4KLBA

Crystal structure of cruzain in complex with the non-covalent inhibitor nequimed176
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cruzipain
publication title Non-peptidic Cruzain Inhibitors with Trypanocidal Activity Discovered by Virtual Screening and In Vitro Assay.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4klbA00
2YJ2A 4WA6A 4W5BA 2FRQA 2AVWA 2AUXA 2G7YA 1ATKA 1BY8A 2PREA 1SNKA 1YK7A 6PADA 1CTEA 1U5IA 2VHSA 3IOQA 3MHSA 2DCAA 2NQGA 1AIMA 3KFQA 2DC7A 2AIMA 2FTDA 3MHHA 2FO5A 3M99A 1STFE 3QSDA 3BC3A 2GFOA 1BGOA 3U8EA 9PAPA 1VSNA 3LXSA 4YYRA 1O0EA 1SP4B 2PNSA 1DEUA 3P5VA 2P0RA 4MZOA 4N79A 3MTNA 1Q6KA 3K9MA 1EWMA 4MZSA 3PNRA 1IWDA 1ZCMA 2YJ9A 4YYWA 3RVVA 4P6EA 3V6EA 3KSEA 3RVWA 4DMXA 1Y4HA 1KHPA 2OULA 2G6DA 4PADA 2E00A 1AU2A 2B1MA 3K8UA 1FH0A 4HWYA 5PADA 2DZZA 4OELA 3KKUA 1U9QX 3D6SA 3OF9A 4ZUXU 1F29A 1EWPA 4W5CA 4QH6A 3F75A 2FUDA 4YVAA 2HH5A 1U9XA 3IV2A 1PADA 2BDZA 3HD3A 1GCBA 5FPWA 1CPJA 3CH2X 4OEMA 1DF0A 2AYOA 3GCBA 4PP2E 1PE6A 1MEMA 5F02A 2Y6EA 3O1GA 1THEA 2AUZA 1VJVA 3E1ZB 1GLOA 4W4UA 2FQ9A 2JQGR 1QOLA 1QMYA 2NQIA 1KXRA 3P5UA 2E01A 3I06A 4QRGA 1GMYA 2G8JA 2B1NA 1ZIVA 3BCNA 3LFYA 2H7JA 4AXMA 5EGWA 3PBHA 3DF0A 1KFUL 1EF7A 1K3BB 4FK5A 4KLBA 4QRVA 5CHTA 1S4VA 1CSBB 2YJ8A 1ME3A 2PADA 3V6CA 3RVXA 2R6NA 3KWBX 4X6IA 2DC8A 4X6JA 3PW3A 2C0YA 5CVMA 1CJLA 2E02A 2XU4A 2XU1A 3ZUAA 1PCIA 3I3TA 4PP1A 1F2CA 5K16A 2DJFB 3ERVA 4XR7A 4N8WA 4FJCA 1TL9A 4XUIA 3KWZA 1GECE 1YT7A 4CDCB 3P5WA 3O0UA 4BSQA 2DCCA 4BS6A 2P7UA 2F1GA 2R9MA 2YJBA 5JH3A 1EWOA 4I07A 5EF4A 2ARYA 1CQDA 3IUTA 1NLJA 3HHIA 2HXZA 1BP4A 4G54A 2DZYA 3TNXA 4CDFB 1AECA 3C9EA 1AYWA 1ME4A 4CDDB 1CS8A 3N3GA 3KW9A 2G8EA 4PI3A 2FT2A 1A6RA 1KHQA 3QJ3A 2AU1A 4X6HA 3N3KA 1BQIA 2VHFA 5CVNB 5A24A 2Y5BA 4YYVA 3QT4A 4DMYA 2WBFX 1XKGA 3OF8A 1NB3A 2FYEA 3P5XA 4YYUA 1F2AA 4YYSA 1PBHA 3F5VA 1JQPA 1QXPA 1U9VA 1AU4A 2IPPB 3CH3X 2OP3A 1EWLA 1YALA 3BPMA 3IHPA 2R9NA 1TU6A 2NQDB 1NB5A 4N4ZA 5CHVA 2XU5A 1TLOA 3B79A 2YJCA 2NQAA 1KFXL 2AYNA 1PIPA 3H89A 2ACTA 4QRXA 5J94A 3OISA 1YK8A 3S3QA 4AXLA 1ICFA 2CIOA 1F2BA 4P6GA 5JA7A 2XU3A 3HHAA 2ATOA 4RY2A 3WXEA 4Q8HA 2DJGB 3CBJA 1CVZA 3PDFA 1YVBA 2DC9A 3N4CA 2OZ2A 1MDWA 1AYUA 1CB5A 3CBKA 1NQCA 3BWKA 3MORA 3OVXA 1PPPA 4MSXA 3S3RA 5CVOB 7PCKA 1AU0A 3HWNA 2R9OA 2HHNA 4YYQA 2IBIA 2HD5A 4K7CA 2R9FA 1PPNA 2R9CA 3KX1A 1MEGA 4I05A 2AS8A 3BOWA 3H6SA 4BS5A 2JQFR 3IEJA 2DCDA 3OVZA 1NPZA 1PPOA 1QDQA 2F7DA 4FIPA 3USVA 3WXGA 3WXFA 3H8CA 4QBBA 1ITOA 1PPDA 2GHUA 2DCBA 2BDLA 4BPVA 4CZWA 1MIRA 3IMAA 1CV8A 1HUCB 4Q8GA 1X9YA 2PBHA 3BPFA 2DC6A 4YV8A 2E03A 3H8BA 4BQVA 8PCHA 1POPA 2O6XA 2CB5A 1AYVA 1NL6A 1M6DA 4CDEB 1AU3A 2FRAA 1Y08A 3H7DA 2P86A 1PXVA 3NHEA 3K24A 1MS6A 1U9WA 4I04A 3AI8A 1MHWA
