXA 3ZUAA 2XU4A 3CH3X 1BP4A 1SP4B 3OF8A 2YJBA 3H89A 1S4VA 2GFOA 4QRGA 5A24A 2OP3A 4CZWA 5FPWA 1CB5A 2PNSA 4P6GA 1F2CA 1ZCMA 2CB5A 1PCIA 2DC6A 2DZYA 2IPPB 4W5CA 2F7DA 1JQPA 4YYSA 2G8JA 2NQAA 3CH2X 1CVZA 3H7DA 1DEUA 1EF7A 1YVBA 2OZ2A 4HWYA 2DJGB 2BDLA 3IMAA 2AYOA 1NPZA 3H8BA 3S3RA 3HWNA 4CDDB 1QDQA 2XU1A 1BY8A 1TU6A 1QMYA 2DCCA 1EWMA 4G54A 1QOLA 1U9WA 2JQGR 1GMYA 1AU4A 4RY2A 1AECA 3CBKA 3MHSA 1HUCB 4FIPA 3HHAA 3USVA 5CVOB 2R9FA 4XR7A 1NQCA 3O0UA 4BS6A 1A6RA 3IEJA 2FUDA 2YJ2A 1PIPA 1GCBA 2YJ9A 6PADA 2VHSA 4BSQA 4YYWA 4YV8A 2WBFX 3NHEA 4QRXA 1YALA 3KX1A 2F1GA 2AU1A 2YJCA 2JQFR 3C9EA 4PI3A 1Y4HA 3HD3A 1VSNA 2AIMA 4OEMA 3MORA 2PADA 1EWLA 2HH5A 4CDCB 4QH6A 4ZUXU 3OVXA 3V6CA 1PBHA 1F2BA 4KLBA 2DC7A 3QJ3A 1TLOA 3PW3A 4QRVA 3IUTA 1NB5A 1CSBB 2R9OA 4AXMA 1BGOA 4OELA 2E03A 1STFE 2R9CA 2Y6EA 1ATKA 2FRAA 1AU2A 3H6SA 3F5VA 2DJFB 2G7YA 3PBHA 2AYNA 3GCBA 1NB3A 2PBHA 1ME4A 4MZOA 1PPDA 4BS5A 3PDFA 4FJCA 2R9NA
chains in the Genus database with same CATH superfamily
1MDWA 3KSEA 3DF0A 2VHFA 1ITOA 1CJLA 1MEMA 2J7QC 4QBBA 1AIMA 3N4CA 1QXPA 3PSEA 2FO5A 4D8BA 3BPFA 4N79A 1GECE 2ATOA 3BY4A 1POPA 3TRKA 2HD5A 3P5VA 4PP2E 1BQIA 1KFUL 4X6HA 1THEA 4IP3A 4X6IA 3F75A 3V6EA 4X6JA 2P0RA 3BWKA 2ARYA 4N4ZA 3P5XA 3BOWA 2PREA 1O0EA 3RVVA 4W4UA 1Y08A 2DCAA 3D6SA 5CVNB 4MM3B 4YYRA 4DMXA 2IBIA 2H7JA 1ZIVA 1U9VA 4W5BA 4P16A 3TNXA 4XZXA 2R9MA 2E02A 2DZZA 5CHVA 4MZSA 1IWDA 4RNAA 3ZNHA 3WXGA 2HWKA 5JH3A 3B79A 3TMPA 2FQ9A 1Q6KA 1PPOA 3OF9A 4Q8GA 4YYVA 3WXFA 4R3DA 2AUXA 2GHUA 3MHHA 2BDZA 1DKIA 2YJ8A 2J7QA 3KKUA 2R6NA 4GUAA 3WXEA 2XU5A 1X9YA 4BQVA 4RF0A 4I04A 1K3BB 1AU0A 1AU3A 3O1GA 4FK5A 2E01A 3M99A 3ERVA 2G6DA 4PT5A 4A5UA 3KFQA 2JTCA 3S3QA 1TL9A 1KHPA 4PP1A 4BPVA 4OVZB 1VJVA 2Z84A 5K16A 3K24A 3KWBX 4I05A 2NQDB 3MTNA 4MSXA 3IV2A 1CS8A 4Q8HA 2O6XA 3B21A 1AYVA 2G8EA 1AYUA 2DCDA 1YT7A 3MJ5A 2P86A 5EZSA 5J94A 2HXZA 1UKFA 1F2AA 2NQIA 3E9SA 5JA7A 1U9XA 1XKGA 3E1ZB 2CIOA 3AI8A 3PRMA 1MS6A 8PCHA 3O65A 3IHPA 3P5UA 4I07A 4BOPA 3BCNA 5EF4A 1CPJA 1GLOA 2FYEA 2OULA 1ME3A 1PPNA 1SNKA 7PCKA 1KXRA 5CVMA 2DCBA 1F29A 4DMYA 1NLJA 3PHWA 2XU3A 3H8CA 3RVWA 5EGWA 1U9QX 4YVAA 4WURA 2FT2A 4PADA 3HHIA 4CDEB 1CV8A 3K9MA 4OVZA 3N3KA 1EWOA 2E00A 4REZA 5KO3A 3PNRA 3KWZA 5PADA 4D8EA 2Y5BA 2P7UA 9PAPA 