4KLBA

Crystal structure of cruzain in complex with the non-covalent inhibitor nequimed176
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cruzipain
publication title Non-peptidic Cruzain Inhibitors with Trypanocidal Activity Discovered by Virtual Screening and In Vitro Assay.
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4klbA00
4MSXA 1MIRA 4X6JA 4G54A 4W4UA 4W5BA 2Y5BA 1ITOA 1Y08A 3OVXA 1NB5A 1SP4B 8PCHA 1AECA 2IPPB 1GMYA 4ZUXU 2IBIA 3N3GA 3QJ3A 2P86A 4X6IA 4PP2E 2XU3A 4FK5A 1POPA 3ERVA 1KHPA 2DC9A 2R9OA 1NLJA 4BS6A 7PCKA 1PPDA 1ME4A 3WXGA 3I06A 1BGOA 2AS8A 4BQVA 2DCDA 1F2BA 5K16A 4BS5A 4AXMA 4HWYA 2Y6EA 3DF0A 3I3TA 2NQDB 2FQ9A 2F1GA 3S3RA 2NQIA 1BP4A 1EF7A 1SNKA 1A6RA 3KKUA 1CB5A 2PREA 1PIPA 3CBKA 4K7CA 2F7DA 1PCIA 2CB5A 3H6SA 3LFYA 2HXZA 1TU6A 1NPZA 1BQIA 1CSBB 1AYVA 2R9FA 3RVVA 1CQDA 3IEJA 3WXFA 3HHAA 1STFE 2FYEA 1U9WA 3BC3A 4BSQA 2XU4A 3BWKA 5F02A 1KFUL 3O1GA 2P0RA 2VHFA 1EWLA 3C9EA 2R9MA 3OF9A 1ATKA 1YK8A 5CVMA 2P7UA 3CBJA 2VHSA 5CVOB 4WA6A 3M99A 3CH2X 1EWMA 2FRQA 1K3BB 4YYQA 2AU1A 2FTDA 3P5XA 1MEGA 1EWPA 4YYUA 2YJ8A 3TNXA 3K9MA 3WXEA 2E03A 4CDCB 3P5VA 2HHNA 3BCNA 1IWDA 1BY8A 3H89A 3V6CA 3BPFA 1CTEA 2AUXA 1Q6KA 2NQGA 2O6XA 2E00A 3V6EA 5JH3A 1PPOA 3PW3A 3ZUAA 3K24A 2E02A 4I04A 2XU1A 1MS6A 4I07A 2E01A 3GCBA 3H7DA 1PE6A 1PXVA 4YYRA 2DCAA 2YJCA 1X9YA 2NQAA 3MHHA 6PADA 1DF0A 5PADA 1F2AA 2OP3A 1AYWA 2YJ9A 4W5CA 1CPJA 4XUIA 1THEA 3CH3X 4P6EA 2FT2A 5EGWA 1NQCA 1GLOA 2R9CA 4RY2A 4CZWA 1AU4A 2BDLA 2DC8A 2BDZA 2DCBA 4QRXA 3RVWA 4X6HA 2ARYA 3QSDA 5J94A 4FIPA 1ME3A 3BOWA 3H8BA 2CIOA 3KFQA 4PP1A 1YVBA 4QRGA 1AU3A 2AIMA 3IHPA 1S4VA 1DEUA 4YYWA 3D6SA 4MZOA 1ZIVA 3P5WA 1F2CA 4OEMA 2DC6A 2YJBA 2AYOA 3LXSA 3KX1A 2GHUA 3PNRA 2ACTA 1MEMA 3MHSA 1CS8A 4YV8A 2DCCA 3IOQA 3HWNA 4AXLA 2B1NA 1KFXL 1KXRA 4YVAA 2JQGR 1U9VA 5FPWA 2HH5A 3NHEA 4YYVA 1AIMA 4N79A 2DJGB 2DZZA 3KSEA 2AUZA 4Q8HA 4P6GA 2AVWA 2ATOA 4DMYA 1YK7A 3BPMA 3H8CA 3KW9A 4XR7A 1CJLA 1JQPA 4QRVA 3AI8A 3KWZA 2FO5A 1GCBA 2DJFB 1HUCB 3HD3A 4YYSA 1GECE 3B79A 1TLOA 1XKGA 3N4CA 3IUTA 1U5IA 3MTNA 4FJCA 1CVZA 1AU2A 5A24A 1MDWA 1FH0A 4KLBA 4Q8GA 2FRAA 4BPVA 1PPPA 2PBHA 1AU0A 2G6DA 4QBBA 1QXPA 2OULA 3K8UA 1PBHA 1PPNA 1CV8A 5CVNB 3IV2A 1KHQA 3KWBX 1QOLA 1VSNA 2GFOA 3F75A 2C0YA 9PAPA 1QDQA 2R6NA 2G7YA 2XU5A 2B1MA 2FUDA 5CHTA 3N3KA 1U9XA 4CDDB 1F29A 4N8WA 1QMYA 4CDFB 2G8JA 4I05A 1YT7A 4PI3A 1Y4HA 1U9QX 3OISA 2H7JA 4MZSA 4OELA 5CHVA 1O0EA 1AYUA 1M6DA 3IMAA 2HD5A 2JQFR 2OZ2A 3MORA 4N4ZA 3HHIA 3S3QA 1PADA 2DC7A 3E1ZB 2PNSA 2YJ2A 3RVXA 3U8EA 5EF4A 2WBFX 3OVZA 2R9NA 3PBHA 4QH6A 1EWOA 2PADA 2G8EA 1TL9A 1ICFA 1YALA 3USVA 5JA7A 4PADA 1ZCMA 2DZYA 1NB3A 3O0UA 1MHWA 4CDEB 3PDFA 3F5VA 3OF8A 3P5UA 1NL6A 1VJVA 3QT4A 4DMXA 2AYNA
