4KLBA

Crystal structure of cruzain in complex with the non-covalent inhibitor nequimed176
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Non-peptidic Cruzain Inhibitors with Trypanocidal Activity Discovered by Virtual Screening and In Vitro Assay.
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cruzipain
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C, D, E
ec nomenclature ec 3.4.22.51: Cruzipain.
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4klbA00
2E00A 4QRXA 1DEUA 3F75A 1Y08A 3I3TA 2FQ9A 1EWPA 1TU6A 5CHTA 3QT4A 2DZZA 1MDWA 4PP2E 3LXSA 3OISA 1AU3A 4PADA 1F2AA 1PPDA 2XU4A 3P5VA 5CHVA 4QRGA 1HUCB 1MHWA 3NHEA 2DCBA 3I06A 1PPPA 2AU1A 2FO5A 2P86A 3LFYA 5PADA 4Q8GA 1NPZA 3U8EA 1FH0A 3M99A 1PADA 4G54A 3O1GA 3QJ3A 3RVWA 4HWYA 4DMXA 1MIRA 3N3GA 1K3BB 2R9MA 4X6IA 2F7DA 2DC6A 3IEJA 2FRAA 1MS6A 3BWKA 1A6RA 3P5XA 3KWZA 4Q8HA 1AYWA 4X6JA 2IBIA 5CVMA 1U9WA 1U5IA 2P7UA 4CDCB 2PADA 3B79A 1GMYA 2R9FA 3F5VA 1GECE 4AXMA 1PE6A 3HWNA 3MHSA 1EWOA 8PCHA 2NQDB 1BGOA 1NL6A 1U9QX 3OF9A 4YVAA 1POPA 4N79A 3KW9A 3PNRA 2R6NA 4X6HA 7PCKA 6PADA 1ME3A 2YJBA 1PPNA 4PI3A 2C0YA 4CZWA 3V6CA 1IWDA 1S4VA 4MZSA 2G6DA 3KSEA 4DMYA 2GHUA 2E01A 5EF4A 2R9OA 2PNSA 2YJ2A 4YYVA 2PBHA 2AIMA 1AIMA 3USVA 4K7CA 1ATKA 2G7YA 2G8JA 2OP3A 4QBBA 3HHIA 2ACTA 2WBFX 1KFUL 1KFXL 2AVWA 3BPMA 2VHSA 1X9YA 2JQFR 1PBHA 1AU4A 3V6EA 1PCIA 4CDEB 3ERVA 2CB5A 2AS8A 2B1MA 1NLJA 1U9XA 2Y5BA 1F29A 1VSNA 3N3KA 3CBKA 2YJ8A 1PXVA 3PDFA 1GCBA 1EWLA 1JQPA 3CBJA 1O0EA 1STFE 2DC9A 1ICFA 2DZYA 2VHFA 2DJFB 4P6GA 2XU3A 1SP4B 1PPOA 3CH2X 4CDDB 1XKGA 1QMYA 1ME4A 2FYEA 3BPFA 1CB5A 4QRVA 3IMAA 3OVXA 4FIPA 1KHPA 4FJCA 1PIPA 1VJVA 3WXGA 3IV2A 4I04A 2JQGR 4W4UA 3H7DA 5J94A 3D6SA 1YALA 3K9MA 1CV8A 4W5CA 5CVNB 2DCDA 2G8EA 3PW3A 1YK7A 3WXEA 2AUZA 4YYUA 1KXRA 1Q6KA 3IHPA 4N8WA 4AXLA 5EGWA 5F02A 5JA7A 1YT7A 2OZ2A 3HD3A 5FPWA 2BDLA 4I05A 3MORA 1BY8A 4OEMA 3RVXA 1MEGA 2GFOA 1QXPA 1CQDA 1U9VA 4FK5A 1YVBA 2FUDA 3IOQA 2R9CA 2AYOA 3O0UA 3AI8A 3KFQA 3H8BA 4I07A 2F1GA 2AYNA 1QOLA 3RVVA 1F2BA 2AUXA 1Y4HA 4BPVA 1AYUA 1EWMA 2CIOA 3N4CA 2FT2A 2FTDA 1NQCA 1AU0A 2E02A 3CH3X 1TL9A 3WXFA 3BCNA 5A24A 2E03A 4MSXA 3BC3A 3KWBX 4BS5A 1M6DA 1QDQA 4YYSA 2NQAA 3S3QA 3K8UA 2BDZA 3PBHA 2ATOA 4YYRA 4P6EA 3OVZA 2HHNA 3P5WA 2DC7A 3HHAA 2OULA 1YK8A 2HH5A 3H89A 3KKUA 1TLOA 2P0RA 4BQVA 3BOWA 1SNKA 2HD5A 4OELA 3KX1A 2DCAA 2YJ9A 4XUIA 1GLOA 1EF7A 1AECA 3C9EA 4XR7A 2DC8A 9PAPA 1KHQA 3P5UA 1NB3A 3OF8A 4YV8A 1CSBB 2ARYA 5JH3A 1AU2A 4YYQA 1NB5A 3MHHA 4RY2A 4BSQA 2XU1A 4YYWA 2IPPB 3H8CA 2HXZA 2Y6EA 4ZUXU 4BS6A 1CTEA 2YJCA 2H7JA 4QH6A 2B1NA 4PP1A 1F2CA 3GCBA 4MZOA 1CS8A 2R9NA 1ITOA 3ZUAA 2PREA 1ZCMA 2NQGA 4N4ZA 3E1ZB 3K24A 1ZIVA 2O6XA 5K16A 3TNXA 2XU5A 3DF0A 2DCCA 1THEA 4W5BA 2FRQA 4WA6A 4KLBA 2DJGB 1CPJA 1BQIA 3S3RA 1BP4A 1MEMA 1CJLA 1CVZA 4CDFB 1AYVA 5CVOB 2NQIA 3MTNA 1DF0A 3QSDA 3H6SA 3IUTA
