4KLBA

Crystal structure of cruzain in complex with the non-covalent inhibitor nequimed176
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
b'APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Non-peptidic Cruzain Inhibitors with Trypanocidal Activity Discovered by Virtual Screening and In Vitro Assay.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4klbA00
4YV8A 2XU4A 2DZZA 2HD5A 1QOLA 3K24A 1U9XA 1CJLA 3IOQA 4K7CA 5CVNB 2ATOA 1EWPA 1F2BA 2IPPB 5CHVA 4N79A 4I04A 1TU6A 1AIMA 1PCIA 4YVAA 3OF9A 3PDFA 2OZ2A 3QSDA 3KFQA 4G54A 1Y08A 2YJ2A 3BCNA 3OVZA 1KHPA 3D6SA 1BGOA 2HHNA 3N4CA 3RVWA 2YJ9A 4WA6A 3CBKA 4RY2A 1ME4A 9PAPA 1MIRA 1IWDA 3E1ZB 1S4VA 1BY8A 2VHFA 3LFYA 2PREA 4XR7A 3PNRA 8PCHA 1KFUL 1MHWA 1TLOA 2DCBA 4DMXA 2G8JA 3BOWA 1AECA 1CVZA 2DC7A 4FIPA 4Q8GA 2FRQA 5CVMA 2ACTA 2DZYA 3AI8A 1PADA 2R9OA 1PE6A 3BWKA 3WXEA 1F2AA 1PPNA 3K9MA 4CDFB 1MEGA 2XU5A 1DF0A 1POPA 3V6CA 4Q8HA 3DF0A 1U9WA 1EF7A 5F02A 2R6NA 5JA7A 3H89A 4ZUXU 6PADA 3RVVA 3PW3A 1KHQA 3CBJA 2GFOA 4BQVA 4BS5A 3N3KA 1PPDA 1QXPA 2PBHA 3HHIA 5A24A 3B79A 3P5UA 3KWZA 1CV8A 3H6SA 2FYEA 4X6JA 4I07A 2AYNA 1NB5A 1GLOA 2HH5A 5PADA 4PP2E 1AU2A 1CB5A 1KFXL 2NQAA 4AXLA 3N3GA 3H8CA 4X6HA 4BPVA 1PIPA 3IMAA 4QRGA 3BPFA 4XUIA 4FJCA 1MS6A 1ME3A 3CH3X 2AIMA 1CPJA 3OISA 2E01A 4I05A 1YVBA 1QMYA 1A6RA 1PPPA 3IV2A 2AUZA 2XU3A 2C0YA 4KLBA 2JQFR 1GECE 4BS6A 1KXRA 1O0EA 1ZCMA 1AU4A 2E00A 1NL6A 3KKUA 2R9NA 1BP4A 1U5IA 3LXSA 3ZUAA 1YK8A 2DCDA 4P6EA 2NQGA 4OELA 4YYWA 3P5VA 4W5BA 1YT7A 3ERVA 2F1GA 4QRXA 2Y6EA 1YK7A 2IBIA 3KSEA 3HWNA 3KWBX 1U9VA 2FQ9A 2AU1A 3H8BA 4MZOA 4CDCB 4PADA 2ARYA 2FTDA 2BDZA 2BDLA 3C9EA 1F2CA 2DC8A 4X6IA 2P0RA 1QDQA 1AU0A 1PXVA 1F29A 5EGWA 2DC9A 5K16A 3WXFA 2R9MA 4MZSA 4MSXA 3KW9A 2F7DA 2E02A 4CZWA 5EF4A 2JQGR 2Y5BA 4P6GA 2P86A 3IUTA 2HXZA 4CDDB 2R9FA 3O1GA 2E03A 3S3QA 3O0UA 4YYSA 3I3TA 3NHEA 1VJVA 1U9QX 2CB5A 4W5CA 3CH2X 2FUDA 1BQIA 1THEA 1Q6KA 5CVOB 2G7YA 4YYVA 4YYRA 1PPOA 2AYOA 3K8UA 1X9YA 2G6DA 2CIOA 1CSBB 2P7UA 1SNKA 1K3BB 1AYVA 4DMYA 2YJBA 3P5WA 2YJCA 2PADA 1NQCA 1AU3A 3I06A 3OVXA 3RVXA 1Y4HA 4FK5A 3HHAA 2PNSA 3KX1A 2DJFB 2DC6A 2H7JA 3MHSA 3WXGA 5J94A 3IHPA 4QBBA 3USVA 3BC3A 1GMYA 1FH0A 2AVWA 2GHUA 1HUCB 4AXMA 2OP3A 1M6DA 3F5VA 4YYUA 1MEMA 2XU1A 1JQPA 1PBHA 3OF8A 3IEJA 5JH3A 1CS8A 2B1NA 3GCBA 3HD3A 1XKGA 4OEMA 2B1MA 2AUXA 2AS8A 3BPMA 4PI3A 2DJGB 2O6XA 4HWYA 3MORA 4PP1A 1MDWA 2FRAA 2WBFX 1NPZA 1EWMA 3PBHA 1YALA 3V6EA 3U8EA 2YJ8A 1EWOA 3QJ3A 4W4UA 1TL9A 4QH6A 3F75A 2OULA 4YYQA 2FO5A 2FT2A 3P5XA 2DCCA 2NQDB 3M99A 1NB3A 1GCBA 1SP4B 1VSNA 4CDEB 1ATKA 2VHSA 1AYWA 1NLJA 4N4ZA 3S3RA 2DCAA 1CTEA 5FPWA 1DEUA 1EWLA 1AYUA 1CQDA 3H7DA 1ZIVA 4QRVA 2NQIA 3MHHA 4BSQA 2G8EA 5CHTA 2R9CA 3QT4A 3MTNA 7PCKA 3TNXA 1STFE 1ITOA 1ICFA 4N8WA