chains in the Genus database with same CATH superfamily
4MSXA 1MIRA 4X6JA 4G54A 4W4UA 5EZQA 4W5BA 4D8EA 2Y5BA 2Z84A 1ITOA 1Y08A 3OVXA 1NB5A 1SP4B 8PCHA 1AECA 2IPPB 4IUMA 1GMYA 4ZUXU 4A5UA 2IBIA 3N3GA 3QJ3A 2P86A 4RF1A 4X6IA 4PP2E 2XU3A 1POPA 3ERVA 2DC9A 1KHPA 4FK5A 2R9OA 1NLJA 4BS6A 7PCKA 1PPDA 1ME4A 3W31A 3WXGA 3I06A 4D8IA 3OQCA 1BGOA 2AS8A 4BOPA 4BQVA 2DCDA 1F2BA 5K16A 4BS5A 3B21A 4AXMA 4RF0A 4HWYA 2Y6EA 3DF0A 3I3TA 2AGAA 2NQDB 2FQ9A 2F1GA 3S3RA 2NQIA 1BP4A 1EF7A 1SNKA 1A6RA 3KKUA 1CB5A 2PREA 4PT5A 1PIPA 3TRKA 3CBKA 4K7CA 2F7DA 1PCIA 2CB5A 2JRIA 3H6SA 3PHWA 3LFYA 2HXZA 1TU6A 3IFUA 1NPZA 2JTCA 1BQIA 3PHXA 3O65A 1CSBB 1AYVA 3MP2A 2R9FA 3RVVA 1CQDA 3IEJA 3WXFA 3HHAA 4R3DA 1STFE 2FYEA 1U9WA 3BC3A 4BSQA 2XU4A 2BTWA 3BWKA 5F02A 1KFUL 3O1GA 2P0RA 2VHFA 1EWLA 3C9EA 2R9MA 3OF9A 3PRPA 1ATKA 1YK8A 5CVMA 3ZNHA 2P7UA 3CBJA 2VHSA 1YZBA 5CVOB 4WA6A 3M99A 3CH2X 1EWMA 2FRQA 1K3BB 4YYQA 2AU1A 2FTDA 3P5XA 1MEGA 1EWPA 4YYUA 5JZEA 2YJ8A 3TNXA 2J7QC 3K9MA 3WXEA 2E03A 4CDCB 3P5VA 2HHNA 3BCNA 1IWDA 1BY8A 3H89A 3V6CA 3BPFA 1CTEA 2AUXA 1Q6KA 2NQGA 2O6XA 2E00A 3V6EA 5JH3A 1PPOA 4BOSA 3PW3A 3ZUAA 5KO3A 3K24A 2E02A 4I04A 2XU1A 1MS6A 4BOQA 4I07A 3MTVA 2E01A 3GCBA 4OVZB 3H7DA 1PE6A 1PXVA 4YYRA 2DCAA 3PSEA 2YJCA 1X9YA 2NQAA 3MHHA 6PADA 4MM3B 1DF0A 5PADA 1F2AA 2OP3A 1AYWA 1UKFA 2YJ9A 4W5CA 1CPJA 4XUIA 1THEA 3CH3X 4P6EA 2FT2A 5EGWA 1NQCA 1GLOA 2R9CA 4RY2A 4M0WA 4CZWA 1AU4A 2BDLA 2DC8A 2BDZA 2DCBA 4QRXA 3RVWA 4X6HA 2ARYA 3QSDA 5J94A 4FIPA 1ME3A 3BOWA 3H8BA 2CIOA 3KFQA 2DOSA 4PP1A 1YVBA 4QRGA 3PRMA 1AU3A 2AIMA 3IHPA 1S4VA 1DEUA 4YYWA 3D6SA 4MZOA 1ZIVA 3P5WA 2UZJA 1F2CA 4OEMA 4OVZA 2DC6A 2YJBA 2AYOA 3LXSA 3KX1A 4RKXA 2GHUA 3PNRA 2ACTA 1MEMA 3MHSA 1CS8A 4YV8A 4RNAA 2DCCA 3IOQA 3HWNA 4AXLA 2B1NA 1KFXL 1KXRA 4YVAA 2JQGR 1U9VA 5FPWA 2HH5A 3NHEA 4YYVA 4OW0A 1AIMA 4N79A 2HWKA 2DJGB 2DZZA 3KSEA 2AUZA 4Q8HA 4P6GA 4HXDB 1PVJA 2AVWA 2ATOA 4DMYA 5EZSA 1YK7A 3BPMA 3H8CA 3KW9A 4XR7A 1CJLA 1JQPA 4QRVA 3AI8A 4IP3A 3KWZA 2FO5A 3HD3A 1GCBA 1HUCB 2DJFB 4YYSA 1GECE 3B79A 1TLOA 1XKGA 3N4CA 3IUTA 1U5IA 3MTNA 4FJCA 1CVZA 1AU2A 5A24A 1MDWA 1FH0A 4KLBA 4Q8GA 2FRAA 4GUAA 4BPVA 1PPPA 2PBHA 1AU0A 2G6DA 4QBBA 1QXPA 2OULA 2FE8A 3K8UA 1PBHA 1PPNA 1CV8A 5CVNB 3IV2A 1KHQA 