chains in the Genus database with same CATH superfamily
2E00A 4A5UA 4QRXA 1DEUA 3F75A 1Y08A 3I3TA 2FQ9A 1EWPA 1TU6A 2BTWB 5CHTA 3ZNHA 4BOPA 1PVJA 3MJ5A 3QT4A 2DZZA 3MP2A 1MDWA 5EZQA 4PP2E 3LXSA 3OISA 1AU3A 4PADA 1F2AA 1PPDA 2XU4A 3P5VA 5CHVA 4QRGA 1HUCB 1MHWA 3NHEA 2DCBA 4MI7A 2J7QC 3I06A 1PPPA 2AU1A 2FO5A 2P86A 3LFYA 5PADA 4Q8GA 2BTWA 4D8IA 1NPZA 3U8EA 1FH0A 3M99A 1PADA 4G54A 4ZTBA 3O1GA 3QJ3A 3RVWA 4RF1A 4HWYA 4DMXA 1MIRA 3N3GA 1K3BB 2R9MA 4X6IA 2F7DA 2DC6A 3IEJA 2FRAA 1MS6A 3BWKA 1A6RA 3P5XA 3KWZA 4Q8HA 1AYWA 4X6JA 2IBIA 5CVMA 1U9WA 1U5IA 2P7UA 3IFUA 4RKXA 4CDCB 2PADA 4RF0A 3B79A 1GMYA 2R9FA 3F5VA 1GECE 3MTVA 4AXMA 1PE6A 3HWNA 3MHSA 4OVZA 2JRIA 1EWOA 8PCHA 2NQDB 2FE8A 4P16A 2UZJA 1BGOA 1NL6A 1U9QX 3OF9A 4YVAA 1POPA 4N79A 3KW9A 3PNRA 2R6NA 4X6HA 7PCKA 6PADA 4HXDB 1ME3A 2YJBA 1PPNA 4PI3A 2C0YA 4CZWA 3V6CA 1IWDA 1S4VA 4MZSA 2G6DA 3KSEA 4DMYA 2GHUA 5KO3A 2E01A 5EF4A 2R9OA 2PNSA 2YJ2A 4YYVA 2PBHA 2AIMA 1AIMA 3USVA 4K7CA 1ATKA 2HWKA 2G7YA 2G8JA 2OP3A 4QBBA 4IUMA 3HHIA 2ACTA 2WBFX 1KFUL 1KFXL 2AVWA 3BPMA 2VHSA 1X9YA 2JQFR 4R3DA 1PBHA 1AU4A 3V6EA 1PCIA 2DOSA 4CDEB 4BOUA 3ERVA 2CB5A 2AS8A 2B1MA 2JTCA 1NLJA 1U9XA 2Y5BA 1F29A 4D8BA 1VSNA 1DKIA 3N3KA 3CBKA 3PHWA 1PXVA 3PDFA 2YJ8A 1GCBA 2BU3A 1EWLA 1JQPA 3CBJA 1O0EA 1STFE 2DC9A 4IP3A 1ICFA 2DZYA 2VHFA 2DJFB 4P6GA 2XU3A 1SP4B 1PPOA 3CH2X 4CDDB 1XKGA 4OVZB 1QMYA 1ME4A 2FYEA 3BPFA 1CB5A 4QRVA 4WURA 4FIPA 3IMAA 3OVXA 1KHPA 4FJCA 4BOZA 1PIPA 1VJVA 3WXGA 3IV2A 4I04A 2JQGR 4W4UA 3BB7A 3TMPA 3H7DA 5J94A 3D6SA 1YALA 3K9MA 1CV8A 3W30A 3E9SA 4W5CA 5CVNB 2DCDA 1UKFA 2G8EA 3PW3A 1YK7A 3WXEA 2AUZA 4YYUA 1KXRA 4REZA 1Q6KA 4OW0A 3IHPA 4N8WA 4XZXA 5JZEA 4AXLA 2J7QA 5EGWA 5F02A 5JA7A 4D8EA 1YT7A 2OZ2A 3HD3A 4MM3B 2BDLA 5FPWA 4I05A 3MORA 1BY8A 4OEMA 3RVXA 1MEGA 3PRPA 2GFOA 1QXPA 3PHXA 1CQDA 1U9VA 4FK5A 1YVBA 4PT5A 2FUDA 3IOQA 3RNVA 2R9CA 2AYOA 3O0UA 3AI8A 3KFQA 3H8BA 4I07A 3C0RA 4RNAA 2F1GA 2AYNA 1QOLA 3RVVA 1F2BA 2AUXA 1Y4HA 4BPVA 1AYUA 1EWMA 2CIOA 3N4CA 2FT2A 3OQCA 3PSEA 2FTDA 1NQCA 1AU0A 2E02A 3CH3X 1TL9A 3WXFA 3BCNA 3TRKA 5A24A 2E03A 4MSXA 3BC3A 3KWBX 4BS5A 1M6DA 1QDQA 4YYSA 2NQAA 