chains in the Genus database with same CATH superfamily
2YJ2A 4WA6A 4W5BA 2FRQA 3PSEA 2AVWA 2AUXA 2G7YA 1ATKA 1BY8A 2PREA 1SNKA 1YK7A 4PT5A 6PADA 1CTEA 1U5IA 2VHSA 3IOQA 4BOQA 4OW0A 3MHSA 2DCAA 2NQGA 1AIMA 3KFQA 2DC7A 5E6JA 2AIMA 1PVJA 2FTDA 3MHHA 2FO5A 3M99A 1STFE 3QSDA 3BC3A 2GFOA 1BGOA 3U8EA 9PAPA 1VSNA 3LXSA 4YYRA 1O0EA 1SP4B 2PNSA 1DEUA 3P5VA 2P0RA 4MZOA 4N79A 3MTNA 1Q6KA 3K9MA 3O65A 1EWMA 4MZSA 3PNRA 5JZEA 1IWDA 1ZCMA 2YJ9A 4YYWA 2JTCA 3RVVA 4P6EA 4MM3B 3V6EA 3KSEA 3BB7A 3RVWA 3PHXA 4DMXA 1Y4HA 1KHPA 2OULA 2JRIA 2G6DA 4PADA 3RNVA 2E00A 1AU2A 2B1MA 3K8UA 1FH0A 4HWYA 5PADA 2DZZA 4OELA 3KKUA 1U9QX 3D6SA 3OF9A 4ZUXU 1F29A 1EWPA 4W5CA 4QH6A 3F75A 2FUDA 4RF0A 2BTWB 4YVAA 2HH5A 1U9XA 3IV2A 1PADA 2BDZA 3HD3A 1GCBA 5FPWA 4D8BA 1CPJA 3CH2X 4OEMA 1DF0A 2AYOA 3GCBA 4PP2E 1PE6A 1MEMA 5F02A 3TMPA 3BBAA 2Y6EA 3O1GA 1THEA 2AUZA 1VJVA 3E1ZB 1GLOA 3MTVA 4W4UA 2FQ9A 2JQGR 1QOLA 1QMYA 2NQIA 1KXRA 3P5UA 2E01A 3I06A 4QRGA 1GMYA 2G8JA 2B1NA 1ZIVA 3BCNA 3PHWA 3LFYA 2H7JA 4AXMA 5EGWA 4P16A 3PBHA 3DF0A 1KFUL 1EF7A 1K3BB 4FK5A 4KLBA 4QRVA 5CHTA 1S4VA 1CSBB 2YJ8A 1ME3A 2PADA 3V6CA 3RVXA 2R6NA 3KWBX 4X6IA 2DC8A 4X6JA 3PW3A 2C0YA 5CVMA 4IUMA 1CJLA 2E02A 2XU4A 1YZBA 2XU1A 3ZUAA 1PCIA 4HXDB 3I3TA 4PP1A 1F2CA 5K16A 2DJFB 3ERVA 4XR7A 4D8IA 4N8WA 4ZTBA 4FJCA 1TL9A 4OVZA 4XUIA 3KWZA 1GECE 1YT7A 4CDCB 3P5WA 3O0UA 4MI7A 4BSQA 2DCCA 4BS6A 2P7UA 2F1GA 2R9MA 2YJBA 5JH3A 1EWOA 4I07A 5EF4A 2ARYA 1CQDA 2Z84A 3BY4A 3IUTA 1NLJA 3HHIA 2HXZA 1BP4A 4G54A 2DZYA 3TNXA 4CDFB 1AECA 3C9EA 1AYWA 1ME4A 4CDDB 4WURA 1CS8A 2UZJA 3N3GA 2BU3A 3KW9A 2G8EA 3PRMA 4PI3A 2FT2A 1A6RA 3C0RA 4XZXA 1KHQA 3QJ3A 4BOSA 2AU1A 4X6HA 3N3KA 1BQIA 2VHFA 5CVNB 4A5UA 5A24A 2Y5BA 3W30A 3IFUA 4YYVA 3QT4A 4DMYA 2WBFX 1XKGA 3OF8A 1NB3A 4RNAA 2FYEA 3P5XA 4YYUA 1F2AA 3W31A 4YYSA 1PBHA 3F5VA 1JQPA 1QXPA 1U9VA 1AU4A 2IPPB 3CH3X 2OP3A 1EWLA 1YALA 3BPMA 3IHPA 2R9NA 1TU6A 5EZSA 2NQDB 1NB5A 4N4ZA 5CHVA 2XU5A 1TLOA 3OQCA 5KO3A 3B21A 3B79A 2YJCA 2NQAA 1KFXL 2AYNA 1PIPA 3H89A 2ACTA 4QRXA 4IP3A 5J94A 3OISA 1YK8A 3PRPA 3S3QA 2DOSA 4AXLA 1ICFA 2BTWA 4RKXA 2CIOA 1F2BA 4P6GA 5JA7A 2XU3A 3HHAA 4M0WA 2ATOA 2J7QA 4RY2A 3WXEA 4Q8HA 2DJGB 3CBJA 3ZNHA 1CVZA 3PT2A 2FE8A 2AGAA 3PDFA 3N4CA 1YVBA 2DC9A 2J7QC 