3KWBX 1QOLA 1VSNA 2GFOA 3BY4A 2J7QA 3F75A 2C0YA 4ZTBA 4WURA 9PAPA 1QDQA 2R6NA 2G7YA 2XU5A 4D8BA 2B1MA 2FUDA 5CHTA 2BU3A 3N3KA 2BTWB 1U9XA 4CDDB 1F29A 4MI7A 4N8WA 1QMYA 4CDFB 2G8JA 3BBAA 4I05A 1YT7A 3PHUA 4PI3A 1Y4HA 1U9QX 3OISA 2H7JA 4MZSA 4OELA 5CHVA 1O0EA 1AYUA 1M6DA 3IMAA 4BOUA 2HD5A 2JQFR 2OZ2A 3MORA 4N4ZA 3W30A 3HHIA 3S3QA 1PADA 2DC7A 3E1ZB 5E6JA 2PNSA 2YJ2A 3C0RA 1DKIA 4BOZA 3RVXA 3U8EA 5EF4A 2WBFX 3OVZA 2R9NA 3PBHA 4QH6A 1EWOA 3RNVA 2PADA 2G8EA 4REZA 1TL9A 1ICFA 1YALA 3USVA 5JA7A 4PADA 3MJ5A 1ZCMA 2DZYA 1NB3A 3BB7A 3PT2A 3TMPA 3E9SA 3O0UA 1MHWA 4CDEB 3PDFA 3F5VA 3OF8A 3P5UA 1NL6A 1VJVA 4XZXA 3QT4A 4P16A 4DMXA 2AYNA
chains in the Genus database with same CATH topology
4MSXA 1MIRA 4X6JA 4G54A 4W4UA 4W5BA 2Y5BA 1ITOA 1Y08A 3OVXA 1NB5A 1SP4B 8PCHA 1AECA 2IPPB 1GMYA 4ZUXU 2IBIA 3N3GA 3QJ3A 2P86A 4X6IA 4PP2E 2XU3A 4FK5A 1POPA 3ERVA 1KHPA 2DC9A 2R9OA 1NLJA 4B55A 4BS6A 7PCKA 1PPDA 1ME4A 3WXGA 3I06A 1BGOA 2AS8A 4BQVA 2DCDA 1F2BA 5K16A 1GX3A 4BS5A 4AXMA 4HWYA 2Y6EA 3DF0A 3I3TA 2NQDB 3D9WA 2FQ9A 2F1GA 3S3RA 2NQIA 1BP4A 1EF7A 1SNKA 1A6RA 4BGFA 3KKUA 1CB5A 2PREA 1PIPA 3CBKA 4K7CA 2F7DA 1PCIA 2CB5A 3H6SA 3LFYA 1W5RA 2HXZA 1TU6A 1NPZA 1BQIA 1CSBB 1AYVA 2R9FA 3RVVA 1CQDA 3IEJA 2VFBA 3WXFA 3HHAA 1STFE 2FYEA 1U9WA 3BC3A 4BSQA 2XU4A 3BWKA 5F02A 1KFUL 3O1GA 1W4TA 2P0RA 2VHFA 1EWLA 3C9EA 2R9MA 3OF9A 1ATKA 1YK8A 5CVMA 2P7UA 3CBJA 2VHSA 5CVOB 4WA6A 3M99A 3CH2X 1EWMA 2FRQA 1K3BB 4YYQA 2AU1A 2FTDA 3P5XA 1MEGA 1EWPA 4YYUA 4NV8A 2YJ8A 3TNXA 3K9MA 3WXEA 2E03A 4CDCB 3P5VA 2HHNA 3BCNA 1IWDA 1BY8A 3H89A 3V6CA 3BPFA 1CTEA 2AUXA 1Q6KA 2NQGA 2O6XA 2E00A 3V6EA 5JH3A 1PPOA 3PW3A 4NV7A 3ZUAA 3K24A 2E02A 4I04A 2XU1A 1MS6A 4I07A 2E01A 3GCBA 3H7DA 1PE6A 1PXVA 4YYRA 2DCAA 2YJCA 1X9YA 2NQAA 3MHHA 6PADA 1DF0A 5PADA 1F2AA 2OP3A 1AYWA 2YJ9A 4W5CA 1CPJA 4XUIA 1THEA 3CH3X 4P6EA 2FT2A 5EGWA 1NQCA 1GLOA 2R9CA 4RY2A 4CZWA 1AU4A 2BDLA 2DC8A 2BDZA 2DCBA 4QRXA 3RVWA 4X6HA 2ARYA 3QSDA 5J94A 4FIPA 1ME3A 3BOWA 3H8BA 2CIOA 3KFQA 4PP1A 1YVBA 4QRGA 1AU3A 2AIMA 3IHPA 1S4VA 1DEUA 4YYWA 3D6SA 4MZOA 1ZIVA 3P5WA 1F2CA 4OEMA 2DC6A 2YJBA 2AYOA 3LXSA 3KX1A 2GHUA 3PNRA 1E2TA 2ACTA 1MEMA 3MHSA 1CS8A 4YV8A 2DCCA 3IOQA 3HWNA 4AXLA 2B1NA 1KFXL 1KXRA 4YVAA 2JQGR 1U9VA 5FPWA 2HH5A 1W6FA 3NHEA 4YYVA 1AIMA 4N79A 2DJGB 2DZZA 3KSEA 2AUZA 4Q8HA 4GUZA 4P6GA 2AVWA 2ATOA 4DMYA 1YK7A 3BPMA 3H8CA 3KW9A 4XR7A 1CJLA 1JQPA 4QRVA 3AI8A 3KWZA 2FO5A 3HD3A 1GCBA 1HUCB 2DJFB 4YYSA 1GECE 3B79A 1TLOA 1XKGA 3N4CA 