3S3QA 1YZBA 3K8UA 2BDZA 3PBHA 2ATOA 4YYRA 4P6EA 2AGAA 3OVZA 2HHNA 4BOQA 3P5WA 2DC7A 3HHAA 2OULA 1YK8A 2HH5A 3H89A 3KKUA 1TLOA 2P0RA 4BQVA 3BOWA 1SNKA 2HD5A 4OELA 3KX1A 2DCAA 2YJ9A 4BOSA 4XUIA 1GLOA 1EF7A 1AECA 3C9EA 4XR7A 2DC8A 5E6JA 9PAPA 1KHQA 3P5UA 1NB3A 3PRMA 3OF8A 4YV8A 1CSBB 2ARYA 2Z84A 5JH3A 1AU2A 4YYQA 1NB5A 3MHHA 4RY2A 4BSQA 2XU1A 4YYWA 2IPPB 3B21A 4M0WA 3H8CA 2HXZA 2Y6EA 4ZUXU 4BS6A 1CTEA 2YJCA 2H7JA 4QH6A 2B1NA 4PP1A 3PT2A 1F2CA 5EZSA 3GCBA 4MZOA 1CS8A 2R9NA 1ITOA 3ZUAA 2PREA 1ZCMA 2NQGA 3BBAA 4N4ZA 3E1ZB 3K24A 1ZIVA 4GUAA 2O6XA 5K16A 3TNXA 2XU5A 3DF0A 2DCCA 1THEA 3W31A 4W5BA 2FRQA 3O65A 4KLBA 4WA6A 2DJGB 1CPJA 1BQIA 3PHUA 3S3RA 1BP4A 1MEMA 1CJLA 1CVZA 3BY4A 4CDFB 1AYVA 5CVOB 2NQIA 3MTNA 1DF0A 3QSDA 3H6SA 3IUTA
chains in the Genus database with same CATH topology
2E00A 4QRXA 1DEUA 3F75A 1Y08A 3I3TA 2FQ9A 1EWPA 1TU6A 5CHTA 3QT4A 2DZZA 1MDWA 3LTWA 4PP2E 3LXSA 4BGFA 3OISA 1AU3A 4PADA 1F2AA 1PPDA 2XU4A 3P5VA 4NV8A 5CHVA 4QRGA 1HUCB 1MHWA 3NHEA 2DCBA 3I06A 1PPPA 2AU1A 2FO5A 2P86A 3LFYA 5PADA 4Q8GA 1NPZA 3U8EA 1FH0A 3M99A 1PADA 4G54A 3O1GA 3QJ3A 3RVWA 4HWYA 4DMXA 1MIRA 3N3GA 1K3BB 2R9MA 4X6IA 2F7DA 2DC6A 3IEJA 2FRAA 1W6FA 1MS6A 3BWKA 1A6RA 3P5XA 3KWZA 4Q8HA 1AYWA 4X6JA 2IBIA 5CVMA 1U9WA 1U5IA 2P7UA 4CDCB 2PADA 3B79A 1GMYA 2R9FA 3F5VA 1GECE 4AXMA 4NV7A 1PE6A 3HWNA 3MHSA 1EWOA 8PCHA 2NQDB 1BGOA 1NL6A 1U9QX 3OF9A 4YVAA 1POPA 3D9WA 4N79A 3KW9A 3PNRA 2R6NA 4X6HA 7PCKA 6PADA 1ME3A 2YJBA 1PPNA 4PI3A 2C0YA 4CZWA 3V6CA 1IWDA 1S4VA 4MZSA 2G6DA 3KSEA 4DMYA 2GHUA 2E01A 5EF4A 2R9OA 2PNSA 2YJ2A 4YYVA 2PBHA 2AIMA 1AIMA 3USVA 4K7CA 1ATKA 2G7YA 2G8JA 2OP3A 4QBBA 3HHIA 2ACTA 2WBFX 1KFUL 1KFXL 2AVWA 3BPMA 2VHSA 1X9YA 2JQFR 1PBHA 1AU4A 3V6EA 1PCIA 4CDEB 3ERVA 2CB5A 2AS8A 2B1MA 1NLJA 1U9XA 2Y5BA 1F29A 4C5PA 1VSNA 3N3KA 3CBKA 2YJ8A 1PXVA 3PDFA 1GCBA 1EWLA 1JQPA 3CBJA 1O0EA 1STFE 2DC9A 1ICFA 2DZYA 2VHFA 2DJFB 4P6GA 2VFBA 2XU3A 1SP4B 1PPOA 3CH2X 4CDDB 1XKGA 1QMYA 1ME4A 2FYEA 3BPFA 1CB5A 4QRVA 3IMAA 3OVXA 4FIPA 1KHPA 4FJCA 1PIPA 1W4TA 1VJVA 3WXGA 3IV2A 4I04A 2JQGR 4W4UA 3H7DA 5J94A 3D6SA 1YALA 3K9MA 1CV8A 4W5CA 5CVNB 2DCDA 2G8EA 3PW3A 1YK7A 2BSZA 3WXEA 2AUZA 4YYUA 1KXRA 1Q6KA 3IHPA 4N8WA 4AXLA 5EGWA 5F02A 5JA7A 1YT7A 2OZ2A 3HD3A 5FPWA 2BDLA 4I05A 3MORA 1BY8A 4OEMA 2VFCA 3RVXA 1MEGA 1GX3A 2GFOA 1QXPA 1CQDA 1U9VA 4FK5A 1YVBA 2FUDA 3IOQA 2R9CA 2AYOA 3O0UA 3AI8A 3KFQA 3H8BA 4I07A 2F1GA 2AYNA 1QOLA 3RVVA 1F2BA 2AUXA 1Y4HA 4BPVA 1AYUA 1EWMA 2CIOA 3N4CA 2FT2A 2FTDA 1NQCA 