2OZ2A 4D8EA 1MDWA 3MP2A 1AYUA 1CB5A 3CBKA 1NQCA 3BWKA 3MORA 3OVXA 1PPPA 4MSXA 3S3RA 5CVOB 7PCKA 4BOZA 1AU0A 3HWNA 2R9OA 2HHNA 4YYQA 5EZQA 2IBIA 2HD5A 4K7CA 2R9FA 1PPNA 2R9CA 3KX1A 1MEGA 4I05A 2AS8A 3BOWA 3H6SA 4BS5A 2JQFR 3IEJA 4RF1A 2DCDA 3OVZA 1NPZA 4BOUA 1PPOA 1QDQA 2F7DA 4FIPA 3USVA 3WXGA 3WXFA 3H8CA 4QBBA 1ITOA 1PPDA 2GHUA 2DCBA 2HWKA 3E9SA 2BDLA 4BPVA 4CZWA 1MIRA 3IMAA 1CV8A 1HUCB 4Q8GA 1X9YA 3PHUA 1UKFA 1DKIA 2PBHA 3BPFA 4GUAA 3MJ5A 2DC6A 4YV8A 2E03A 4R3DA 3H8BA 4BQVA 8PCHA 4OVZB 1POPA 2O6XA 2CB5A 1AYVA 4REZA 1NL6A 1M6DA 4BOPA 4CDEB 1AU3A 2FRAA 1Y08A 3H7DA 2P86A 1PXVA 3NHEA 3TRKA 3K24A 1MS6A 1U9WA 4I04A 3AI8A 1MHWA
chains in the Genus database with same CATH topology
2YJ2A 4WA6A 4W5BA 2FRQA 2AVWA 2AUXA 2G7YA 1ATKA 1BY8A 2PREA 1GX3A 1SNKA 1YK7A 6PADA 1CTEA 1U5IA 2VHSA 3IOQA 3MHSA 2DCAA 2NQGA 1AIMA 3KFQA 2DC7A 2AIMA 2FTDA 3MHHA 2FO5A 3M99A 1STFE 3QSDA 3BC3A 2GFOA 1BGOA 3U8EA 9PAPA 1VSNA 3LXSA 4YYRA 1O0EA 1SP4B 2PNSA 1DEUA 3P5VA 2P0RA 4MZOA 4N79A 3MTNA 1Q6KA 3K9MA 1EWMA 4MZSA 3PNRA 1IWDA 1ZCMA 2YJ9A 4YYWA 3RVVA 4P6EA 3V6EA 3KSEA 3RVWA 4DMXA 1Y4HA 1KHPA 2OULA 2G6DA 4PADA 2E00A 1W4TA 1AU2A 2B1MA 3K8UA 1FH0A 4HWYA 5PADA 2DZZA 4OELA 3KKUA 3D9WA 1U9QX 3D6SA 3OF9A 4ZUXU 1F29A 1EWPA 4W5CA 4QH6A 3F75A 2FUDA 4YVAA 2HH5A 1U9XA 3IV2A 1PADA 2BDZA 3HD3A 1GCBA 5FPWA 1CPJA 3CH2X 4OEMA 1DF0A 2AYOA 3GCBA 4PP2E 1PE6A 1MEMA 5F02A 2Y6EA 3O1GA 1THEA 2AUZA 1VJVA 3E1ZB 1GLOA 4W4UA 2FQ9A 2JQGR 1QOLA 1QMYA 2NQIA 1KXRA 3P5UA 2E01A 3I06A 4QRGA 1GMYA 2G8JA 2B1NA 1ZIVA 3BCNA 3LFYA 2H7JA 4AXMA 5EGWA 3PBHA 3DF0A 1KFUL 1EF7A 1K3BB 4FK5A 4KLBA 4QRVA 5CHTA 1S4VA 1CSBB 2YJ8A 1ME3A 2PADA 3V6CA 3RVXA 2R6NA 3KWBX 4X6IA 2DC8A 4X6JA 3PW3A 2C0YA 5CVMA 1CJLA 2E02A 2XU4A 2XU1A 3ZUAA 1PCIA 3I3TA 3LTWA 4PP1A 1F2CA 5K16A 2DJFB 3ERVA 4XR7A 4N8WA 4FJCA 1TL9A 4XUIA 3KWZA 1GECE 1YT7A 4CDCB 3P5WA 3O0UA 4BSQA 2DCCA 4BS6A 2P7UA 2F1GA 2R9MA 2YJBA 5JH3A 1EWOA 4I07A 5EF4A 2ARYA 2VFCA 1CQDA 3IUTA 1NLJA 3HHIA 2HXZA 1W5RA 1BP4A 4G54A 2DZYA 3TNXA 4CDFB 1AECA 3C9EA 1AYWA 1ME4A 4CDDB 1CS8A 3N3GA 3KW9A 2G8EA 4PI3A 2FT2A 2VFBA 1A6RA 4GUZA 1KHQA 3QJ3A 2AU1A 4X6HA 3N3KA 1BQIA 2VHFA 5CVNB 5A24A 2Y5BA 4YYVA 3QT4A 4DMYA 2WBFX 1XKGA 3OF8A 1NB3A 2FYEA 3P5XA 4YYUA 1F2AA 4YYSA 4B55A 1PBHA 3F5VA 1JQPA 1QXPA 1U9VA 1AU4A 2IPPB 3CH3X 2OP3A 1EWLA 1YALA 3BPMA 3IHPA 2R9NA 1TU6A 2NQDB 1NB5A 4N4ZA 5CHVA 2XU5A 1TLOA 4NV7A 3B79A 2YJCA 1E2TA 1KFXL 2NQAA 2AYNA 1PIPA 3H89A 2ACTA 4QRXA 5J94A 3OISA 1YK8A 4NV8A 3S3QA 