3IUTA 1U5IA 3MTNA 4FJCA 1CVZA 1AU2A 5A24A 1MDWA 1FH0A 4KLBA 4Q8GA 2FRAA 4BPVA 1PPPA 2PBHA 1AU0A 2G6DA 4QBBA 1QXPA 2OULA 3K8UA 1PBHA 1PPNA 1CV8A 5CVNB 3IV2A 1KHQA 3KWBX 1QOLA 1VSNA 2GFOA 3F75A 2C0YA 9PAPA 1QDQA 2R6NA 2G7YA 2XU5A 2B1MA 2FUDA 2VFCA 5CHTA 3N3KA 1U9XA 4CDDB 1F29A 4N8WA 1QMYA 4CDFB 2G8JA 4I05A 4C5PA 1YT7A 4PI3A 1Y4HA 1U9QX 3OISA 2H7JA 4MZSA 4OELA 5CHVA 1O0EA 1AYUA 1M6DA 3IMAA 2HD5A 2JQFR 2OZ2A 3MORA 4N4ZA 3HHIA 3S3QA 1PADA 2DC7A 3E1ZB 2PNSA 2YJ2A 3RVXA 3U8EA 5EF4A 2WBFX 3OVZA 2R9NA 3PBHA 4QH6A 3LTWA 1EWOA 2PADA 2G8EA 1TL9A 1ICFA 1YALA 3USVA 5JA7A 4PADA 1ZCMA 2DZYA 1NB3A 3O0UA 1MHWA 4CDEB 3PDFA 3F5VA 2BSZA 3OF8A 3P5UA 1NL6A 1VJVA 3QT4A 4DMXA 2AYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSX A;  1MIR A;  4X6J A;  4G54 A;  4W4U A;  4W5B A;  2Y5B A;  1ITO A;  1Y08 A;  3OVX A;  1NB5 A;  1SP4 B;  8PCH A;  1AEC A;  2IPP B;  1GMY A;  4ZUX U;  2IBI A;  3N3G A;  3QJ3 A;  2P86 A;  4X6I A;  4PP2 E;  2XU3 A;  4FK5 A;  1POP A;  3ERV A;  1KHP A;  2DC9 A;  2R9O A;  1NLJ A;  4BS6 A;  7PCK A;  1PPD A;  1ME4 A;  3WXG A;  3I06 A;  1BGO A;  2AS8 A;  4BQV A;  2DCD A;  1F2B A;  5K16 A;  4BS5 A;  4AXM A;  4HWY A;  2Y6E A;  3DF0 A;  3I3T A;  2NQD B;  2FQ9 A;  2F1G A;  3S3R A;  2NQI A;  1BP4 A;  1EF7 A;  1SNK A;  1A6R A;  3KKU A;  1CB5 A;  2PRE A;  1PIP A;  3CBK A;  4K7C A;  2F7D A;  1PCI A;  2CB5 A;  3H6S A;  3LFY A;  2HXZ A;  1TU6 A;  1NPZ A;  1BQI A;  1CSB B;  1AYV A;  2R9F A;  3RVV A;  1CQD A;  3IEJ A;  3WXF A;  3HHA A;  1STF E;  2FYE A;  1U9W A;  3BC3 A;  4BSQ A;  2XU4 A;  3BWK A;  5F02 A;  1KFU L;  3O1G A;  2P0R A;  2VHF A;  1EWL A;  3C9E A;  2R9M A;  3OF9 A;  1ATK A;  1YK8 A;  5CVM A;  2P7U A;  3CBJ A;  2VHS A;  5CVO B;  4WA6 A;  3M99 A;  3CH2 X;  1EWM A;  2FRQ A;  1K3B B;  4YYQ A;  2AU1 A;  2FTD A;  3P5X A;  1MEG A;  1EWP A;  4YYU A;  2YJ8 A;  3TNX A;  3K9M A;  3WXE A;  2E03 A;  4CDC B;  3P5V A;  2HHN A;  3BCN A;  1IWD A;  1BY8 A;  3H89 A;  3V6C A;  3BPF A;  1CTE A;  2AUX A;  1Q6K A;  2NQG A;  2O6X A;  2E00 A;  3V6E A;  5JH3 A;  1PPO A;  3PW3 A;  3ZUA A;  3K24 A;  2E02 A;  4I04 A;  2XU1 A;  1MS6 A;  4I07 A;  2E01 A;  3GCB A;  3H7D A;  1PE6 A;  1PXV A;  4YYR A;  2DCA A;  2YJC A;  1X9Y A;  2NQA A;  3MHH A;  6PAD A;  1DF0 A;  5PAD A;  1F2A A;  2OP3 A;  1AYW A;  2YJ9 A;  4W5C A;  1CPJ A;  4XUI A;  1THE A;  3CH3 X;  4P6E A;  2FT2 A;  5EGW A;  1NQC A;  1GLO A;  2R9C A;  4RY2 A;  4CZW A;  1AU4 A;  2BDL A;  2DC8 A;  2BDZ A;  2DCB A;  4QRX