3OVZA 2AVWA 1CQDA 3I3TA 1YK7A 4K7CA 2DC8A 3MTVA 4ZTBA 2C0YA 4XUIA 2BU3A 3KW9A 1MEGA 1PPPA 1PADA 3LFYA 5CHTA 3IOQA 1U5IA 4CDFB 2B1NA 4P6EA 3RNVA 2FRQA 3BC3A 3MP2A 2AS8A 1KFXL 1AYWA 2HHNA 2NQGA 1PXVA 2AGAA 2ACTA 3OQCA 4M0WA 4WA6A 1DF0A 3OISA 5EZQA 1M6DA 2DC9A 3U8EA 1MHWA 3LXSA 4N8WA 3I06A 3QT4A 2B1MA 1FH0A 1KHQA 3P5WA 1PE6A 4YYUA 1YK8A 1MIRA 2FTDA 4IUMA 1EWPA 3QSDA 4AXLA 1CTEA 3N3GA 2AUZA 4BOUA 1NL6A 4BOSA 4YYQA 1ICFA 3CBJA 5F02A 3K8UA 3BPMA 3RVXA 3ZUAA 2XU4A 3CH3X 1BP4A 1SP4B 3OF8A 2YJBA 3H89A 4BOQA 1S4VA 2GFOA 4QRGA 5A24A 2OP3A 4CZWA 5JZEA 4OW0A 5FPWA 1CB5A 2PNSA 4P6GA 1F2CA 1ZCMA 2CB5A 1PCIA 2DC6A 2DZYA 2IPPB 4W5CA 2F7DA 1JQPA 4HXDB 4YYSA 2G8JA 2NQAA 3CH2X 1CVZA 3H7DA 1DEUA 1EF7A 1YVBA 3PT2A 3W31A 3PRPA 2OZ2A 4HWYA 2DJGB 2BDLA 3IMAA 2AYOA 1NPZA 3H8BA 3S3RA 3HWNA 4CDDB 1QDQA 2XU1A 1BY8A 1TU6A 1QMYA 5E6JA 2DCCA 1EWMA 4G54A 1QOLA 1U9WA 2JQGR 1GMYA 1AU4A 4RY2A 1AECA 3CBKA 3MHSA 1HUCB 4FIPA 3HHAA 3USVA 5CVOB 2R9FA 4XR7A 1NQCA 3O0UA 4BS6A 1A6RA 3IEJA 2FUDA 2YJ2A 1PIPA 1GCBA 1PVJA 2YJ9A 6PADA 4BOZA 2VHSA 3PHUA 4BSQA 2UZJA 4YYWA 2BTWA 4YV8A 2WBFX 3NHEA 4QRXA 1YALA 3BB7A 3KX1A 2F1GA 4RKXA 2AU1A 2YJCA 2JQFR 3C9EA 2DOSA 4PI3A 2JRIA 1Y4HA 3HD3A 1VSNA 2AIMA 4OEMA 4RF1A 3MORA 2PADA 1EWLA 2HH5A 4CDCB 4QH6A 4ZUXU 3W30A 3OVXA 3V6CA 1PBHA 2FE8A 1F2BA 4KLBA 2DC7A 3QJ3A 4D8IA 1TLOA 3PW3A 4QRVA 3IUTA 1NB5A 1CSBB 2R9OA 2BTWB 3PHXA 4AXMA 1BGOA 4OELA 2E03A 1STFE 2R9CA 2Y6EA 1ATKA 2FRAA 1AU2A 3H6SA 3F5VA 3BBAA 2DJFB 2G7YA 3IFUA 2AYNA 3GCBA 3PBHA 1NB3A 1YZBA 2PBHA 1ME4A 4MZOA 1PPDA 4BS5A 3C0RA 4MI7A 3PDFA 4FJCA 2R9NA
chains in the Genus database with same CATH topology
1MDWA 3KSEA 3DF0A 2VHFA 1ITOA 1CJLA 1MEMA 4QBBA 1AIMA 3N4CA 1QXPA 2FO5A 3BPFA 4N79A 1GECE 2ATOA 1POPA 2HD5A 3P5VA 4PP2E 1BQIA 1KFUL 4X6HA 1THEA 4X6IA 3F75A 3V6EA 4X6JA 2P0RA 3BWKA 2ARYA 4N4ZA 3P5XA 3BOWA 2PREA 1O0EA 3RVVA 4W4UA 1Y08A 2DCAA 3D6SA 5CVNB 4YYRA 4DMXA 2IBIA 2H7JA 1ZIVA 1U9VA 4W5BA 3TNXA 2R9MA 2E02A 2DZZA 5CHVA 4MZSA 1IWDA 3WXGA 5JH3A 3B79A 2FQ9A 1Q6KA 1PPOA 3OF9A 4Q8GA 4YYVA 3WXFA 2AUXA 2GHUA 3MHHA 1W5RA 2BDZA 4GUZA 3LTWA 2YJ8A 3KKUA 2R6NA 3WXEA 2XU5A 1X9YA 4BQVA 4I04A 1K3BB 1AU0A 1AU3A 3O1GA 4FK5A 2E01A 3M99A 3ERVA 2G6DA 3KFQA 3S3QA 1TL9A 1KHPA 4PP1A 4BPVA 4B55A 1VJVA 