4AXLA 1ICFA 2CIOA 1F2BA 4P6GA 5JA7A 2XU3A 3HHAA 2ATOA 4RY2A 3WXEA 4Q8HA 2DJGB 3CBJA 1CVZA 3PDFA 3N4CA 1YVBA 2DC9A 2OZ2A 1MDWA 1AYUA 1CB5A 3CBKA 1NQCA 3BWKA 3MORA 3OVXA 1PPPA 4MSXA 3S3RA 5CVOB 7PCKA 1AU0A 3HWNA 2R9OA 2HHNA 4YYQA 2IBIA 2HD5A 4K7CA 2R9FA 1PPNA 2R9CA 3KX1A 1MEGA 4I05A 4C5PA 2AS8A 3BOWA 3H6SA 4BS5A 2JQFR 3IEJA 2DCDA 3OVZA 1NPZA 1PPOA 1QDQA 2F7DA 4FIPA 3USVA 3WXGA 3WXFA 3H8CA 4QBBA 1ITOA 1PPDA 2GHUA 2DCBA 2BDLA 4BGFA 4BPVA 4CZWA 1MIRA 3IMAA 1CV8A 1HUCB 4Q8GA 1X9YA 2PBHA 3BPFA 2DC6A 4YV8A 2E03A 3H8BA 4BQVA 8PCHA 1POPA 2O6XA 2CB5A 1AYVA 2BSZA 1NL6A 1M6DA 4CDEB 1AU3A 2FRAA 1Y08A 3H7DA 2P86A 1PXVA 3NHEA 3K24A 1MS6A 1W6FA 1U9WA 4I04A 3AI8A 1MHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ2 A;  4WA6 A;  4W5B A;  2FRQ A;  2AVW A;  2AUX A;  2G7Y A;  1ATK A;  1BY8 A;  2PRE A;  1SNK A;  1YK7 A;  6PAD A;  1CTE A;  1U5I A;  2VHS A;  3IOQ A;  3MHS A;  2DCA A;  2NQG A;  1AIM A;  3KFQ A;  2DC7 A;  2AIM A;  2FTD A;  3MHH A;  2FO5 A;  3M99 A;  1STF E;  3QSD A;  3BC3 A;  2GFO A;  1BGO A;  3U8E A;  9PAP A;  1VSN A;  3LXS A;  4YYR A;  1O0E A;  1SP4 B;  2PNS A;  1DEU A;  3P5V A;  2P0R A;  4MZO A;  4N79 A;  3MTN A;  1Q6K A;  3K9M A;  1EWM A;  4MZS A;  3PNR A;  1IWD A;  1ZCM A;  2YJ9 A;  4YYW A;  3RVV A;  4P6E A;  3V6E A;  3KSE A;  3RVW A;  4DMX A;  1Y4H A;  1KHP A;  2OUL A;  2G6D A;  4PAD A;  2E00 A;  1AU2 A;  2B1M A;  3K8U A;  1FH0 A;  4HWY A;  5PAD A;  2DZZ A;  4OEL A;  3KKU A;  1U9Q X;  3D6S A;  3OF9 A;  4ZUX U;  1F29 A;  1EWP A;  4W5C A;  4QH6 A;  3F75 A;  2FUD A;  4YVA A;  2HH5 A;  1U9X A;  3IV2 A;  1PAD A;  2BDZ A;  3HD3 A;  1GCB A;  5FPW A;  1CPJ A;  3CH2 X;  4OEM A;  1DF0 A;  2AYO A;  3GCB A;  4PP2 E;  1PE6 A;  1MEM A;  5F02 A;  2Y6E A;  3O1G A;  1THE A;  2AUZ A;  1VJV A;  3E1Z B;  1GLO A;  4W4U A;  2FQ9 A;  2JQG R;  1QOL A;  1QMY A;  2NQI A;  1KXR A;  3P5U A;  2E01 A;  3I06 A;  4QRG A;  1GMY A;  2G8J A;  2B1N A;  1ZIV A;  3BCN A;  3LFY A;  2H7J A;  4AXM A;  5EGW A;  3PBH A;  3DF0 A;  1KFU L;  1EF7 A;  1K3B B;  4FK5 A;  4KLB A;  4QRV A;  5CHT A;  1S4V A;  1CSB B;  2YJ8 A;  1ME3 A;  2PAD A;  3V6C A;  3RVX A;  2R6N A;  3KWB X;  4X6I A;  2DC8 A;  4X6J A;  3PW3 A;  2C0Y A;  5CVM A;  1CJL A;  2E02 A;  2XU4 A;  2XU1 A;  3ZUA A;  1PCI A;  3I3T A;  4PP1 A;  1F2C A;  5K16 A;  2DJF B;  3ERV A;  4XR7 A;  4N8W A;  4FJC A;  1TL9 A;  4XUI A;  3KWZ A;  1GEC E;  1YT7 A;  4CDC B;  3P5W A;  3O0U A;  4BSQ A;  2DCC A;  4BS6 A;  2P7U A;  2F1G