A;  3RVW A;  4X6H A;  2ARY A;  3QSD A;  5J94 A;  4FIP A;  1ME3 A;  3BOW A;  3H8B A;  2CIO A;  3KFQ A;  4PP1 A;  1YVB A;  4QRG A;  1AU3 A;  2AIM A;  3IHP A;  1S4V A;  1DEU A;  4YYW A;  3D6S A;  4MZO A;  1ZIV A;  3P5W A;  1F2C A;  4OEM A;  2DC6 A;  2YJB A;  2AYO A;  3LXS A;  3KX1 A;  2GHU A;  3PNR A;  2ACT A;  1MEM A;  3MHS A;  1CS8 A;  4YV8 A;  2DCC A;  3IOQ A;  3HWN A;  4AXL A;  2B1N A;  1KFX L;  1KXR A;  4YVA A;  2JQG R;  1U9V A;  5FPW A;  2HH5 A;  3NHE A;  4YYV A;  1AIM A;  4N79 A;  2DJG B;  2DZZ A;  3KSE A;  2AUZ A;  4Q8H A;  4P6G A;  2AVW A;  2ATO A;  4DMY A;  1YK7 A;  3BPM A;  3H8C A;  3KW9 A;  4XR7 A;  1CJL A;  1JQP A;  4QRV A;  3AI8 A;  3KWZ A;  2FO5 A;  1GCB A;  2DJF B;  1HUC B;  3HD3 A;  4YYS A;  1GEC E;  3B79 A;  1TLO A;  1XKG A;  3N4C A;  3IUT A;  1U5I A;  3MTN A;  4FJC A;  1CVZ A;  1AU2 A;  5A24 A;  1MDW A;  1FH0 A;  4KLB A;  4Q8G A;  2FRA A;  4BPV A;  1PPP A;  2PBH A;  1AU0 A;  2G6D A;  4QBB A;  1QXP A;  2OUL A;  3K8U A;  1PBH A;  1PPN A;  1CV8 A;  5CVN B;  3IV2 A;  1KHQ A;  3KWB X;  1QOL A;  1VSN A;  2GFO A;  3F75 A;  2C0Y A;  9PAP A;  1QDQ A;  2R6N A;  2G7Y A;  2XU5 A;  2B1M A;  2FUD A;  5CHT A;  3N3K A;  1U9X A;  4CDD B;  1F29 A;  4N8W A;  1QMY A;  4CDF B;  2G8J A;  4I05 A;  1YT7 A;  4PI3 A;  1Y4H A;  1U9Q X;  3OIS A;  2H7J A;  4MZS A;  4OEL A;  5CHV A;  1O0E A;  1AYU A;  1M6D A;  3IMA A;  2HD5 A;  2JQF R;  2OZ2 A;  3MOR A;  4N4Z A;  3HHI A;  3S3Q A;  1PAD A;  2DC7 A;  3E1Z B;  2PNS A;  2YJ2 A;  3RVX A;  3U8E A;  5EF4 A;  2WBF X;  3OVZ A;  2R9N A;  3PBH A;  4QH6 A;  1EWO A;  2PAD A;  2G8E A;  1TL9 A;  1ICF A;  1YAL A;  3USV A;  5JA7 A;  4PAD A;  1ZCM A;  2DZY A;  1NB3 A;  3O0U A;  1MHW A;  4CDE B;  3PDF A;  3F5V A;  3OF8 A;  3P5U A;  1NL6 A;  1VJV A;  3QT4 A;  4DMX A;  2AYN A; 
#chains in the Genus database with same CATH topology
 4MSX A;  1MIR A;  4X6J A;  4G54 A;  4W4U A;  5EZQ A;  4W5B A;  4D8E A;  2Y5B A;  2Z84 A;  1ITO A;  1Y08 A;  3OVX A;  1NB5 A;  1SP4 B;  8PCH A;  1AEC A;  2IPP B;  4IUM A;  1GMY A;  4ZUX U;  4A5U A;  2IBI A;  3N3G A;  3QJ3 A;  2P86 A;  4RF1 A;  4X6I A;  4PP2 E;  2XU3 A;  1POP A;  3ERV A;  2DC9 A;  1KHP A;  4FK5 A;  2R9O A;  1NLJ A;  4BS6 A;  7PCK A;  1PPD A;  1ME4 A;  3W31 A;  3WXG A;  3I06 A;  4D8I A;  3OQC A;  1BGO A;  2AS8 A;  4BOP A;  4BQV A;  2DCD A;  1F2B A;  5K16 A;  4BS5 A;  3B21 A;  4AXM A;  4RF0 A;  4HWY A;  2Y6E A;  3DF0 A;  3I3T A;  2AGA A;  2NQD B;  2FQ9 A;  2F1G A;  3S3R A;  