1AU0A 2E02A 3CH3X 1TL9A 3WXFA 3BCNA 5A24A 2E03A 4MSXA 3BC3A 3KWBX 4BS5A 1M6DA 1QDQA 4YYSA 2NQAA 3S3QA 3K8UA 2BDZA 3PBHA 2ATOA 4YYRA 4P6EA 3OVZA 2HHNA 3P5WA 2DC7A 3HHAA 2OULA 1YK8A 2HH5A 3H89A 3KKUA 1TLOA 2P0RA 4BQVA 3BOWA 1SNKA 4B55A 4GUZA 2HD5A 4OELA 1W5RA 3KX1A 2DCAA 2YJ9A 4XUIA 1GLOA 1EF7A 1AECA 3C9EA 4XR7A 2DC8A 9PAPA 1KHQA 3P5UA 1NB3A 3OF8A 4YV8A 1CSBB 2ARYA 5JH3A 1AU2A 4YYQA 1NB5A 3MHHA 4RY2A 4BSQA 2XU1A 4YYWA 2IPPB 3H8CA 2HXZA 2Y6EA 4ZUXU 4BS6A 1CTEA 2YJCA 2H7JA 4QH6A 2B1NA 4PP1A 1F2CA 3GCBA 4MZOA 1CS8A 2R9NA 1ITOA 3ZUAA 2PREA 1ZCMA 2NQGA 4N4ZA 3E1ZB 3K24A 1ZIVA 1E2TA 2O6XA 5K16A 3TNXA 2XU5A 3DF0A 2DCCA 1THEA 4W5BA 2FRQA 4WA6A 4KLBA 2DJGB 1CPJA 1BQIA 3S3RA 1BP4A 1MEMA 1CJLA 1CVZA 4CDFB 1AYVA 5CVOB 2NQIA 3MTNA 1DF0A 3QSDA 3H6SA 3IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E00 A;  4QRX A;  1DEU A;  3F75 A;  1Y08 A;  3I3T A;  2FQ9 A;  1EWP A;  1TU6 A;  5CHT A;  3QT4 A;  2DZZ A;  1MDW A;  4PP2 E;  3LXS A;  3OIS A;  1AU3 A;  4PAD A;  1F2A A;  1PPD A;  2XU4 A;  3P5V A;  5CHV A;  4QRG A;  1HUC B;  1MHW A;  3NHE A;  2DCB A;  3I06 A;  1PPP A;  2AU1 A;  2FO5 A;  2P86 A;  3LFY A;  5PAD A;  4Q8G A;  1NPZ A;  3U8E A;  1FH0 A;  3M99 A;  1PAD A;  4G54 A;  3O1G A;  3QJ3 A;  3RVW A;  4HWY A;  4DMX A;  1MIR A;  3N3G A;  1K3B B;  2R9M A;  4X6I A;  2F7D A;  2DC6 A;  3IEJ A;  2FRA A;  1MS6 A;  3BWK A;  1A6R A;  3P5X A;  3KWZ A;  4Q8H A;  1AYW A;  4X6J A;  2IBI A;  5CVM A;  1U9W A;  1U5I A;  2P7U A;  4CDC B;  2PAD A;  3B79 A;  1GMY A;  2R9F A;  3F5V A;  1GEC E;  4AXM A;  1PE6 A;  3HWN A;  3MHS A;  1EWO A;  8PCH A;  2NQD B;  1BGO A;  1NL6 A;  1U9Q X;  3OF9 A;  4YVA A;  1POP A;  4N79 A;  3KW9 A;  3PNR A;  2R6N A;  4X6H A;  7PCK A;  6PAD A;  1ME3 A;  2YJB A;  1PPN A;  4PI3 A;  2C0Y A;  4CZW A;  3V6C A;  1IWD A;  1S4V A;  4MZS A;  2G6D A;  3KSE A;  4DMY A;  2GHU A;  2E01 A;  5EF4 A;  2R9O A;  2PNS A;  2YJ2 A;  4YYV A;  2PBH A;  2AIM A;  1AIM A;  3USV A;  4K7C A;  1ATK A;  2G7Y A;  2G8J A;  2OP3 A;  4QBB A;  3HHI A;  2ACT A;  2WBF X;  1KFU L;  1KFX L;  2AVW A;  3BPM A;  2VHS A;  1X9Y A;  2JQF R;  1PBH A;  1AU4 A;  3V6E A;  1PCI A;  4CDE B;  3ERV A;  2CB5 A;  2AS8 A;  2B1M A;  1NLJ A;  1U9X A;  2Y5B A;  1F29 A;  1VSN A;  3N3K A;  3CBK A;  2YJ8 A;  1PXV A;  3PDF A;  1GCB A;  1EWL A;  1JQP A;  3CBJ A;  1O0E A;  1STF E;  2DC9 A;  1ICF A;  2DZY A;  2VHF A;  2DJF B;  4P6G A;  2XU3 A;  1SP4 B;  1PPO A;  3CH2 X;  4CDD B;  1XKG A;  1QMY A;  1ME4 A;  2FYE A;  3BPF A;  