A;  2R9M A;  2YJB A;  5JH3 A;  1EWO A;  4I07 A;  5EF4 A;  2ARY A;  1CQD A;  3IUT A;  1NLJ A;  3HHI A;  2HXZ A;  1BP4 A;  4G54 A;  2DZY A;  3TNX A;  4CDF B;  1AEC A;  3C9E A;  1AYW A;  1ME4 A;  4CDD B;  1CS8 A;  3N3G A;  3KW9 A;  2G8E A;  4PI3 A;  2FT2 A;  1A6R A;  1KHQ A;  3QJ3 A;  2AU1 A;  4X6H A;  3N3K A;  1BQI A;  2VHF A;  5CVN B;  5A24 A;  2Y5B A;  4YYV A;  3QT4 A;  4DMY A;  2WBF X;  1XKG A;  3OF8 A;  1NB3 A;  2FYE A;  3P5X A;  4YYU A;  1F2A A;  4YYS A;  1PBH A;  3F5V A;  1JQP A;  1QXP A;  1U9V A;  1AU4 A;  2IPP B;  3CH3 X;  2OP3 A;  1EWL A;  1YAL A;  3BPM A;  3IHP A;  2R9N A;  1TU6 A;  2NQD B;  1NB5 A;  4N4Z A;  5CHV A;  2XU5 A;  1TLO A;  3B79 A;  2YJC A;  2NQA A;  1KFX L;  2AYN A;  1PIP A;  3H89 A;  2ACT A;  4QRX A;  5J94 A;  3OIS A;  1YK8 A;  3S3Q A;  4AXL A;  1ICF A;  2CIO A;  1F2B A;  4P6G A;  5JA7 A;  2XU3 A;  3HHA A;  2ATO A;  4RY2 A;  3WXE A;  4Q8H A;  2DJG B;  3CBJ A;  1CVZ A;  3PDF A;  1YVB A;  2DC9 A;  3N4C A;  2OZ2 A;  1MDW A;  1AYU A;  1CB5 A;  3CBK A;  1NQC A;  3BWK A;  3MOR A;  3OVX A;  1PPP A;  4MSX A;  3S3R A;  5CVO B;  7PCK A;  1AU0 A;  3HWN A;  2R9O A;  2HHN A;  4YYQ A;  2IBI A;  2HD5 A;  4K7C A;  2R9F A;  1PPN A;  2R9C A;  3KX1 A;  1MEG A;  4I05 A;  2AS8 A;  3BOW A;  3H6S A;  4BS5 A;  2JQF R;  3IEJ A;  2DCD A;  3OVZ A;  1NPZ A;  1PPO A;  1QDQ A;  2F7D A;  4FIP A;  3USV A;  3WXG A;  3WXF A;  3H8C A;  4QBB A;  1ITO A;  1PPD A;  2GHU A;  2DCB A;  2BDL A;  4BPV A;  4CZW A;  1MIR A;  3IMA A;  1CV8 A;  1HUC B;  4Q8G A;  1X9Y A;  2PBH A;  3BPF A;  2DC6 A;  4YV8 A;  2E03 A;  3H8B A;  4BQV A;  8PCH A;  1POP A;  2O6X A;  2CB5 A;  1AYV A;  1NL6 A;  1M6D A;  4CDE B;  1AU3 A;  2FRA A;  1Y08 A;  3H7D A;  2P86 A;  1PXV A;  3NHE A;  3K24 A;  1MS6 A;  1U9W A;  4I04 A;  3AI8 A;  1MHW A; 
#chains in the Genus database with same CATH topology
 2YJ2 A;  4WA6 A;  4W5B A;  2FRQ A;  3PSE A;  2AVW A;  2AUX A;  2G7Y A;  1ATK A;  1BY8 A;  2PRE A;  1SNK A;  1YK7 A;  4PT5 A;  6PAD A;  1CTE A;  1U5I A;  2VHS A;  3IOQ A;  4BOQ A;  4OW0 A;  3MHS A;  2DCA A;  2NQG A;  1AIM A;  3KFQ A;  2DC7 A;  5E6J A;  2AIM A;  1PVJ A;  2FTD A;  3MHH A;  2FO5 A;  3M99 A;  1STF E;  3QSD A;  3BC3 A;  2GFO A;  1BGO A;  3U8E A;  9PAP A;  1VSN A;  3LXS A;  4YYR A;  1O0E A;  1SP4 B;  2PNS A;  1DEU A;  3P5V A;  2P0R A;  4MZO A;  4N79 A;  3MTN A;  1Q6K A;  3K9M A;  3O65 A;  1EWM A;  4MZS A;  3PNR A;  5JZE A;  1IWD A;  1ZCM A;  2YJ9 A;  4YYW A;  2JTC A;  3RVV A;  