chains in the Genus database with same CATH superfamily
4IP3A 4YV8A 2XU4A 2DZZA 2HD5A 1QOLA 3K24A 1U9XA 1CJLA 3IOQA 4K7CA 5CVNB 4BOZA 3BB7A 4RNAA 2ATOA 4D8IA 4BOUA 1EWPA 1F2BA 2IPPB 5CHVA 4N79A 4A5UA 3IFUA 4I04A 1TU6A 1AIMA 1PCIA 4YVAA 2Z84A 3OF9A 2BTWB 3PDFA 2OZ2A 3QSDA 3KFQA 4G54A 1Y08A 2DOSA 2YJ2A 3BCNA 3OVZA 1KHPA 3D6SA 1BGOA 2HHNA 3N4CA 3RVWA 2YJ9A 4WA6A 3PT2A 3CBKA 4RY2A 5EZQA 3W31A 1ME4A 4BOPA 9PAPA 1MIRA 1IWDA 3TMPA 3E1ZB 1S4VA 1BY8A 2VHFA 3LFYA 2PREA 4XR7A 3PNRA 8PCHA 1KFUL 1MHWA 1TLOA 2DCBA 4DMXA 2G8JA 3BOWA 1AECA 2BTWA 1CVZA 2DC7A 4FIPA 4Q8GA 2FRQA 5CVMA 2ACTA 2DZYA 3AI8A 1PADA 3MTVA 2R9OA 1PE6A 3BWKA 3WXEA 1F2AA 2JRIA 1PPNA 3K9MA 4CDFB 1MEGA 2XU5A 1DF0A 1POPA 3V6CA 4Q8HA 3DF0A 4PT5A 1U9WA 1EF7A 5F02A 2R6NA 4P16A 5JA7A 4ZTBA 3H89A 4ZUXU 6PADA 3RVVA 3PW3A 1KHQA 3CBJA 2GFOA 4BQVA 4BS5A 3N3KA 1PPDA 1QXPA 2PBHA 3HHIA 5A24A 3B79A 3P5UA 3KWZA 1CV8A 3H6SA 2FYEA 2HWKA 4X6JA 4I07A 2AYNA 1NB5A 1GLOA 2HH5A 5PADA 4PP2E 1AU2A 4MI7A 1CB5A 1KFXL 2NQAA 4AXLA 4OW0A 3MP2A 4GUAA 3N3GA 3H8CA 4X6HA 4BPVA 1PIPA 3IMAA 2JTCA 4M0WA 4QRGA 3BPFA 4XUIA 4FJCA 1MS6A 1ME3A 2J7QA 3CH3X 2AIMA 1CPJA 3OISA 2E01A 4I05A 4IUMA 1YVBA 4BOSA 1QMYA 4R3DA 1A6RA 1PPPA 3IV2A 2AUZA 2XU3A 2C0YA 4KLBA 4BOQA 2JQFR 1GECE 4BS6A 1KXRA 5EZSA 1O0EA 1ZCMA 1AU4A 2E00A 1NL6A 3KKUA 2R9NA 5KO3A 1BP4A 1U5IA 3LXSA 3ZUAA 1YK8A 2DCDA 4P6EA 2NQGA 4OELA 4YYWA 3P5VA 4D8EA 4W5BA 1YT7A 3ERVA 2F1GA 4QRXA 2Y6EA 1YK7A 2IBIA 3KSEA 3HWNA 3KWBX 1YZBA 1U9VA 2FQ9A 2AU1A 2BU3A 3H8BA 3RNVA 4MZOA 4CDCB 2ARYA 4PADA 2FTDA 3PSEA 2BDZA 2BDLA 3C9EA 1F2CA 2DC8A 4X6IA 2P0RA 1QDQA 1AU0A 3W30A 1PXVA 1F29A 5EGWA 2DC9A 5K16A 3TRKA 3WXFA 3O65A 2R9MA 4MZSA 4MSXA 3KW9A 2F7DA 2E02A 4CZWA 5EF4A 2JQGR 2Y5BA 4P6GA 2P86A 4RF1A 3IUTA 2HXZA 4CDDB 2R9FA 3O1GA 2E03A 3S3QA 3O0UA 4YYSA 3I3TA 3NHEA 4XZXA 1VJVA 1U9QX 2CB5A 4RKXA 4W5CA 3CH2X 2FUDA 1BQIA 1THEA 1Q6KA 5CVOB 1UKFA 2G7YA 4YYVA 4YYRA 1PPOA 2AYOA 4MM3B 3K8UA 1X9YA 2G6DA 2CIOA 1CSBB 2P7UA 1SNKA 4HXDB 1K3BB 1AYVA 4DMYA 2YJBA 3P5WA 2YJCA 2PADA 1NQCA 1AU3A 3I06A 3OVXA 3RVXA 1Y4HA 4FK5A 3HHAA 2PNSA 3KX1A 2DJFB 3PRMA 2DC6A 2H7JA 3B21A 3MHSA 2J7QC 3WXGA 5J94A 3IHPA 4QBBA 3USVA 3BC3A 1GMYA 1FH0A 3E9SA 2AVWA 2GHUA 3PHUA 4REZA 