5K16A 3K24A 3KWBX 4I05A 2NQDB 3MTNA 4MSXA 3IV2A 1CS8A 4Q8HA 2O6XA 1AYVA 2G8EA 1AYUA 2DCDA 1YT7A 2P86A 5J94A 2HXZA 1F2AA 2NQIA 5JA7A 1U9XA 1XKGA 3E1ZB 2CIOA 3AI8A 4C5PA 1MS6A 8PCHA 3IHPA 3P5UA 4I07A 3BCNA 5EF4A 1CPJA 1GLOA 2FYEA 2OULA 1ME3A 1PPNA 1SNKA 7PCKA 1KXRA 5CVMA 2DCBA 1F29A 4DMYA 1NLJA 4NV8A 2XU3A 3H8CA 3RVWA 5EGWA 1U9QX 4YVAA 2FT2A 4PADA 3HHIA 4CDEB 1CV8A 3K9MA 3N3KA 1EWOA 2E00A 3PNRA 3KWZA 5PADA 9PAPA 2Y5BA 2P7UA 3D9WA 3OVZA 2AVWA 1CQDA 3I3TA 1YK7A 4K7CA 2DC8A 4XUIA 2C0YA 3KW9A 1MEGA 1PPPA 1W4TA 1PADA 3LFYA 5CHTA 3IOQA 1U5IA 4CDFB 2B1NA 4P6EA 2FRQA 3BC3A 2AS8A 1KFXL 1AYWA 2HHNA 2NQGA 1PXVA 2ACTA 2VFBA 4WA6A 1DF0A 3OISA 1M6DA 2DC9A 3U8EA 1MHWA 3LXSA 4N8WA 3I06A 3QT4A 2B1MA 1FH0A 1KHQA 3P5WA 1PE6A 4YYUA 1YK8A 1MIRA 2FTDA 1EWPA 3QSDA 4AXLA 1CTEA 3N3GA 2AUZA 1NL6A 4YYQA 1ICFA 3CBJA 5F02A 3K8UA 3BPMA 3RVXA 3ZUAA 2XU4A 3CH3X 1BP4A 1SP4B 3OF8A 2YJBA 3H89A 1S4VA 2GFOA 4QRGA 1E2TA 5A24A 2OP3A 4CZWA 5FPWA 1CB5A 2PNSA 4P6GA 1F2CA 1ZCMA 2CB5A 1PCIA 2DC6A 2DZYA 2IPPB 4W5CA 2F7DA 1JQPA 4YYSA 2G8JA 2NQAA 3CH2X 1CVZA 3H7DA 1DEUA 1EF7A 1YVBA 2OZ2A 4BGFA 4HWYA 2DJGB 2BDLA 3IMAA 2AYOA 1NPZA 3H8BA 3S3RA 3HWNA 4CDDB 1QDQA 2XU1A 1BY8A 1TU6A 1QMYA 2DCCA 1EWMA 4G54A 1QOLA 1U9WA 2JQGR 1GMYA 1AU4A 4RY2A 1AECA 3CBKA 3MHSA 1HUCB 4FIPA 4NV7A 3HHAA 3USVA 5CVOB 2R9FA 4XR7A 1NQCA 3O0UA 4BS6A 1A6RA 3IEJA 2FUDA 2YJ2A 1PIPA 1GCBA 2VFCA 2YJ9A 6PADA 2VHSA 4BSQA 4YYWA 4YV8A 2WBFX 3NHEA 4QRXA 1YALA 3KX1A 2F1GA 2BSZA 2AU1A 2YJCA 2JQFR 3C9EA 4PI3A 1Y4HA 3HD3A 1VSNA 2AIMA 1W6FA 4OEMA 3MORA 2PADA 1EWLA 2HH5A 4CDCB 4QH6A 1GX3A 4ZUXU 3OVXA 3V6CA 1PBHA 1F2BA 4KLBA 2DC7A 3QJ3A 1TLOA 3PW3A 4QRVA 3IUTA 1NB5A 1CSBB 2R9OA 4AXMA 1BGOA 4OELA 2E03A 1STFE 2R9CA 2Y6EA 1ATKA 2FRAA 1AU2A 3H6SA 3F5VA 2DJFB 2G7YA 3PBHA 2AYNA 3GCBA 1NB3A 2PBHA 1ME4A 4MZOA 1PPDA 4BS5A 3PDFA 4FJCA 2R9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDW A;  3KSE A;  3DF0 A;  2VHF A;  1ITO A;  1CJL A;  1MEM A;  4QBB A;  1AIM A;  3N4C A;  1QXP A;  2FO5 A;  3BPF A;  4N79 A;  1GEC E;  2ATO A;  1POP A;  2HD5 A;  3P5V A;  4PP2 E;  1BQI A;  1KFU L;  4X6H A;  1THE A;  4X6I A;  3F75 A;  3V6E A;  4X6J A;  2P0R A;  3BWK A;  2ARY A;  4N4Z A;  3P5X A;  3BOW A;  2PRE A;  1O0E A;  3RVV A;  4W4U A;  1Y08 A;  