1CB5 A;  4QRV A;  3IMA A;  3OVX A;  4FIP A;  1KHP A;  4FJC A;  1PIP A;  1VJV A;  3WXG A;  3IV2 A;  4I04 A;  2JQG R;  4W4U A;  3H7D A;  5J94 A;  3D6S A;  1YAL A;  3K9M A;  1CV8 A;  4W5C A;  5CVN B;  2DCD A;  2G8E A;  3PW3 A;  1YK7 A;  3WXE A;  2AUZ A;  4YYU A;  1KXR A;  1Q6K A;  3IHP A;  4N8W A;  4AXL A;  5EGW A;  5F02 A;  5JA7 A;  1YT7 A;  2OZ2 A;  3HD3 A;  5FPW A;  2BDL A;  4I05 A;  3MOR A;  1BY8 A;  4OEM A;  3RVX A;  1MEG A;  2GFO A;  1QXP A;  1CQD A;  1U9V A;  4FK5 A;  1YVB A;  2FUD A;  3IOQ A;  2R9C A;  2AYO A;  3O0U A;  3AI8 A;  3KFQ A;  3H8B A;  4I07 A;  2F1G A;  2AYN A;  1QOL A;  3RVV A;  1F2B A;  2AUX A;  1Y4H A;  4BPV A;  1AYU A;  1EWM A;  2CIO A;  3N4C A;  2FT2 A;  2FTD A;  1NQC A;  1AU0 A;  2E02 A;  3CH3 X;  1TL9 A;  3WXF A;  3BCN A;  5A24 A;  2E03 A;  4MSX A;  3BC3 A;  3KWB X;  4BS5 A;  1M6D A;  1QDQ A;  4YYS A;  2NQA A;  3S3Q A;  3K8U A;  2BDZ A;  3PBH A;  2ATO A;  4YYR A;  4P6E A;  3OVZ A;  2HHN A;  3P5W A;  2DC7 A;  3HHA A;  2OUL A;  1YK8 A;  2HH5 A;  3H89 A;  3KKU A;  1TLO A;  2P0R A;  4BQV A;  3BOW A;  1SNK A;  2HD5 A;  4OEL A;  3KX1 A;  2DCA A;  2YJ9 A;  4XUI A;  1GLO A;  1EF7 A;  1AEC A;  3C9E A;  4XR7 A;  2DC8 A;  9PAP A;  1KHQ A;  3P5U A;  1NB3 A;  3OF8 A;  4YV8 A;  1CSB B;  2ARY A;  5JH3 A;  1AU2 A;  4YYQ A;  1NB5 A;  3MHH A;  4RY2 A;  4BSQ A;  2XU1 A;  4YYW A;  2IPP B;  3H8C A;  2HXZ A;  2Y6E A;  4ZUX U;  4BS6 A;  1CTE A;  2YJC A;  2H7J A;  4QH6 A;  2B1N A;  4PP1 A;  1F2C A;  3GCB A;  4MZO A;  1CS8 A;  2R9N A;  1ITO A;  3ZUA A;  2PRE A;  1ZCM A;  2NQG A;  4N4Z A;  3E1Z B;  3K24 A;  1ZIV A;  2O6X A;  5K16 A;  3TNX A;  2XU5 A;  3DF0 A;  2DCC A;  1THE A;  4W5B A;  2FRQ A;  4WA6 A;  4KLB A;  2DJG B;  1CPJ A;  1BQI A;  3S3R A;  1BP4 A;  1MEM A;  1CJL A;  1CVZ A;  4CDF B;  1AYV A;  5CVO B;  2NQI A;  3MTN A;  1DF0 A;  3QSD A;  3H6S A;  3IUT A; 
#chains in the Genus database with same CATH topology
 2E00 A;  4A5U A;  4QRX A;  1DEU A;  3F75 A;  1Y08 A;  3I3T A;  2FQ9 A;  1EWP A;  1TU6 A;  2BTW B;  5CHT A;  3ZNH A;  4BOP A;  1PVJ A;  3MJ5 A;  3QT4 A;  2DZZ A;  3MP2 A;  1MDW A;  5EZQ A;  4PP2 E;  3LXS A;  3OIS A;  1AU3 A;  4PAD A;  1F2A A;  1PPD A;  2XU4 A;  3P5V A;  5CHV A;  4QRG A;  1HUC B;  1MHW A;  3NHE A;  2DCB A;  4MI7 A;  2J7Q C;  3I06 A;  1PPP A;  2AU1 A;  2FO5 A;  2P86 A;  3LFY A;  5PAD A;  4Q8G A;  2BTW A;  4D8I A;  1NPZ A;  3U8E A;  1FH0 A;  3M99 A;  1PAD A;  4G54 A;  4ZTB A;  3O1G A;  3QJ3 A;  3RVW A;  4RF1 A;  4HWY A;  