4P6E A;  4MM3 B;  3V6E A;  3KSE A;  3BB7 A;  3RVW A;  3PHX A;  4DMX A;  1Y4H A;  1KHP A;  2OUL A;  2JRI A;  2G6D A;  4PAD A;  3RNV A;  2E00 A;  1AU2 A;  2B1M A;  3K8U A;  1FH0 A;  4HWY A;  5PAD A;  2DZZ A;  4OEL A;  3KKU A;  1U9Q X;  3D6S A;  3OF9 A;  4ZUX U;  1F29 A;  1EWP A;  4W5C A;  4QH6 A;  3F75 A;  2FUD A;  4RF0 A;  2BTW B;  4YVA A;  2HH5 A;  1U9X A;  3IV2 A;  1PAD A;  2BDZ A;  3HD3 A;  1GCB A;  5FPW A;  4D8B A;  1CPJ A;  3CH2 X;  4OEM A;  1DF0 A;  2AYO A;  3GCB A;  4PP2 E;  1PE6 A;  1MEM A;  5F02 A;  3TMP A;  3BBA A;  2Y6E A;  3O1G A;  1THE A;  2AUZ A;  1VJV A;  3E1Z B;  1GLO A;  3MTV A;  4W4U A;  2FQ9 A;  2JQG R;  1QOL A;  1QMY A;  2NQI A;  1KXR A;  3P5U A;  2E01 A;  3I06 A;  4QRG A;  1GMY A;  2G8J A;  2B1N A;  1ZIV A;  3BCN A;  3PHW A;  3LFY A;  2H7J A;  4AXM A;  5EGW A;  4P16 A;  3PBH A;  3DF0 A;  1KFU L;  1EF7 A;  1K3B B;  4FK5 A;  4KLB A;  4QRV A;  5CHT A;  1S4V A;  1CSB B;  2YJ8 A;  1ME3 A;  2PAD A;  3V6C A;  3RVX A;  2R6N A;  3KWB X;  4X6I A;  2DC8 A;  4X6J A;  3PW3 A;  2C0Y A;  5CVM A;  4IUM A;  1CJL A;  2E02 A;  2XU4 A;  1YZB A;  2XU1 A;  3ZUA A;  1PCI A;  4HXD B;  3I3T A;  4PP1 A;  1F2C A;  5K16 A;  2DJF B;  3ERV A;  4XR7 A;  4D8I A;  4N8W A;  4ZTB A;  4FJC A;  1TL9 A;  4OVZ A;  4XUI A;  3KWZ A;  1GEC E;  1YT7 A;  4CDC B;  3P5W A;  3O0U A;  4MI7 A;  4BSQ A;  2DCC A;  4BS6 A;  2P7U A;  2F1G A;  2R9M A;  2YJB A;  5JH3 A;  1EWO A;  4I07 A;  5EF4 A;  2ARY A;  1CQD A;  2Z84 A;  3BY4 A;  3IUT A;  1NLJ A;  3HHI A;  2HXZ A;  1BP4 A;  4G54 A;  2DZY A;  3TNX A;  4CDF B;  1AEC A;  3C9E A;  1AYW A;  1ME4 A;  4CDD B;  4WUR A;  1CS8 A;  2UZJ A;  3N3G A;  2BU3 A;  3KW9 A;  2G8E A;  3PRM A;  4PI3 A;  2FT2 A;  1A6R A;  3C0R A;  4XZX A;  1KHQ A;  3QJ3 A;  4BOS A;  2AU1 A;  4X6H A;  3N3K A;  1BQI A;  2VHF A;  5CVN B;  4A5U A;  5A24 A;  2Y5B A;  3W30 A;  3IFU A;  4YYV A;  3QT4 A;  4DMY A;  2WBF X;  1XKG A;  3OF8 A;  1NB3 A;  4RNA A;  2FYE A;  3P5X A;  4YYU A;  1F2A A;  3W31 A;  4YYS A;  1PBH A;  3F5V A;  1JQP A;  1QXP A;  1U9V A;  1AU4 A;  2IPP B;  3CH3 X;  2OP3 A;  1EWL A;  1YAL A;  3BPM A;  3IHP A;  2R9N A;  1TU6 A;  5EZS A;  2NQD B;  1NB5 A;  4N4Z A;  5CHV A;  2XU5 A;  1TLO A;  3OQC A;  5KO3 A;  3B21 A;  3B79 A;  2YJC A;  2NQA A;  1KFX L;  2AYN A;  1PIP A;  3H89 A;  2ACT A;  4QRX A;  4IP3 A;  5J94 A;  3OIS A;  1YK8 A;  3PRP A;  3S3Q A;  2DOS A;  4AXL A;  1ICF A;  2BTW A;  4RKX A;  2CIO A;  1F2B A;  4P6G A;  5JA7 A;  2XU3 A;  3HHA