2DCA A;  3D6S A;  5CVN B;  4YYR A;  4DMX A;  2IBI A;  2H7J A;  1ZIV A;  1U9V A;  4W5B A;  3TNX A;  2R9M A;  2E02 A;  2DZZ A;  5CHV A;  4MZS A;  1IWD A;  3WXG A;  5JH3 A;  3B79 A;  2FQ9 A;  1Q6K A;  1PPO A;  3OF9 A;  4Q8G A;  4YYV A;  3WXF A;  2AUX A;  2GHU A;  3MHH A;  2BDZ A;  2YJ8 A;  3KKU A;  2R6N A;  3WXE A;  2XU5 A;  1X9Y A;  4BQV A;  4I04 A;  1K3B B;  1AU0 A;  1AU3 A;  3O1G A;  4FK5 A;  2E01 A;  3M99 A;  3ERV A;  2G6D A;  3KFQ A;  3S3Q A;  1TL9 A;  1KHP A;  4PP1 A;  4BPV A;  1VJV A;  5K16 A;  3K24 A;  3KWB X;  4I05 A;  2NQD B;  3MTN A;  4MSX A;  3IV2 A;  1CS8 A;  4Q8H A;  2O6X A;  1AYV A;  2G8E A;  1AYU A;  2DCD A;  1YT7 A;  2P86 A;  5J94 A;  2HXZ A;  1F2A A;  2NQI A;  5JA7 A;  1U9X A;  1XKG A;  3E1Z B;  2CIO A;  3AI8 A;  1MS6 A;  8PCH A;  3IHP A;  3P5U A;  4I07 A;  3BCN A;  5EF4 A;  1CPJ A;  1GLO A;  2FYE A;  2OUL A;  1ME3 A;  1PPN A;  1SNK A;  7PCK A;  1KXR A;  5CVM A;  2DCB A;  1F29 A;  4DMY A;  1NLJ A;  2XU3 A;  3H8C A;  3RVW A;  5EGW A;  1U9Q X;  4YVA A;  2FT2 A;  4PAD A;  3HHI A;  4CDE B;  1CV8 A;  3K9M A;  3N3K A;  1EWO A;  2E00 A;  3PNR A;  3KWZ A;  5PAD A;  9PAP A;  2Y5B A;  2P7U A;  3OVZ A;  2AVW A;  1CQD A;  3I3T A;  1YK7 A;  4K7C A;  2DC8 A;  4XUI A;  2C0Y A;  3KW9 A;  1MEG A;  1PPP A;  1PAD A;  3LFY A;  5CHT A;  3IOQ A;  1U5I A;  4CDF B;  2B1N A;  4P6E A;  2FRQ A;  3BC3 A;  2AS8 A;  1KFX L;  1AYW A;  2HHN A;  2NQG A;  1PXV A;  2ACT A;  4WA6 A;  1DF0 A;  3OIS A;  1M6D A;  2DC9 A;  3U8E A;  1MHW A;  3LXS A;  4N8W A;  3I06 A;  3QT4 A;  2B1M A;  1FH0 A;  1KHQ A;  3P5W A;  1PE6 A;  4YYU A;  1YK8 A;  1MIR A;  2FTD A;  1EWP A;  3QSD A;  4AXL A;  1CTE A;  3N3G A;  2AUZ A;  1NL6 A;  4YYQ A;  1ICF A;  3CBJ A;  5F02 A;  3K8U A;  3BPM A;  3RVX A;  3ZUA A;  2XU4 A;  3CH3 X;  1BP4 A;  1SP4 B;  3OF8 A;  2YJB A;  3H89 A;  1S4V A;  2GFO A;  4QRG A;  5A24 A;  2OP3 A;  4CZW A;  5FPW A;  1CB5 A;  2PNS A;  4P6G A;  1F2C A;  1ZCM A;  2CB5 A;  1PCI A;  2DC6 A;  2DZY A;  2IPP B;  4W5C A;  2F7D A;  1JQP A;  4YYS A;  2G8J A;  2NQA A;  3CH2 X;  1CVZ A;  3H7D A;  1DEU A;  1EF7 A;  1YVB A;  2OZ2 A;  4HWY A;  2DJG B;  2BDL A;  3IMA A;  2AYO A;  1NPZ A;  3H8B A;  3S3R A;  3HWN A;  4CDD B;  1QDQ A;  2XU1 A;  1BY8 A;  1TU6 A;  1QMY A;  