1HUCB 4AXMA 2OP3A 1M6DA 3F5VA 4YYUA 2FE8A 1MEMA 2XU1A 3BBAA 3C0RA 1JQPA 1PBHA 3OF8A 3IEJA 5JH3A 1CS8A 2B1NA 3GCBA 3HD3A 1XKGA 5E6JA 3OQCA 4OEMA 2B1MA 5JZEA 2AUXA 2AS8A 3BPMA 4OVZB 4PI3A 2DJGB 2O6XA 4HWYA 3MORA 4PP1A 1MDWA 2FRAA 2WBFX 1NPZA 1EWMA 3PBHA 1YALA 3V6EA 3PHWA 3U8EA 2YJ8A 1EWOA 3QJ3A 4W4UA 1TL9A 4QH6A 3F75A 2OULA 4YYQA 3ZNHA 2FO5A 2FT2A 3P5XA 2DCCA 2NQDB 4RF0A 3M99A 1NB3A 2AGAA 1GCBA 1SP4B 2UZJA 1DKIA 1VSNA 3MJ5A 4CDEB 1ATKA 2VHSA 1AYWA 3PRPA 1NLJA 4N4ZA 3S3RA 2DCAA 4OVZA 1CTEA 5FPWA 1DEUA 1EWLA 1AYUA 1CQDA 3H7DA 3PHXA 1ZIVA 4D8BA 4QRVA 2NQIA 3MHHA 4BSQA 2G8EA 5CHTA 2R9CA 1PVJA 3QT4A 4WURA 3MTNA 3BY4A 7PCKA 3TNXA 1STFE 1ITOA 1ICFA 4N8WA
chains in the Genus database with same CATH topology
4YV8A 2XU4A 2DZZA 2HD5A 1QOLA 3K24A 1U9XA 1CJLA 3IOQA 1W5RA 4K7CA 5CVNB 2ATOA 1EWPA 1F2BA 2IPPB 5CHVA 4N79A 4I04A 1TU6A 1AIMA 1PCIA 4YVAA 3OF9A 3PDFA 2OZ2A 3QSDA 3KFQA 4G54A 1Y08A 2YJ2A 3BCNA 3OVZA 1KHPA 3D6SA 1BGOA 2HHNA 3N4CA 3RVWA 2YJ9A 4WA6A 3CBKA 4RY2A 1ME4A 9PAPA 1MIRA 1IWDA 3E1ZB 1S4VA 1BY8A 2VHFA 3LFYA 2PREA 4XR7A 3PNRA 8PCHA 1KFUL 1MHWA 1TLOA 2DCBA 4DMXA 2G8JA 3BOWA 1AECA 1CVZA 2DC7A 4FIPA 4Q8GA 2FRQA 5CVMA 2VFBA 2ACTA 2DZYA 3AI8A 1PADA 2R9OA 1PE6A 3BWKA 3WXEA 1F2AA 1PPNA 3K9MA 4CDFB 1W4TA 1MEGA 2XU5A 1DF0A 1POPA 3V6CA 4Q8HA 3DF0A 3LTWA 2VFCA 1U9WA 1EF7A 5F02A 4NV8A 2R6NA 5JA7A 3H89A 4ZUXU 6PADA 3RVVA 3PW3A 1KHQA 3CBJA 2GFOA 4BQVA 4BS5A 3N3KA 1PPDA 1QXPA 2PBHA 3HHIA 5A24A 3B79A 3P5UA 3KWZA 1CV8A 3H6SA 2FYEA 4X6JA 4I07A 2AYNA 1NB5A 1GLOA 2HH5A 5PADA 4PP2E 1AU2A 1CB5A 1KFXL 2NQAA 4AXLA 3N3GA 3H8CA 4X6HA 4BPVA 1PIPA 3IMAA 4B55A 4QRGA 3BPFA 4XUIA 4FJCA 1MS6A 1ME3A 3CH3X 2AIMA 1CPJA 3OISA 2E01A 4I05A 1YVBA 1QMYA 1A6RA 1PPPA 3IV2A 2AUZA 2XU3A 2C0YA 4KLBA 2JQFR 1GECE 4BS6A 1KXRA 1O0EA 1ZCMA 1AU4A 2E00A 1NL6A 3KKUA 2R9NA 1BP4A 1U5IA 3LXSA 3ZUAA 1YK8A 2DCDA 4P6EA 2NQGA 4OELA 1E2TA 4YYWA 3P5VA 4W5BA 1YT7A 3ERVA 2F1GA 4QRXA 2Y6EA 1YK7A 2IBIA 3KSEA 3HWNA 3KWBX 1U9VA 2FQ9A 2AU1A 3H8BA 4MZOA 4CDCB 2ARYA 4PADA 2FTDA 2BDZA 4BGFA 2BDLA 3C9EA 1F2CA 2DC8A 4X6IA 2P0RA 1QDQA 1AU0A 1PXVA 1F29A 5EGWA 2DC9A 5K16A 3WXFA 2R9MA 4MZSA 2BSZA 4MSXA 3KW9A 2F7DA 2E02A 4CZWA 5EF4A 2JQGR 2Y5BA 4P6GA 2P86A 3IUTA 2HXZA 4CDDB 2R9FA 3O1GA 2E03A 3S3QA 3O0UA 4YYSA 3I3TA 3NHEA 1VJVA 1U9QX 2CB5A 4W5CA 3CH2X 2FUDA 4GUZA 1BQIA 1THEA 1Q6KA 5CVOB 2G7YA 4YYVA 4YYRA 1PPOA 2AYOA 3K8UA 1X9YA 2G6DA 2CIOA 1CSBB 2P7UA 1SNKA 1K3BB 1AYVA 4DMYA 2YJBA 3P5WA 2YJCA 2PADA 1NQCA 1AU3A 3I06A 3OVXA 