2NQI A;  1BP4 A;  1EF7 A;  1SNK A;  1A6R A;  3KKU A;  1CB5 A;  2PRE A;  4PT5 A;  1PIP A;  3TRK A;  3CBK A;  4K7C A;  2F7D A;  1PCI A;  2CB5 A;  2JRI A;  3H6S A;  3PHW A;  3LFY A;  2HXZ A;  1TU6 A;  3IFU A;  1NPZ A;  2JTC A;  1BQI A;  3PHX A;  3O65 A;  1CSB B;  1AYV A;  3MP2 A;  2R9F A;  3RVV A;  1CQD A;  3IEJ A;  3WXF A;  3HHA A;  4R3D A;  1STF E;  2FYE A;  1U9W A;  3BC3 A;  4BSQ A;  2XU4 A;  2BTW A;  3BWK A;  5F02 A;  1KFU L;  3O1G A;  2P0R A;  2VHF A;  1EWL A;  3C9E A;  2R9M A;  3OF9 A;  3PRP A;  1ATK A;  1YK8 A;  5CVM A;  3ZNH A;  2P7U A;  3CBJ A;  2VHS A;  1YZB A;  5CVO B;  4WA6 A;  3M99 A;  3CH2 X;  1EWM A;  2FRQ A;  1K3B B;  4YYQ A;  2AU1 A;  2FTD A;  3P5X A;  1MEG A;  1EWP A;  4YYU A;  5JZE A;  2YJ8 A;  3TNX A;  2J7Q C;  3K9M A;  3WXE A;  2E03 A;  4CDC B;  3P5V A;  2HHN A;  3BCN A;  1IWD A;  1BY8 A;  3H89 A;  3V6C A;  3BPF A;  1CTE A;  2AUX A;  1Q6K A;  2NQG A;  2O6X A;  2E00 A;  3V6E A;  5JH3 A;  1PPO A;  4BOS A;  3PW3 A;  3ZUA A;  5KO3 A;  3K24 A;  2E02 A;  4I04 A;  2XU1 A;  1MS6 A;  4BOQ A;  4I07 A;  3MTV A;  2E01 A;  3GCB A;  4OVZ B;  3H7D A;  1PE6 A;  1PXV A;  4YYR A;  2DCA A;  3PSE A;  2YJC A;  1X9Y A;  2NQA A;  3MHH A;  6PAD A;  4MM3 B;  1DF0 A;  5PAD A;  1F2A A;  2OP3 A;  1AYW A;  1UKF A;  2YJ9 A;  4W5C A;  1CPJ A;  4XUI A;  1THE A;  3CH3 X;  4P6E A;  2FT2 A;  5EGW A;  1NQC A;  1GLO A;  2R9C A;  4RY2 A;  4M0W A;  4CZW A;  1AU4 A;  2BDL A;  2DC8 A;  2BDZ A;  2DCB A;  4QRX A;  3RVW A;  4X6H A;  2ARY A;  3QSD A;  5J94 A;  4FIP A;  1ME3 A;  3BOW A;  3H8B A;  2CIO A;  3KFQ A;  2DOS A;  4PP1 A;  1YVB A;  4QRG A;  3PRM A;  1AU3 A;  2AIM A;  3IHP A;  1S4V A;  1DEU A;  4YYW A;  3D6S A;  4MZO A;  1ZIV A;  3P5W A;  2UZJ A;  1F2C A;  4OEM A;  4OVZ A;  2DC6 A;  2YJB A;  2AYO A;  3LXS A;  3KX1 A;  4RKX A;  2GHU A;  3PNR A;  2ACT A;  1MEM A;  3MHS A;  1CS8 A;  4YV8 A;  4RNA A;  2DCC A;  3IOQ A;  3HWN A;  4AXL A;  2B1N A;  1KFX L;  1KXR A;  4YVA A;  2JQG R;  1U9V A;  5FPW A;  2HH5 A;  3NHE A;  4YYV A;  4OW0 A;  1AIM A;  4N79 A;  2HWK A;  2DJG B;  2DZZ A;  3KSE A;  2AUZ A;  4Q8H A;  4P6G A;  4HXD B;  1PVJ A;  2AVW A;  2ATO A;  4DMY A;  5EZS A;  1YK7 A;  3BPM A;  3H8C A;  3KW9 A;  4XR7 A;  1CJL A;  1JQP A;  4QRV A;  3AI8 A;  4IP3 A;  3KWZ A;  2FO5 A;  3HD3 A;  1GCB A;  1HUC B;  2DJF B;  4YYS A;  1GEC E;  3B79 A;  1TLO A;  1XKG A;  3N4C A;  3IUT A;  1U5I A;  3MTN A;  4FJC A;  1CVZ A;  1AU2 A;  5A24 A;  1MDW A;  1FH0 A;  4KLB A;  4Q8G