2DCC A;  1EWM A;  4G54 A;  1QOL A;  1U9W A;  2JQG R;  1GMY A;  1AU4 A;  4RY2 A;  1AEC A;  3CBK A;  3MHS A;  1HUC B;  4FIP A;  3HHA A;  3USV A;  5CVO B;  2R9F A;  4XR7 A;  1NQC A;  3O0U A;  4BS6 A;  1A6R A;  3IEJ A;  2FUD A;  2YJ2 A;  1PIP A;  1GCB A;  2YJ9 A;  6PAD A;  2VHS A;  4BSQ A;  4YYW A;  4YV8 A;  2WBF X;  3NHE A;  4QRX A;  1YAL A;  3KX1 A;  2F1G A;  2AU1 A;  2YJC A;  2JQF R;  3C9E A;  4PI3 A;  1Y4H A;  3HD3 A;  1VSN A;  2AIM A;  4OEM A;  3MOR A;  2PAD A;  1EWL A;  2HH5 A;  4CDC B;  4QH6 A;  4ZUX U;  3OVX A;  3V6C A;  1PBH A;  1F2B A;  4KLB A;  2DC7 A;  3QJ3 A;  1TLO A;  3PW3 A;  4QRV A;  3IUT A;  1NB5 A;  1CSB B;  2R9O A;  4AXM A;  1BGO A;  4OEL A;  2E03 A;  1STF E;  2R9C A;  2Y6E A;  1ATK A;  2FRA A;  1AU2 A;  3H6S A;  3F5V A;  2DJF B;  2G7Y A;  3PBH A;  2AYN A;  3GCB A;  1NB3 A;  2PBH A;  1ME4 A;  4MZO A;  1PPD A;  4BS5 A;  3PDF A;  4FJC A;  2R9N A; 
#chains in the Genus database with same CATH topology
 1MDW A;  3KSE A;  3DF0 A;  2VHF A;  1ITO A;  1CJL A;  1MEM A;  2J7Q C;  4QBB A;  1AIM A;  3N4C A;  1QXP A;  3PSE A;  2FO5 A;  4D8B A;  3BPF A;  4N79 A;  1GEC E;  2ATO A;  3BY4 A;  1POP A;  3TRK A;  2HD5 A;  3P5V A;  4PP2 E;  1BQI A;  1KFU L;  4X6H A;  1THE A;  4IP3 A;  4X6I A;  3F75 A;  3V6E A;  4X6J A;  2P0R A;  3BWK A;  2ARY A;  4N4Z A;  3P5X A;  3BOW A;  2PRE A;  1O0E A;  3RVV A;  4W4U A;  1Y08 A;  2DCA A;  3D6S A;  5CVN B;  4MM3 B;  4YYR A;  4DMX A;  2IBI A;  2H7J A;  1ZIV A;  1U9V A;  4W5B A;  4P16 A;  3TNX A;  4XZX A;  2R9M A;  2E02 A;  2DZZ A;  5CHV A;  4MZS A;  1IWD A;  4RNA A;  3ZNH A;  3WXG A;  2HWK A;  5JH3 A;  3B79 A;  3TMP A;  2FQ9 A;  1Q6K A;  1PPO A;  3OF9 A;  4Q8G A;  4YYV A;  3WXF A;  4R3D A;  2AUX A;  2GHU A;  3MHH A;  2BDZ A;  1DKI A;  2YJ8 A;  2J7Q A;  3KKU A;  2R6N A;  4GUA A;  3WXE A;  2XU5 A;  1X9Y A;  4BQV A;  4RF0 A;  4I04 A;  1K3B B;  1AU0 A;  1AU3 A;  3O1G A;  4FK5 A;  2E01 A;  3M99 A;  3ERV A;  2G6D A;  4PT5 A;  4A5U A;  3KFQ A;  2JTC A;  3S3Q A;  1TL9 A;  1KHP A;  4PP1 A;  4BPV A;  4OVZ B;  1VJV A;  2Z84 A;  5K16 A;  3K24 A;  3KWB X;  4I05 A;  2NQD B;  3MTN A;  4MSX A;  3IV2 A;  1CS8 A;  4Q8H A;  2O6X A;  3B21 A;  1AYV A;  2G8E A;  1AYU A;  2DCD A;  1YT7 A;  3MJ5 A;  2P86 A;  5EZS