4DMX A;  1MIR A;  3N3G A;  1K3B B;  2R9M A;  4X6I A;  2F7D A;  2DC6 A;  3IEJ A;  2FRA A;  1MS6 A;  3BWK A;  1A6R A;  3P5X A;  3KWZ A;  4Q8H A;  1AYW A;  4X6J A;  2IBI A;  5CVM A;  1U9W A;  1U5I A;  2P7U A;  3IFU A;  4RKX A;  4CDC B;  2PAD A;  4RF0 A;  3B79 A;  1GMY A;  2R9F A;  3F5V A;  1GEC E;  3MTV A;  4AXM A;  1PE6 A;  3HWN A;  3MHS A;  4OVZ A;  2JRI A;  1EWO A;  8PCH A;  2NQD B;  2FE8 A;  4P16 A;  2UZJ A;  1BGO A;  1NL6 A;  1U9Q X;  3OF9 A;  4YVA A;  1POP A;  4N79 A;  3KW9 A;  3PNR A;  2R6N A;  4X6H A;  7PCK A;  6PAD A;  4HXD B;  1ME3 A;  2YJB A;  1PPN A;  4PI3 A;  2C0Y A;  4CZW A;  3V6C A;  1IWD A;  1S4V A;  4MZS A;  2G6D A;  3KSE A;  4DMY A;  2GHU A;  5KO3 A;  2E01 A;  5EF4 A;  2R9O A;  2PNS A;  2YJ2 A;  4YYV A;  2PBH A;  2AIM A;  1AIM A;  3USV A;  4K7C A;  1ATK A;  2HWK A;  2G7Y A;  2G8J A;  2OP3 A;  4QBB A;  4IUM A;  3HHI A;  2ACT A;  2WBF X;  1KFU L;  1KFX L;  2AVW A;  3BPM A;  2VHS A;  1X9Y A;  2JQF R;  4R3D A;  1PBH A;  1AU4 A;  3V6E A;  1PCI A;  2DOS A;  4CDE B;  4BOU A;  3ERV A;  2CB5 A;  2AS8 A;  2B1M A;  2JTC A;  1NLJ A;  1U9X A;  2Y5B A;  1F29 A;  4D8B A;  1VSN A;  1DKI A;  3N3K A;  3CBK A;  3PHW A;  1PXV A;  3PDF A;  2YJ8 A;  1GCB A;  2BU3 A;  1EWL A;  1JQP A;  3CBJ A;  1O0E A;  1STF E;  2DC9 A;  4IP3 A;  1ICF A;  2DZY A;  2VHF A;  2DJF B;  4P6G A;  2XU3 A;  1SP4 B;  1PPO A;  3CH2 X;  4CDD B;  1XKG A;  4OVZ B;  1QMY A;  1ME4 A;  2FYE A;  3BPF A;  1CB5 A;  4QRV A;  4WUR A;  4FIP A;  3IMA A;  3OVX A;  1KHP A;  4FJC A;  4BOZ A;  1PIP A;  1VJV A;  3WXG A;  3IV2 A;  4I04 A;  2JQG R;  4W4U A;  3BB7 A;  3TMP A;  3H7D A;  5J94 A;  3D6S A;  1YAL A;  3K9M A;  1CV8 A;  3W30 A;  3E9S A;  4W5C A;  5CVN B;  2DCD A;  1UKF A;  2G8E A;  3PW3 A;  1YK7 A;  3WXE A;  2AUZ A;  4YYU A;  1KXR A;  4REZ A;  1Q6K A;  4OW0 A;  3IHP A;  4N8W A;  4XZX A;  5JZE A;  4AXL A;  2J7Q A;  5EGW A;  5F02 A;  5JA7 A;  4D8E A;  1YT7 A;  2OZ2 A;  3HD3 A;  4MM3 B;  2BDL A;  5FPW A;  4I05 A;  3MOR A;  1BY8 A;  4OEM A;  3RVX A;  1MEG A;  3PRP A;  2GFO A;  1QXP A;  3PHX A;  1CQD A;  1U9V A;  4FK5 A;  1YVB A;  4PT5 A;  2FUD A;  3IOQ A;  3RNV A;  2R9C A;  2AYO A;  3O0U A;  3AI8 A;  3KFQ A;  3H8B A;  4I07 A;  3C0R A;  4RNA A;  2F1G A;  2AYN A;  1QOL A;  3RVV A;  1F2B A;  2AUX A;  1Y4H A;  4BPV A;  1AYU A;  1EWM A;  2CIO A;  3N4C A;  2FT2 A;  3OQC A;  3PSE A;  2FTD A;  1NQC A;  1AU0 A;  2E02 A;  3CH3 X;  1TL9 A;  3WXF A;  3BCN A;  3TRK A;  5A24 A;  2E03 A;  4MSX A;  3BC3 A;  3KWB