3D9WA 3RVXA 1Y4HA 4FK5A 3HHAA 1W6FA 2PNSA 3KX1A 2DJFB 1GX3A 2DC6A 2H7JA 3MHSA 3WXGA 5J94A 3IHPA 4QBBA 3USVA 3BC3A 1GMYA 1FH0A 2AVWA 2GHUA 1HUCB 4AXMA 2OP3A 1M6DA 3F5VA 4YYUA 1MEMA 2XU1A 1JQPA 1PBHA 3OF8A 3IEJA 5JH3A 1CS8A 2B1NA 4NV7A 3GCBA 3HD3A 1XKGA 4OEMA 2B1MA 2AUXA 2AS8A 3BPMA 4PI3A 2DJGB 2O6XA 4HWYA 3MORA 4PP1A 1MDWA 2FRAA 2WBFX 1NPZA 1EWMA 3PBHA 1YALA 3V6EA 3U8EA 2YJ8A 1EWOA 3QJ3A 4W4UA 1TL9A 4QH6A 3F75A 4C5PA 2OULA 4YYQA 2FO5A 2FT2A 3P5XA 2DCCA 2NQDB 3M99A 1NB3A 1GCBA 1SP4B 1VSNA 4CDEB 1ATKA 2VHSA 1AYWA 1NLJA 4N4ZA 3S3RA 2DCAA 1CTEA 5FPWA 1DEUA 1EWLA 1AYUA 1CQDA 3H7DA 1ZIVA 4QRVA 2NQIA 3MHHA 4BSQA 2G8EA 5CHTA 2R9CA 3QT4A 3MTNA 7PCKA 3TNXA 1STFE 1ITOA 1ICFA 4N8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YV8 A;  2XU4 A;  2DZZ A;  2HD5 A;  1QOL A;  3K24 A;  1U9X A;  1CJL A;  3IOQ A;  4K7C A;  5CVN B;  2ATO A;  1EWP A;  1F2B A;  2IPP B;  5CHV A;  4N79 A;  4I04 A;  1TU6 A;  1AIM A;  1PCI A;  4YVA A;  3OF9 A;  3PDF A;  2OZ2 A;  3QSD A;  3KFQ A;  4G54 A;  1Y08 A;  2YJ2 A;  3BCN A;  3OVZ A;  1KHP A;  3D6S A;  1BGO A;  2HHN A;  3N4C A;  3RVW A;  2YJ9 A;  4WA6 A;  3CBK A;  4RY2 A;  1ME4 A;  9PAP A;  1MIR A;  1IWD A;  3E1Z B;  1S4V A;  1BY8 A;  2VHF A;  3LFY A;  2PRE A;  4XR7 A;  3PNR A;  8PCH A;  1KFU L;  1MHW A;  1TLO A;  2DCB A;  4DMX A;  2G8J A;  3BOW A;  1AEC A;  1CVZ A;  2DC7 A;  4FIP A;  4Q8G A;  2FRQ A;  5CVM A;  2ACT A;  2DZY A;  3AI8 A;  1PAD A;  2R9O A;  1PE6 A;  3BWK A;  3WXE A;  1F2A A;  1PPN A;  3K9M A;  4CDF B;  1MEG A;  2XU5 A;  1DF0 A;  1POP A;  3V6C A;  4Q8H A;  3DF0 A;  1U9W A;  1EF7 A;  5F02 A;  2R6N A;  5JA7 A;  3H89 A;  4ZUX U;  6PAD A;  3RVV A;  3PW3 A;  1KHQ A;  3CBJ A;  2GFO A;  4BQV A;  4BS5 A;  3N3K A;  1PPD A;  1QXP A;  2PBH A;  3HHI A;  5A24 A;  3B79 A;  3P5U A;  3KWZ A;  1CV8 A;  3H6S A;  2FYE A;  4X6J A;  4I07 A;  2AYN A;  1NB5 A;  1GLO A;  2HH5 A;  5PAD A;  4PP2 E;  1AU2 A;  1CB5 A;  1KFX L;  2NQA A;  4AXL A;  3N3G A;  3H8C A;  4X6H A;  4BPV A;  1PIP A;  3IMA A;  4QRG A;  3BPF A;  4XUI A;  4FJC A;  1MS6 A;  1ME3 A;  3CH3 X;  2AIM A;  1CPJ A;  3OIS A;  2E01 A;  4I05 A;  1YVB A;  1QMY A;  1A6R A;  1PPP A;  3IV2 A;  2AUZ A;  2XU3 A;  2C0Y A;  4KLB A;  2JQF R;  1GEC E;  4BS6 A;  1KXR A;  1O0E A;  1ZCM A;  1AU4 A;  2E00 A;  1NL6 A;  3KKU A;  2R9N A;  1BP4 A;  1U5I A;  3LXS A;  3ZUA A;  1YK8 A;  2DCD A;  4P6E A;  2NQG A;  4OEL A;  4YYW A;  3P5V A;  4W5B A;  1YT7 A;  3ERV A;  2F1G A;  4QRX A;  2Y6E A;  