A;  5J94 A;  2HXZ A;  1UKF A;  1F2A A;  2NQI A;  3E9S A;  5JA7 A;  1U9X A;  1XKG A;  3E1Z B;  2CIO A;  3AI8 A;  3PRM A;  1MS6 A;  8PCH A;  3O65 A;  3IHP A;  3P5U A;  4I07 A;  4BOP A;  3BCN A;  5EF4 A;  1CPJ A;  1GLO A;  2FYE A;  2OUL A;  1ME3 A;  1PPN A;  1SNK A;  7PCK A;  1KXR A;  5CVM A;  2DCB A;  1F29 A;  4DMY A;  1NLJ A;  3PHW A;  2XU3 A;  3H8C A;  3RVW A;  5EGW A;  1U9Q X;  4YVA A;  4WUR A;  2FT2 A;  4PAD A;  3HHI A;  4CDE B;  1CV8 A;  3K9M A;  4OVZ A;  3N3K A;  1EWO A;  2E00 A;  4REZ A;  5KO3 A;  3PNR A;  3KWZ A;  5PAD A;  4D8E A;  2Y5B A;  2P7U A;  9PAP A;  3OVZ A;  2AVW A;  1CQD A;  3I3T A;  1YK7 A;  4K7C A;  2DC8 A;  3MTV A;  4ZTB A;  2C0Y A;  4XUI A;  2BU3 A;  3KW9 A;  1MEG A;  1PPP A;  1PAD A;  3LFY A;  5CHT A;  3IOQ A;  1U5I A;  4CDF B;  2B1N A;  4P6E A;  3RNV A;  2FRQ A;  3BC3 A;  3MP2 A;  2AS8 A;  1KFX L;  1AYW A;  2HHN A;  2NQG A;  1PXV A;  2AGA A;  2ACT A;  3OQC A;  4M0W A;  4WA6 A;  1DF0 A;  3OIS A;  5EZQ A;  1M6D A;  2DC9 A;  3U8E A;  1MHW A;  3LXS A;  4N8W A;  3I06 A;  3QT4 A;  2B1M A;  1FH0 A;  1KHQ A;  3P5W A;  1PE6 A;  4YYU A;  1YK8 A;  1MIR A;  2FTD A;  4IUM A;  1EWP A;  3QSD A;  4AXL A;  1CTE A;  3N3G A;  2AUZ A;  4BOU A;  1NL6 A;  4BOS A;  4YYQ A;  1ICF A;  3CBJ A;  5F02 A;  3K8U A;  3BPM A;  3RVX A;  3ZUA A;  2XU4 A;  3CH3 X;  1BP4 A;  1SP4 B;  3OF8 A;  2YJB A;  3H89 A;  4BOQ A;  1S4V A;  2GFO A;  4QRG A;  5A24 A;  2OP3 A;  4CZW A;  5JZE A;  4OW0 A;  5FPW A;  1CB5 A;  2PNS A;  4P6G A;  1F2C A;  1ZCM A;  2CB5 A;  1PCI A;  2DC6 A;  2DZY A;  2IPP B;  4W5C A;  2F7D A;  1JQP A;  4HXD B;  4YYS A;  2G8J A;  2NQA A;  3CH2 X;  1CVZ A;  3H7D A;  1DEU A;  1EF7 A;  1YVB A;  3PT2 A;  3W31 A;  3PRP A;  2OZ2 A;  4HWY A;  2DJG B;  2BDL A;  3IMA A;  2AYO A;  1NPZ A;  3H8B A;  3S3R A;  3HWN A;  4CDD B;  1QDQ A;  2XU1 A;  1BY8 A;  1TU6 A;  1QMY A;  5E6J A;  2DCC A;  1EWM A;  4G54 A;  1QOL A;  1U9W A;  2JQG R;  1GMY A;  1AU4 A;  4RY2 A;  1AEC A;  3CBK A;  3MHS A;  1HUC B;  4FIP A;  3HHA A;  3USV A;  5CVO B;  2R9F A;  4XR7 A;  1NQC A;  3O0U A;  4BS6 A;  1A6R A;  3IEJ A;  2FUD A;  2YJ2 A;  1PIP A;  1GCB A;  1PVJ A;  2YJ9 A;  6PAD A;  4BOZ A;  2VHS A;  3PHU A;  4BSQ A;  2UZJ A;  4YYW A;  2BTW A;  4YV8 A;  2WBF X;  3NHE