A;  4M0W A;  2ATO A;  2J7Q A;  4RY2 A;  3WXE A;  4Q8H A;  2DJG B;  3CBJ A;  3ZNH A;  1CVZ A;  3PT2 A;  2FE8 A;  2AGA A;  3PDF A;  3N4C A;  1YVB A;  2DC9 A;  2J7Q C;  2OZ2 A;  4D8E A;  1MDW A;  3MP2 A;  1AYU A;  1CB5 A;  3CBK A;  1NQC A;  3BWK A;  3MOR A;  3OVX A;  1PPP A;  4MSX A;  3S3R A;  5CVO B;  7PCK A;  4BOZ A;  1AU0 A;  3HWN A;  2R9O A;  2HHN A;  4YYQ A;  5EZQ A;  2IBI A;  2HD5 A;  4K7C A;  2R9F A;  1PPN A;  2R9C A;  3KX1 A;  1MEG A;  4I05 A;  2AS8 A;  3BOW A;  3H6S A;  4BS5 A;  2JQF R;  3IEJ A;  4RF1 A;  2DCD A;  3OVZ A;  1NPZ A;  4BOU A;  1PPO A;  1QDQ A;  2F7D A;  4FIP A;  3USV A;  3WXG A;  3WXF A;  3H8C A;  4QBB A;  1ITO A;  1PPD A;  2GHU A;  2DCB A;  2HWK A;  3E9S A;  2BDL A;  4BPV A;  4CZW A;  1MIR A;  3IMA A;  1CV8 A;  1HUC B;  4Q8G A;  1X9Y A;  3PHU A;  1UKF A;  1DKI A;  2PBH A;  3BPF A;  4GUA A;  3MJ5 A;  2DC6 A;  4YV8 A;  2E03 A;  4R3D A;  3H8B A;  4BQV A;  8PCH A;  4OVZ B;  1POP A;  2O6X A;  2CB5 A;  1AYV A;  4REZ A;  1NL6 A;  1M6D A;  4BOP A;  4CDE B;  1AU3 A;  2FRA A;  1Y08 A;  3H7D A;  2P86 A;  1PXV A;  3NHE A;  3TRK A;  3K24 A;  1MS6 A;  1U9W A;  4I04 A;  3AI8 A;  1MHW A; 
#chains in the Genus database with same CATH homology
 2YJ2 A;  4WA6 A;  4W5B A;  2FRQ A;  2AVW A;  2AUX A;  2G7Y A;  1ATK A;  1BY8 A;  2PRE A;  1GX3 A;  1SNK A;  1YK7 A;  6PAD A;  1CTE A;  1U5I A;  2VHS A;  3IOQ A;  3MHS A;  2DCA A;  2NQG A;  1AIM A;  3KFQ A;  2DC7 A;  2AIM A;  2FTD A;  3MHH A;  2FO5 A;  3M99 A;  1STF E;  3QSD A;  3BC3 A;  2GFO A;  1BGO A;  3U8E A;  9PAP A;  1VSN A;  3LXS A;  4YYR A;  1O0E A;  1SP4 B;  2PNS A;  1DEU A;  3P5V A;  2P0R A;  4MZO A;  4N79 A;  3MTN A;  1Q6K A;  3K9M A;  1EWM A;  4MZS A;  3PNR A;  1IWD A;  1ZCM A;  2YJ9 A;  4YYW A;  3RVV A;  4P6E A;  3V6E A;  3KSE A;  3RVW A;  4DMX A;  1Y4H A;  1KHP A;  2OUL A;  2G6D A;  4PAD A;  2E00 A;  1W4T A;  1AU2 A;  2B1M A;  3K8U A;  1FH0 A;  4HWY A;  5PAD A;  2DZZ A;  4OEL A;  3KKU A;  3D9W A;  1U9Q X;  3D6S A;  3OF9 A;  4ZUX U;  1F29 A;  1EWP A;  4W5C A;  4QH6 A;  3F75 A;  2FUD A;  4YVA A;  2HH5 A;  1U9X A;  3IV2 A;  1PAD A;  2BDZ A;  3HD3 A;  1GCB A;  5FPW A;  1CPJ A;  3CH2 X;  4OEM A;  1DF0 A;  2AYO A;  3GCB A;  4PP2 E;  1PE6 A;  1MEM A;  5F02 A;  2Y6E A;  3O1G A;  1THE A;  2AUZ A;  1VJV A;  3E1Z B;  1GLO A;  4W4U A;  2FQ9 A;  2JQG R;  1QOL A;  1QMY A;  2NQI A;  1KXR A;  3P5U A;  2E01 A;  3I06 A;  4QRG A;  1GMY A;  2G8J A;  2B1N A;  1ZIV A;  3BCN A;  3LFY A;  2H7J A;  