X;  4BS5 A;  1M6D A;  1QDQ A;  4YYS A;  2NQA A;  3S3Q A;  1YZB A;  3K8U A;  2BDZ A;  3PBH A;  2ATO A;  4YYR A;  4P6E A;  2AGA A;  3OVZ A;  2HHN A;  4BOQ A;  3P5W A;  2DC7 A;  3HHA A;  2OUL A;  1YK8 A;  2HH5 A;  3H89 A;  3KKU A;  1TLO A;  2P0R A;  4BQV A;  3BOW A;  1SNK A;  2HD5 A;  4OEL A;  3KX1 A;  2DCA A;  2YJ9 A;  4BOS A;  4XUI A;  1GLO A;  1EF7 A;  1AEC A;  3C9E A;  4XR7 A;  2DC8 A;  5E6J A;  9PAP A;  1KHQ A;  3P5U A;  1NB3 A;  3PRM A;  3OF8 A;  4YV8 A;  1CSB B;  2ARY A;  2Z84 A;  5JH3 A;  1AU2 A;  4YYQ A;  1NB5 A;  3MHH A;  4RY2 A;  4BSQ A;  2XU1 A;  4YYW A;  2IPP B;  3B21 A;  4M0W A;  3H8C A;  2HXZ A;  2Y6E A;  4ZUX U;  4BS6 A;  1CTE A;  2YJC A;  2H7J A;  4QH6 A;  2B1N A;  4PP1 A;  3PT2 A;  1F2C A;  5EZS A;  3GCB A;  4MZO A;  1CS8 A;  2R9N A;  1ITO A;  3ZUA A;  2PRE A;  1ZCM A;  2NQG A;  3BBA A;  4N4Z A;  3E1Z B;  3K24 A;  1ZIV A;  4GUA A;  2O6X A;  5K16 A;  3TNX A;  2XU5 A;  3DF0 A;  2DCC A;  1THE A;  3W31 A;  4W5B A;  2FRQ A;  3O65 A;  4KLB A;  4WA6 A;  2DJG B;  1CPJ A;  1BQI A;  3PHU A;  3S3R A;  1BP4 A;  1MEM A;  1CJL A;  1CVZ A;  3BY4 A;  4CDF B;  1AYV A;  5CVO B;  2NQI A;  3MTN A;  1DF0 A;  3QSD A;  3H6S A;  3IUT A; 
#chains in the Genus database with same CATH homology
 2E00 A;  4QRX A;  1DEU A;  3F75 A;  1Y08 A;  3I3T A;  2FQ9 A;  1EWP A;  1TU6 A;  5CHT A;  3QT4 A;  2DZZ A;  1MDW A;  3LTW A;  4PP2 E;  3LXS A;  4BGF A;  3OIS A;  1AU3 A;  4PAD A;  1F2A A;  1PPD A;  2XU4 A;  3P5V A;  4NV8 A;  5CHV A;  4QRG A;  1HUC B;  1MHW A;  3NHE A;  2DCB A;  3I06 A;  1PPP A;  2AU1 A;  2FO5 A;  2P86 A;  3LFY A;  5PAD A;  4Q8G A;  1NPZ A;  3U8E A;  1FH0 A;  3M99 A;  1PAD A;  4G54 A;  3O1G A;  3QJ3 A;  3RVW A;  4HWY A;  4DMX A;  1MIR A;  3N3G A;  1K3B B;  2R9M A;  4X6I A;  2F7D A;  2DC6 A;  3IEJ A;  2FRA A;  1W6F A;  1MS6 A;  3BWK A;  1A6R A;  3P5X A;  3KWZ A;  4Q8H A;  1AYW A;  4X6J A;  2IBI A;  5CVM A;  1U9W A;  1U5I A;  2P7U A;  4CDC B;  2PAD A;  3B79 A;  1GMY A;  2R9F A;  3F5V A;  1GEC E;  4AXM A;  4NV7 A;  1PE6 A;  3HWN A;  3MHS A;  1EWO A;  8PCH A;  2NQD B;  1BGO A;  1NL6 A;  1U9Q X;  3OF9 A;  4YVA A;  1POP A;  3D9W A;  4N79 A;  3KW9 A;  3PNR A;  2R6N A;  4X6H A;  7PCK A;  6PAD A;  1ME3 A;  2YJB A;  1PPN A;  4PI3 A;  2C0Y A;  4CZW A;  3V6C A;  1IWD A;  1S4V A;  4MZS A;  2G6D A;  3KSE A;  4DMY A;  2GHU A;  2E01 A;  5EF4 A;  2R9O A;  2PNS A;  2YJ2 A;  4YYV A;  2PBH A;  2AIM A;  1AIM A;  3USV A;  4K7C A;  1ATK A;  2G7Y A;  2G8J A;  2OP3 A;  4QBB A;  