A;  4QRX A;  1YAL A;  3BB7 A;  3KX1 A;  2F1G A;  4RKX A;  2AU1 A;  2YJC A;  2JQF R;  3C9E A;  2DOS A;  4PI3 A;  2JRI A;  1Y4H A;  3HD3 A;  1VSN A;  2AIM A;  4OEM A;  4RF1 A;  3MOR A;  2PAD A;  1EWL A;  2HH5 A;  4CDC B;  4QH6 A;  4ZUX U;  3W30 A;  3OVX A;  3V6C A;  1PBH A;  2FE8 A;  1F2B A;  4KLB A;  2DC7 A;  3QJ3 A;  4D8I A;  1TLO A;  3PW3 A;  4QRV A;  3IUT A;  1NB5 A;  1CSB B;  2R9O A;  2BTW B;  3PHX A;  4AXM A;  1BGO A;  4OEL A;  2E03 A;  1STF E;  2R9C A;  2Y6E A;  1ATK A;  2FRA A;  1AU2 A;  3H6S A;  3F5V A;  3BBA A;  2DJF B;  2G7Y A;  3IFU A;  2AYN A;  3GCB A;  3PBH A;  1NB3 A;  1YZB A;  2PBH A;  1ME4 A;  4MZO A;  1PPD A;  4BS5 A;  3C0R A;  4MI7 A;  3PDF A;  4FJC A;  2R9N A; 
#chains in the Genus database with same CATH homology
 1MDW A;  3KSE A;  3DF0 A;  2VHF A;  1ITO A;  1CJL A;  1MEM A;  4QBB A;  1AIM A;  3N4C A;  1QXP A;  2FO5 A;  3BPF A;  4N79 A;  1GEC E;  2ATO A;  1POP A;  2HD5 A;  3P5V A;  4PP2 E;  1BQI A;  1KFU L;  4X6H A;  1THE A;  4X6I A;  3F75 A;  3V6E A;  4X6J A;  2P0R A;  3BWK A;  2ARY A;  4N4Z A;  3P5X A;  3BOW A;  2PRE A;  1O0E A;  3RVV A;  4W4U A;  1Y08 A;  2DCA A;  3D6S A;  5CVN B;  4YYR A;  4DMX A;  2IBI A;  2H7J A;  1ZIV A;  1U9V A;  4W5B A;  3TNX A;  2R9M A;  2E02 A;  2DZZ A;  5CHV A;  4MZS A;  1IWD A;  3WXG A;  5JH3 A;  3B79 A;  2FQ9 A;  1Q6K A;  1PPO A;  3OF9 A;  4Q8G A;  4YYV A;  3WXF A;  2AUX A;  2GHU A;  3MHH A;  1W5R A;  2BDZ A;  4GUZ A;  3LTW A;  2YJ8 A;  3KKU A;  2R6N A;  3WXE A;  2XU5 A;  1X9Y A;  4BQV A;  4I04 A;  1K3B B;  1AU0 A;  1AU3 A;  3O1G A;  4FK5 A;  2E01 A;  3M99 A;  3ERV A;  2G6D A;  3KFQ A;  3S3Q A;  1TL9 A;  1KHP A;  4PP1 A;  4BPV A;  4B55 A;  1VJV A;  5K16 A;  3K24 A;  3KWB X;  4I05 A;  2NQD B;  3MTN A;  4MSX A;  3IV2 A;  1CS8 A;  4Q8H A;  2O6X A;  1AYV A;  2G8E A;  1AYU A;  2DCD A;  1YT7 A;  2P86 A;  5J94 A;  2HXZ A;  1F2A A;  2NQI A;  5JA7 A;  1U9X A;  1XKG A;  3E1Z B;  2CIO A;  3AI8 A;  4C5P A;  1MS6 A;  8PCH A;  3IHP A;  3P5U A;  4I07 A;  3BCN A;  5EF4 A;  1CPJ A;  1GLO A;  2FYE A;  2OUL A;  1ME3 A;  1PPN A;  1SNK A;  7PCK A;  1KXR A;  5CVM A;  2DCB A;  1F29 A;  4DMY A;  1NLJ A;  4NV8 A;  2XU3 A;  3H8C A;  3RVW A;  5EGW A;  1U9Q X;  4YVA A;  2FT2 A;  4PAD A;  3HHI A;  4CDE