1YK7 A;  2IBI A;  3KSE A;  3HWN A;  3KWB X;  1U9V A;  2FQ9 A;  2AU1 A;  3H8B A;  4MZO A;  4CDC B;  4PAD A;  2ARY A;  2FTD A;  2BDZ A;  2BDL A;  3C9E A;  1F2C A;  2DC8 A;  4X6I A;  2P0R A;  1QDQ A;  1AU0 A;  1PXV A;  1F29 A;  5EGW A;  2DC9 A;  5K16 A;  3WXF A;  2R9M A;  4MZS A;  4MSX A;  3KW9 A;  2F7D A;  2E02 A;  4CZW A;  5EF4 A;  2JQG R;  2Y5B A;  4P6G A;  2P86 A;  3IUT A;  2HXZ A;  4CDD B;  2R9F A;  3O1G A;  2E03 A;  3S3Q A;  3O0U A;  4YYS A;  3I3T A;  3NHE A;  1VJV A;  1U9Q X;  2CB5 A;  4W5C A;  3CH2 X;  2FUD A;  1BQI A;  1THE A;  1Q6K A;  5CVO B;  2G7Y A;  4YYV A;  4YYR A;  1PPO A;  2AYO A;  3K8U A;  1X9Y A;  2G6D A;  2CIO A;  1CSB B;  2P7U A;  1SNK A;  1K3B B;  1AYV A;  4DMY A;  2YJB A;  3P5W A;  2YJC A;  2PAD A;  1NQC A;  1AU3 A;  3I06 A;  3OVX A;  3RVX A;  1Y4H A;  4FK5 A;  3HHA A;  2PNS A;  3KX1 A;  2DJF B;  2DC6 A;  2H7J A;  3MHS A;  3WXG A;  5J94 A;  3IHP A;  4QBB A;  3USV A;  3BC3 A;  1GMY A;  1FH0 A;  2AVW A;  2GHU A;  1HUC B;  4AXM A;  2OP3 A;  1M6D A;  3F5V A;  4YYU A;  1MEM A;  2XU1 A;  1JQP A;  1PBH A;  3OF8 A;  3IEJ A;  5JH3 A;  1CS8 A;  2B1N A;  3GCB A;  3HD3 A;  1XKG A;  4OEM A;  2B1M A;  2AUX A;  2AS8 A;  3BPM A;  4PI3 A;  2DJG B;  2O6X A;  4HWY A;  3MOR A;  4PP1 A;  1MDW A;  2FRA A;  2WBF X;  1NPZ A;  1EWM A;  3PBH A;  1YAL A;  3V6E A;  3U8E A;  2YJ8 A;  1EWO A;  3QJ3 A;  4W4U A;  1TL9 A;  4QH6 A;  3F75 A;  2OUL A;  4YYQ A;  2FO5 A;  2FT2 A;  3P5X A;  2DCC A;  2NQD B;  3M99 A;  1NB3 A;  1GCB A;  1SP4 B;  1VSN A;  4CDE B;  1ATK A;  2VHS A;  1AYW A;  1NLJ A;  4N4Z A;  3S3R A;  2DCA A;  1CTE A;  5FPW A;  1DEU A;  1EWL A;  1AYU A;  1CQD A;  3H7D A;  1ZIV A;  4QRV A;  2NQI A;  3MHH A;  4BSQ A;  2G8E A;  5CHT A;  2R9C A;  3QT4 A;  3MTN A;  7PCK A;  3TNX A;  1STF E;  1ITO A;  1ICF A;  4N8W A; 
#chains in the Genus database with same CATH topology
 4IP3 A;  4YV8 A;  2XU4 A;  2DZZ A;  2HD5 A;  1QOL A;  3K24 A;  1U9X A;  1CJL A;  3IOQ A;  4K7C A;  5CVN B;  4BOZ A;  3BB7 A;  4RNA A;  2ATO A;  4D8I A;  4BOU A;  1EWP A;  1F2B A;  2IPP B;  5CHV A;  4N79 A;  4A5U A;  3IFU A;  4I04 A;  1TU6 A;  1AIM A;  1PCI A;  4YVA A;  2Z84 A;  3OF9 A;  2BTW B;  3PDF A;  2OZ2 A;  3QSD A;  3KFQ A;  4G54 A;  1Y08 A;  2DOS A;  2YJ2 A;  3BCN A;  3OVZ A;  1KHP A;  3D6S A;  1BGO A;  2HHN A;  3N4C A;  3RVW A;  2YJ9 A;  4WA6 A;  3PT2 A;  3CBK A;  4RY2 A;  5EZQ A;  3W31 A;  1ME4 A;  4BOP A;  9PAP A;  1MIR A;  1IWD A;  3TMP A;  3E1Z B;  1S4V A;  1BY8 