3HHI A;  2ACT A;  2WBF X;  1KFU L;  1KFX L;  2AVW A;  3BPM A;  2VHS A;  1X9Y A;  2JQF R;  1PBH A;  1AU4 A;  3V6E A;  1PCI A;  4CDE B;  3ERV A;  2CB5 A;  2AS8 A;  2B1M A;  1NLJ A;  1U9X A;  2Y5B A;  1F29 A;  4C5P A;  1VSN A;  3N3K A;  3CBK A;  2YJ8 A;  1PXV A;  3PDF A;  1GCB A;  1EWL A;  1JQP A;  3CBJ A;  1O0E A;  1STF E;  2DC9 A;  1ICF A;  2DZY A;  2VHF A;  2DJF B;  4P6G A;  2VFB A;  2XU3 A;  1SP4 B;  1PPO A;  3CH2 X;  4CDD B;  1XKG A;  1QMY A;  1ME4 A;  2FYE A;  3BPF A;  1CB5 A;  4QRV A;  3IMA A;  3OVX A;  4FIP A;  1KHP A;  4FJC A;  1PIP A;  1W4T A;  1VJV A;  3WXG A;  3IV2 A;  4I04 A;  2JQG R;  4W4U A;  3H7D A;  5J94 A;  3D6S A;  1YAL A;  3K9M A;  1CV8 A;  4W5C A;  5CVN B;  2DCD A;  2G8E A;  3PW3 A;  1YK7 A;  2BSZ A;  3WXE A;  2AUZ A;  4YYU A;  1KXR A;  1Q6K A;  3IHP A;  4N8W A;  4AXL A;  5EGW A;  5F02 A;  5JA7 A;  1YT7 A;  2OZ2 A;  3HD3 A;  5FPW A;  2BDL A;  4I05 A;  3MOR A;  1BY8 A;  4OEM A;  2VFC A;  3RVX A;  1MEG A;  1GX3 A;  2GFO A;  1QXP A;  1CQD A;  1U9V A;  4FK5 A;  1YVB A;  2FUD A;  3IOQ A;  2R9C A;  2AYO A;  3O0U A;  3AI8 A;  3KFQ A;  3H8B A;  4I07 A;  2F1G A;  2AYN A;  1QOL A;  3RVV A;  1F2B A;  2AUX A;  1Y4H A;  4BPV A;  1AYU A;  1EWM A;  2CIO A;  3N4C A;  2FT2 A;  2FTD A;  1NQC A;  1AU0 A;  2E02 A;  3CH3 X;  1TL9 A;  3WXF A;  3BCN A;  5A24 A;  2E03 A;  4MSX A;  3BC3 A;  3KWB X;  4BS5 A;  1M6D A;  1QDQ A;  4YYS A;  2NQA A;  3S3Q A;  3K8U A;  2BDZ A;  3PBH A;  2ATO A;  4YYR A;  4P6E A;  3OVZ A;  2HHN A;  3P5W A;  2DC7 A;  3HHA A;  2OUL A;  1YK8 A;  2HH5 A;  3H89 A;  3KKU A;  1TLO A;  2P0R A;  4BQV A;  3BOW A;  1SNK A;  4B55 A;  4GUZ A;  2HD5 A;  4OEL A;  1W5R A;  3KX1 A;  2DCA A;  2YJ9 A;  4XUI A;  1GLO A;  1EF7 A;  1AEC A;  3C9E A;  4XR7 A;  2DC8 A;  9PAP A;  1KHQ A;  3P5U A;  1NB3 A;  3OF8 A;  4YV8 A;  1CSB B;  2ARY A;  5JH3 A;  1AU2 A;  4YYQ A;  1NB5 A;  3MHH A;  4RY2 A;  4BSQ A;  2XU1 A;  4YYW A;  2IPP B;  3H8C A;  2HXZ A;  2Y6E A;  4ZUX U;  4BS6 A;  1CTE A;  2YJC A;  2H7J A;  4QH6 A;  2B1N A;  4PP1 A;  1F2C A;  3GCB A;  4MZO A;  1CS8 A;  2R9N A;  1ITO A;  3ZUA A;  2PRE A;  1ZCM A;  2NQG A;  4N4Z A;  3E1Z B;  3K24 A;  1ZIV A;  1E2T A;  2O6X A;  5K16 A;  3TNX A;  2XU5 A;  3DF0 A;  2DCC A;  1THE A;  4W5B A;  2FRQ A;  4WA6 A;  4KLB A;  2DJG B;  1CPJ A;  1BQI A;  3S3R A;  1BP4 A;  1MEM A;  1CJL A;  1CVZ A;  4CDF B;  1AYV A;  5CVO B;  2NQI A;  3MTN A;  1DF0 A;  3QSD A;  3H6S A;  3IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...