A;  2FRA A;  4GUA A;  4BPV A;  1PPP A;  2PBH A;  1AU0 A;  2G6D A;  4QBB A;  1QXP A;  2OUL A;  2FE8 A;  3K8U A;  1PBH A;  1PPN A;  1CV8 A;  5CVN B;  3IV2 A;  1KHQ A;  3KWB X;  1QOL A;  1VSN A;  2GFO A;  3BY4 A;  2J7Q A;  3F75 A;  2C0Y A;  4ZTB A;  4WUR A;  9PAP A;  1QDQ A;  2R6N A;  2G7Y A;  2XU5 A;  4D8B A;  2B1M A;  2FUD A;  5CHT A;  2BU3 A;  3N3K A;  2BTW B;  1U9X A;  4CDD B;  1F29 A;  4MI7 A;  4N8W A;  1QMY A;  4CDF B;  2G8J A;  3BBA A;  4I05 A;  1YT7 A;  3PHU A;  4PI3 A;  1Y4H A;  1U9Q X;  3OIS A;  2H7J A;  4MZS A;  4OEL A;  5CHV A;  1O0E A;  1AYU A;  1M6D A;  3IMA A;  4BOU A;  2HD5 A;  2JQF R;  2OZ2 A;  3MOR A;  4N4Z A;  3W30 A;  3HHI A;  3S3Q A;  1PAD A;  2DC7 A;  3E1Z B;  5E6J A;  2PNS A;  2YJ2 A;  3C0R A;  1DKI A;  4BOZ A;  3RVX A;  3U8E A;  5EF4 A;  2WBF X;  3OVZ A;  2R9N A;  3PBH A;  4QH6 A;  1EWO A;  3RNV A;  2PAD A;  2G8E A;  4REZ A;  1TL9 A;  1ICF A;  1YAL A;  3USV A;  5JA7 A;  4PAD A;  3MJ5 A;  1ZCM A;  2DZY A;  1NB3 A;  3BB7 A;  3PT2 A;  3TMP A;  3E9S A;  3O0U A;  1MHW A;  4CDE B;  3PDF A;  3F5V A;  3OF8 A;  3P5U A;  1NL6 A;  1VJV A;  4XZX A;  3QT4 A;  4P16 A;  4DMX A;  2AYN A; 
#chains in the Genus database with same CATH homology
 4MSX A;  1MIR A;  4X6J A;  4G54 A;  4W4U A;  4W5B A;  2Y5B A;  1ITO A;  1Y08 A;  3OVX A;  1NB5 A;  1SP4 B;  8PCH A;  1AEC A;  2IPP B;  1GMY A;  4ZUX U;  2IBI A;  3N3G A;  3QJ3 A;  2P86 A;  4X6I A;  4PP2 E;  2XU3 A;  4FK5 A;  1POP A;  3ERV A;  1KHP A;  2DC9 A;  2R9O A;  1NLJ A;  4B55 A;  4BS6 A;  7PCK A;  1PPD A;  1ME4 A;  3WXG A;  3I06 A;  1BGO A;  2AS8 A;  4BQV A;  2DCD A;  1F2B A;  5K16 A;  1GX3 A;  4BS5 A;  4AXM A;  4HWY A;  2Y6E A;  3DF0 A;  3I3T A;  2NQD B;  3D9W A;  2FQ9 A;  2F1G A;  3S3R A;  2NQI A;  1BP4 A;  1EF7 A;  1SNK A;  1A6R A;  4BGF A;  3KKU A;  1CB5 A;  2PRE A;  1PIP A;  3CBK A;  4K7C A;  2F7D A;  1PCI A;  2CB5 A;  3H6S A;  3LFY A;  1W5R A;  2HXZ A;  1TU6 A;  1NPZ A;  1BQI A;  1CSB B;  1AYV A;  2R9F A;  3RVV A;  1CQD A;  3IEJ A;  2VFB A;  3WXF A;  3HHA A;  1STF E;  2FYE A;  1U9W A;  3BC3 A;  4BSQ A;  2XU4 A;  3BWK A;  5F02 A;  1KFU L;  3O1G A;  1W4T A;  2P0R A;  2VHF A;  1EWL A;  3C9E A;  2R9M A;  3OF9 A;  1ATK A;  1YK8 A;  5CVM A;  2P7U A;  3CBJ A;  2VHS A;  5CVO B;  4WA6 A;  3M99 A;  3CH2 X;  1EWM A;  2FRQ A;  1K3B B;  4YYQ A;  2AU1 A;  2FTD A;  3P5X A;  1MEG A;  1EWP A;  4YYU A;  4NV8 A;  2YJ8 A;  3TNX A;  3K9M A;  3WXE A;  2E03 A;  4CDC B;  3P5V A;  2HHN A;  3BCN A;  