A;  2VHF A;  3LFY A;  2PRE A;  4XR7 A;  3PNR A;  8PCH A;  1KFU L;  1MHW A;  1TLO A;  2DCB A;  4DMX A;  2G8J A;  3BOW A;  1AEC A;  2BTW A;  1CVZ A;  2DC7 A;  4FIP A;  4Q8G A;  2FRQ A;  5CVM A;  2ACT A;  2DZY A;  3AI8 A;  1PAD A;  3MTV A;  2R9O A;  1PE6 A;  3BWK A;  3WXE A;  1F2A A;  2JRI A;  1PPN A;  3K9M A;  4CDF B;  1MEG A;  2XU5 A;  1DF0 A;  1POP A;  3V6C A;  4Q8H A;  3DF0 A;  4PT5 A;  1U9W A;  1EF7 A;  5F02 A;  2R6N A;  4P16 A;  5JA7 A;  4ZTB A;  3H89 A;  4ZUX U;  6PAD A;  3RVV A;  3PW3 A;  1KHQ A;  3CBJ A;  2GFO A;  4BQV A;  4BS5 A;  3N3K A;  1PPD A;  1QXP A;  2PBH A;  3HHI A;  5A24 A;  3B79 A;  3P5U A;  3KWZ A;  1CV8 A;  3H6S A;  2FYE A;  2HWK A;  4X6J A;  4I07 A;  2AYN A;  1NB5 A;  1GLO A;  2HH5 A;  5PAD A;  4PP2 E;  1AU2 A;  4MI7 A;  1CB5 A;  1KFX L;  2NQA A;  4AXL A;  4OW0 A;  3MP2 A;  4GUA A;  3N3G A;  3H8C A;  4X6H A;  4BPV A;  1PIP A;  3IMA A;  2JTC A;  4M0W A;  4QRG A;  3BPF A;  4XUI A;  4FJC A;  1MS6 A;  1ME3 A;  2J7Q A;  3CH3 X;  2AIM A;  1CPJ A;  3OIS A;  2E01 A;  4I05 A;  4IUM A;  1YVB A;  4BOS A;  1QMY A;  4R3D A;  1A6R A;  1PPP A;  3IV2 A;  2AUZ A;  2XU3 A;  2C0Y A;  4KLB A;  4BOQ A;  2JQF R;  1GEC E;  4BS6 A;  1KXR A;  5EZS A;  1O0E A;  1ZCM A;  1AU4 A;  2E00 A;  1NL6 A;  3KKU A;  2R9N A;  5KO3 A;  1BP4 A;  1U5I A;  3LXS A;  3ZUA A;  1YK8 A;  2DCD A;  4P6E A;  2NQG A;  4OEL A;  4YYW A;  3P5V A;  4D8E A;  4W5B A;  1YT7 A;  3ERV A;  2F1G A;  4QRX A;  2Y6E A;  1YK7 A;  2IBI A;  3KSE A;  3HWN A;  3KWB X;  1YZB A;  1U9V A;  2FQ9 A;  2AU1 A;  2BU3 A;  3H8B A;  3RNV A;  4MZO A;  4CDC B;  2ARY A;  4PAD A;  2FTD A;  3PSE A;  2BDZ A;  2BDL A;  3C9E A;  1F2C A;  2DC8 A;  4X6I A;  2P0R A;  1QDQ A;  1AU0 A;  3W30 A;  1PXV A;  1F29 A;  5EGW A;  2DC9 A;  5K16 A;  3TRK A;  3WXF A;  3O65 A;  2R9M A;  4MZS A;  4MSX A;  3KW9 A;  2F7D A;  2E02 A;  4CZW A;  5EF4 A;  2JQG R;  2Y5B A;  4P6G A;  2P86 A;  4RF1 A;  3IUT A;  2HXZ A;  4CDD B;  2R9F A;  3O1G A;  2E03 A;  3S3Q A;  3O0U A;  4YYS A;  3I3T A;  3NHE A;  4XZX A;  1VJV A;  1U9Q X;  2CB5 A;  4RKX A;  4W5C A;  3CH2 X;  2FUD A;  1BQI A;  1THE A;  1Q6K A;  5CVO B;  1UKF A;  2G7Y A;  4YYV A;  4YYR A;  1PPO A;  2AYO A;  4MM3 B;  3K8U A;  1X9Y A;  2G6D A;  2CIO A;  1CSB B;  2P7U A;  1SNK A;  4HXD B;  1K3B B;  1AYV A;  4DMY A;  2YJB A;  3P5W A;  2YJC A;  2PAD A;  1NQC A;  1AU3 A;  3I06 A;  3OVX A;  3RVX A;  1Y4H A;  4FK5 A;  3HHA A;  2PNS A;  3KX1 A;  2DJF B;  3PRM A;  2DC6 A;  2H7J A;  3B21 