4AXM A;  5EGW A;  3PBH A;  3DF0 A;  1KFU L;  1EF7 A;  1K3B B;  4FK5 A;  4KLB A;  4QRV A;  5CHT A;  1S4V A;  1CSB B;  2YJ8 A;  1ME3 A;  2PAD A;  3V6C A;  3RVX A;  2R6N A;  3KWB X;  4X6I A;  2DC8 A;  4X6J A;  3PW3 A;  2C0Y A;  5CVM A;  1CJL A;  2E02 A;  2XU4 A;  2XU1 A;  3ZUA A;  1PCI A;  3I3T A;  3LTW A;  4PP1 A;  1F2C A;  5K16 A;  2DJF B;  3ERV A;  4XR7 A;  4N8W A;  4FJC A;  1TL9 A;  4XUI A;  3KWZ A;  1GEC E;  1YT7 A;  4CDC B;  3P5W A;  3O0U A;  4BSQ A;  2DCC A;  4BS6 A;  2P7U A;  2F1G A;  2R9M A;  2YJB A;  5JH3 A;  1EWO A;  4I07 A;  5EF4 A;  2ARY A;  2VFC A;  1CQD A;  3IUT A;  1NLJ A;  3HHI A;  2HXZ A;  1W5R A;  1BP4 A;  4G54 A;  2DZY A;  3TNX A;  4CDF B;  1AEC A;  3C9E A;  1AYW A;  1ME4 A;  4CDD B;  1CS8 A;  3N3G A;  3KW9 A;  2G8E A;  4PI3 A;  2FT2 A;  2VFB A;  1A6R A;  4GUZ A;  1KHQ A;  3QJ3 A;  2AU1 A;  4X6H A;  3N3K A;  1BQI A;  2VHF A;  5CVN B;  5A24 A;  2Y5B A;  4YYV A;  3QT4 A;  4DMY A;  2WBF X;  1XKG A;  3OF8 A;  1NB3 A;  2FYE A;  3P5X A;  4YYU A;  1F2A A;  4YYS A;  4B55 A;  1PBH A;  3F5V A;  1JQP A;  1QXP A;  1U9V A;  1AU4 A;  2IPP B;  3CH3 X;  2OP3 A;  1EWL A;  1YAL A;  3BPM A;  3IHP A;  2R9N A;  1TU6 A;  2NQD B;  1NB5 A;  4N4Z A;  5CHV A;  2XU5 A;  1TLO A;  4NV7 A;  3B79 A;  2YJC A;  1E2T A;  1KFX L;  2NQA A;  2AYN A;  1PIP A;  3H89 A;  2ACT A;  4QRX A;  5J94 A;  3OIS A;  1YK8 A;  4NV8 A;  3S3Q A;  4AXL A;  1ICF A;  2CIO A;  1F2B A;  4P6G A;  5JA7 A;  2XU3 A;  3HHA A;  2ATO A;  4RY2 A;  3WXE A;  4Q8H A;  2DJG B;  3CBJ A;  1CVZ A;  3PDF A;  3N4C A;  1YVB A;  2DC9 A;  2OZ2 A;  1MDW A;  1AYU A;  1CB5 A;  3CBK A;  1NQC A;  3BWK A;  3MOR A;  3OVX A;  1PPP A;  4MSX A;  3S3R A;  5CVO B;  7PCK A;  1AU0 A;  3HWN A;  2R9O A;  2HHN A;  4YYQ A;  2IBI A;  2HD5 A;  4K7C A;  2R9F A;  1PPN A;  2R9C A;  3KX1 A;  1MEG A;  4I05 A;  4C5P A;  2AS8 A;  3BOW A;  3H6S A;  4BS5 A;  2JQF R;  3IEJ A;  2DCD A;  3OVZ A;  1NPZ A;  1PPO A;  1QDQ A;  2F7D A;  4FIP A;  3USV A;  3WXG A;  3WXF A;  3H8C A;  4QBB A;  1ITO A;  1PPD A;  2GHU A;  2DCB A;  2BDL A;  4BGF A;  4BPV A;  4CZW A;  1MIR A;  3IMA A;  1CV8 A;  1HUC B;  4Q8G A;  1X9Y A;  2PBH A;  3BPF A;  2DC6 A;  4YV8 A;  2E03 A;  3H8B A;  4BQV A;  8PCH A;  1POP A;  2O6X A;  2CB5 A;  1AYV A;  2BSZ A;  1NL6 A;  1M6D A;  4CDE B;  1AU3 A;  2FRA A;  1Y08 A;  3H7D A;  2P86 A;  1PXV A;  3NHE A;  3K24 A;  1MS6 A;  1W6F A;  1U9W A;  4I04 A;  3AI8 A;  1MHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...