B;  1CV8 A;  3K9M A;  3N3K A;  1EWO A;  2E00 A;  3PNR A;  3KWZ A;  5PAD A;  9PAP A;  2Y5B A;  2P7U A;  3D9W A;  3OVZ A;  2AVW A;  1CQD A;  3I3T A;  1YK7 A;  4K7C A;  2DC8 A;  4XUI A;  2C0Y A;  3KW9 A;  1MEG A;  1PPP A;  1W4T A;  1PAD A;  3LFY A;  5CHT A;  3IOQ A;  1U5I A;  4CDF B;  2B1N A;  4P6E A;  2FRQ A;  3BC3 A;  2AS8 A;  1KFX L;  1AYW A;  2HHN A;  2NQG A;  1PXV A;  2ACT A;  2VFB A;  4WA6 A;  1DF0 A;  3OIS A;  1M6D A;  2DC9 A;  3U8E A;  1MHW A;  3LXS A;  4N8W A;  3I06 A;  3QT4 A;  2B1M A;  1FH0 A;  1KHQ A;  3P5W A;  1PE6 A;  4YYU A;  1YK8 A;  1MIR A;  2FTD A;  1EWP A;  3QSD A;  4AXL A;  1CTE A;  3N3G A;  2AUZ A;  1NL6 A;  4YYQ A;  1ICF A;  3CBJ A;  5F02 A;  3K8U A;  3BPM A;  3RVX A;  3ZUA A;  2XU4 A;  3CH3 X;  1BP4 A;  1SP4 B;  3OF8 A;  2YJB A;  3H89 A;  1S4V A;  2GFO A;  4QRG A;  1E2T A;  5A24 A;  2OP3 A;  4CZW A;  5FPW A;  1CB5 A;  2PNS A;  4P6G A;  1F2C A;  1ZCM A;  2CB5 A;  1PCI A;  2DC6 A;  2DZY A;  2IPP B;  4W5C A;  2F7D A;  1JQP A;  4YYS A;  2G8J A;  2NQA A;  3CH2 X;  1CVZ A;  3H7D A;  1DEU A;  1EF7 A;  1YVB A;  2OZ2 A;  4BGF A;  4HWY A;  2DJG B;  2BDL A;  3IMA A;  2AYO A;  1NPZ A;  3H8B A;  3S3R A;  3HWN A;  4CDD B;  1QDQ A;  2XU1 A;  1BY8 A;  1TU6 A;  1QMY A;  2DCC A;  1EWM A;  4G54 A;  1QOL A;  1U9W A;  2JQG R;  1GMY A;  1AU4 A;  4RY2 A;  1AEC A;  3CBK A;  3MHS A;  1HUC B;  4FIP A;  4NV7 A;  3HHA A;  3USV A;  5CVO B;  2R9F A;  4XR7 A;  1NQC A;  3O0U A;  4BS6 A;  1A6R A;  3IEJ A;  2FUD A;  2YJ2 A;  1PIP A;  1GCB A;  2VFC A;  2YJ9 A;  6PAD A;  2VHS A;  4BSQ A;  4YYW A;  4YV8 A;  2WBF X;  3NHE A;  4QRX A;  1YAL A;  3KX1 A;  2F1G A;  2BSZ A;  2AU1 A;  2YJC A;  2JQF R;  3C9E A;  4PI3 A;  1Y4H A;  3HD3 A;  1VSN A;  2AIM A;  1W6F A;  4OEM A;  3MOR A;  2PAD A;  1EWL A;  2HH5 A;  4CDC B;  4QH6 A;  1GX3 A;  4ZUX U;  3OVX A;  3V6C A;  1PBH A;  1F2B A;  4KLB A;  2DC7 A;  3QJ3 A;  1TLO A;  3PW3 A;  4QRV A;  3IUT A;  1NB5 A;  1CSB B;  2R9O A;  4AXM A;  1BGO A;  4OEL A;  2E03 A;  1STF E;  2R9C A;  2Y6E A;  1ATK A;  2FRA A;  1AU2 A;  3H6S A;  3F5V A;  2DJF B;  2G7Y A;  3PBH A;  2AYN A;  3GCB A;  1NB3 A;  2PBH A;  1ME4 A;  4MZO A;  1PPD A;  4BS5 A;  3PDF A;  4FJC A;  2R9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...