A;  3MHS A;  2J7Q C;  3WXG A;  5J94 A;  3IHP A;  4QBB A;  3USV A;  3BC3 A;  1GMY A;  1FH0 A;  3E9S A;  2AVW A;  2GHU A;  3PHU A;  4REZ A;  1HUC B;  4AXM A;  2OP3 A;  1M6D A;  3F5V A;  4YYU A;  2FE8 A;  1MEM A;  2XU1 A;  3BBA A;  3C0R A;  1JQP A;  1PBH A;  3OF8 A;  3IEJ A;  5JH3 A;  1CS8 A;  2B1N A;  3GCB A;  3HD3 A;  1XKG A;  5E6J A;  3OQC A;  4OEM A;  2B1M A;  5JZE A;  2AUX A;  2AS8 A;  3BPM A;  4OVZ B;  4PI3 A;  2DJG B;  2O6X A;  4HWY A;  3MOR A;  4PP1 A;  1MDW A;  2FRA A;  2WBF X;  1NPZ A;  1EWM A;  3PBH A;  1YAL A;  3V6E A;  3PHW A;  3U8E A;  2YJ8 A;  1EWO A;  3QJ3 A;  4W4U A;  1TL9 A;  4QH6 A;  3F75 A;  2OUL A;  4YYQ A;  3ZNH A;  2FO5 A;  2FT2 A;  3P5X A;  2DCC A;  2NQD B;  4RF0 A;  3M99 A;  1NB3 A;  2AGA A;  1GCB A;  1SP4 B;  2UZJ A;  1DKI A;  1VSN A;  3MJ5 A;  4CDE B;  1ATK A;  2VHS A;  1AYW A;  3PRP A;  1NLJ A;  4N4Z A;  3S3R A;  2DCA A;  4OVZ A;  1CTE A;  5FPW A;  1DEU A;  1EWL A;  1AYU A;  1CQD A;  3H7D A;  3PHX A;  1ZIV A;  4D8B A;  4QRV A;  2NQI A;  3MHH A;  4BSQ A;  2G8E A;  5CHT A;  2R9C A;  1PVJ A;  3QT4 A;  4WUR A;  3MTN A;  3BY4 A;  7PCK A;  3TNX A;  1STF E;  1ITO A;  1ICF A;  4N8W A; 
#chains in the Genus database with same CATH homology
 4YV8 A;  2XU4 A;  2DZZ A;  2HD5 A;  1QOL A;  3K24 A;  1U9X A;  1CJL A;  3IOQ A;  1W5R A;  4K7C A;  5CVN B;  2ATO A;  1EWP A;  1F2B A;  2IPP B;  5CHV A;  4N79 A;  4I04 A;  1TU6 A;  1AIM A;  1PCI A;  4YVA A;  3OF9 A;  3PDF A;  2OZ2 A;  3QSD A;  3KFQ A;  4G54 A;  1Y08 A;  2YJ2 A;  3BCN A;  3OVZ A;  1KHP A;  3D6S A;  1BGO A;  2HHN A;  3N4C A;  3RVW A;  2YJ9 A;  4WA6 A;  3CBK A;  4RY2 A;  1ME4 A;  9PAP A;  1MIR A;  1IWD A;  3E1Z B;  1S4V A;  1BY8 A;  2VHF A;  3LFY A;  2PRE A;  4XR7 A;  3PNR A;  8PCH A;  1KFU L;  1MHW A;  1TLO A;  2DCB A;  4DMX A;  2G8J A;  3BOW A;  1AEC A;  1CVZ A;  2DC7 A;  4FIP A;  4Q8G A;  2FRQ A;  5CVM A;  2VFB A;  2ACT A;  2DZY A;  3AI8 A;  1PAD A;  2R9O A;  1PE6 A;  3BWK A;  3WXE A;  1F2A A;  1PPN A;  3K9M A;  4CDF B;  1W4T A;  1MEG A;  2XU5 A;  1DF0 A;  1POP A;  3V6C A;  4Q8H A;  3DF0 A;  3LTW A;  2VFC A;  1U9W A;  1EF7 A;  5F02 A;  4NV8 A;  2R6N A;  5JA7 A;  3H89 A;  4ZUX U;  6PAD A;  3RVV A;  3PW3 A;  1KHQ A;  3CBJ A;  2GFO A;  4BQV A;  4BS5 A;  3N3K A;  1PPD A;  1QXP A;  2PBH A;  3HHI A;  5A24 A;  3B79 A;  3P5U A;  3KWZ A;  1CV8 A;  3H6S A;  2FYE A;  4X6J A;  4I07 A;  2AYN A;  1NB5 A;  1GLO A;  2HH5 A;  5PAD A;  4PP2 E;  1AU2 A;  1CB5 A;  1KFX L;  2NQA A;  4AXL