1IWD A;  1BY8 A;  3H89 A;  3V6C A;  3BPF A;  1CTE A;  2AUX A;  1Q6K A;  2NQG A;  2O6X A;  2E00 A;  3V6E A;  5JH3 A;  1PPO A;  3PW3 A;  4NV7 A;  3ZUA A;  3K24 A;  2E02 A;  4I04 A;  2XU1 A;  1MS6 A;  4I07 A;  2E01 A;  3GCB A;  3H7D A;  1PE6 A;  1PXV A;  4YYR A;  2DCA A;  2YJC A;  1X9Y A;  2NQA A;  3MHH A;  6PAD A;  1DF0 A;  5PAD A;  1F2A A;  2OP3 A;  1AYW A;  2YJ9 A;  4W5C A;  1CPJ A;  4XUI A;  1THE A;  3CH3 X;  4P6E A;  2FT2 A;  5EGW A;  1NQC A;  1GLO A;  2R9C A;  4RY2 A;  4CZW A;  1AU4 A;  2BDL A;  2DC8 A;  2BDZ A;  2DCB A;  4QRX A;  3RVW A;  4X6H A;  2ARY A;  3QSD A;  5J94 A;  4FIP A;  1ME3 A;  3BOW A;  3H8B A;  2CIO A;  3KFQ A;  4PP1 A;  1YVB A;  4QRG A;  1AU3 A;  2AIM A;  3IHP A;  1S4V A;  1DEU A;  4YYW A;  3D6S A;  4MZO A;  1ZIV A;  3P5W A;  1F2C A;  4OEM A;  2DC6 A;  2YJB A;  2AYO A;  3LXS A;  3KX1 A;  2GHU A;  3PNR A;  1E2T A;  2ACT A;  1MEM A;  3MHS A;  1CS8 A;  4YV8 A;  2DCC A;  3IOQ A;  3HWN A;  4AXL A;  2B1N A;  1KFX L;  1KXR A;  4YVA A;  2JQG R;  1U9V A;  5FPW A;  2HH5 A;  1W6F A;  3NHE A;  4YYV A;  1AIM A;  4N79 A;  2DJG B;  2DZZ A;  3KSE A;  2AUZ A;  4Q8H A;  4GUZ A;  4P6G A;  2AVW A;  2ATO A;  4DMY A;  1YK7 A;  3BPM A;  3H8C A;  3KW9 A;  4XR7 A;  1CJL A;  1JQP A;  4QRV A;  3AI8 A;  3KWZ A;  2FO5 A;  3HD3 A;  1GCB A;  1HUC B;  2DJF B;  4YYS A;  1GEC E;  3B79 A;  1TLO A;  1XKG A;  3N4C A;  3IUT A;  1U5I A;  3MTN A;  4FJC A;  1CVZ A;  1AU2 A;  5A24 A;  1MDW A;  1FH0 A;  4KLB A;  4Q8G A;  2FRA A;  4BPV A;  1PPP A;  2PBH A;  1AU0 A;  2G6D A;  4QBB A;  1QXP A;  2OUL A;  3K8U A;  1PBH A;  1PPN A;  1CV8 A;  5CVN B;  3IV2 A;  1KHQ A;  3KWB X;  1QOL A;  1VSN A;  2GFO A;  3F75 A;  2C0Y A;  9PAP A;  1QDQ A;  2R6N A;  2G7Y A;  2XU5 A;  2B1M A;  2FUD A;  2VFC A;  5CHT A;  3N3K A;  1U9X A;  4CDD B;  1F29 A;  4N8W A;  1QMY A;  4CDF B;  2G8J A;  4I05 A;  4C5P A;  1YT7 A;  4PI3 A;  1Y4H A;  1U9Q X;  3OIS A;  2H7J A;  4MZS A;  4OEL A;  5CHV A;  1O0E A;  1AYU A;  1M6D A;  3IMA A;  2HD5 A;  2JQF R;  2OZ2 A;  3MOR A;  4N4Z A;  3HHI A;  3S3Q A;  1PAD A;  2DC7 A;  3E1Z B;  2PNS A;  2YJ2 A;  3RVX A;  3U8E A;  5EF4 A;  2WBF X;  3OVZ A;  2R9N A;  3PBH A;  4QH6 A;  3LTW A;  1EWO A;  2PAD A;  2G8E A;  1TL9 A;  1ICF A;  1YAL A;  3USV A;  5JA7 A;  4PAD A;  1ZCM A;  2DZY A;  1NB3 A;  3O0U A;  1MHW A;  4CDE B;  3PDF A;  3F5V A;  2BSZ A;  3OF8 A;  3P5U A;  1NL6 A;  1VJV A;  3QT4 A;  4DMX A;  2AYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...