A;  3N3G A;  3H8C A;  4X6H A;  4BPV A;  1PIP A;  3IMA A;  4B55 A;  4QRG A;  3BPF A;  4XUI A;  4FJC A;  1MS6 A;  1ME3 A;  3CH3 X;  2AIM A;  1CPJ A;  3OIS A;  2E01 A;  4I05 A;  1YVB A;  1QMY A;  1A6R A;  1PPP A;  3IV2 A;  2AUZ A;  2XU3 A;  2C0Y A;  4KLB A;  2JQF R;  1GEC E;  4BS6 A;  1KXR A;  1O0E A;  1ZCM A;  1AU4 A;  2E00 A;  1NL6 A;  3KKU A;  2R9N A;  1BP4 A;  1U5I A;  3LXS A;  3ZUA A;  1YK8 A;  2DCD A;  4P6E A;  2NQG A;  4OEL A;  1E2T A;  4YYW A;  3P5V A;  4W5B A;  1YT7 A;  3ERV A;  2F1G A;  4QRX A;  2Y6E A;  1YK7 A;  2IBI A;  3KSE A;  3HWN A;  3KWB X;  1U9V A;  2FQ9 A;  2AU1 A;  3H8B A;  4MZO A;  4CDC B;  2ARY A;  4PAD A;  2FTD A;  2BDZ A;  4BGF A;  2BDL A;  3C9E A;  1F2C A;  2DC8 A;  4X6I A;  2P0R A;  1QDQ A;  1AU0 A;  1PXV A;  1F29 A;  5EGW A;  2DC9 A;  5K16 A;  3WXF A;  2R9M A;  4MZS A;  2BSZ A;  4MSX A;  3KW9 A;  2F7D A;  2E02 A;  4CZW A;  5EF4 A;  2JQG R;  2Y5B A;  4P6G A;  2P86 A;  3IUT A;  2HXZ A;  4CDD B;  2R9F A;  3O1G A;  2E03 A;  3S3Q A;  3O0U A;  4YYS A;  3I3T A;  3NHE A;  1VJV A;  1U9Q X;  2CB5 A;  4W5C A;  3CH2 X;  2FUD A;  4GUZ A;  1BQI A;  1THE A;  1Q6K A;  5CVO B;  2G7Y A;  4YYV A;  4YYR A;  1PPO A;  2AYO A;  3K8U A;  1X9Y A;  2G6D A;  2CIO A;  1CSB B;  2P7U A;  1SNK A;  1K3B B;  1AYV A;  4DMY A;  2YJB A;  3P5W A;  2YJC A;  2PAD A;  1NQC A;  1AU3 A;  3I06 A;  3OVX A;  3D9W A;  3RVX A;  1Y4H A;  4FK5 A;  3HHA A;  1W6F A;  2PNS A;  3KX1 A;  2DJF B;  1GX3 A;  2DC6 A;  2H7J A;  3MHS A;  3WXG A;  5J94 A;  3IHP A;  4QBB A;  3USV A;  3BC3 A;  1GMY A;  1FH0 A;  2AVW A;  2GHU A;  1HUC B;  4AXM A;  2OP3 A;  1M6D A;  3F5V A;  4YYU A;  1MEM A;  2XU1 A;  1JQP A;  1PBH A;  3OF8 A;  3IEJ A;  5JH3 A;  1CS8 A;  2B1N A;  4NV7 A;  3GCB A;  3HD3 A;  1XKG A;  4OEM A;  2B1M A;  2AUX A;  2AS8 A;  3BPM A;  4PI3 A;  2DJG B;  2O6X A;  4HWY A;  3MOR A;  4PP1 A;  1MDW A;  2FRA A;  2WBF X;  1NPZ A;  1EWM A;  3PBH A;  1YAL A;  3V6E A;  3U8E A;  2YJ8 A;  1EWO A;  3QJ3 A;  4W4U A;  1TL9 A;  4QH6 A;  3F75 A;  4C5P A;  2OUL A;  4YYQ A;  2FO5 A;  2FT2 A;  3P5X A;  2DCC A;  2NQD B;  3M99 A;  1NB3 A;  1GCB A;  1SP4 B;  1VSN A;  4CDE B;  1ATK A;  2VHS A;  1AYW A;  1NLJ A;  4N4Z A;  3S3R A;  2DCA A;  1CTE A;  5FPW A;  1DEU A;  1EWL A;  1AYU A;  1CQD A;  3H7D A;  1ZIV A;  4QRV A;  2NQI A;  3MHH A;  4BSQ A;  2G8E A;  5CHT A;  2R9C A;  3QT4 A;  3MTN A;  7PCK A;  3TNX A;  1STF E;  1ITO A;  1ICF A;  4N8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...