4Q8GA

Structure of the saccharomyces cerevisiae pan2 pseudoubiquitin-hydrolase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
403
structure length
344
Chain Sequence
TSDIQTYTSINKYEVPPAYSRLPLTFDFTPFNNTEYSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDTTLLTDLGYLFDMMERSHGKICSSSNFQASLKSLTSIKRNMPQKFNRFLLSQLIKEEAQTVNHNITLNQCFGLETEIRTECSCDHYDTTVKLLPSLSISGINQNILPYIEYAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLDTEFSNIRSSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNNNETRLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEELRKPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the Pan2-Pan3 core complex reveals cross-talk between deadenylase and pseudokinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords PAB-dependent poly(A)-specific ribonuclease subunit PAN2
total genus 98
structure length 344
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4q8gA00
1ATKA 1U9QX 1F2BA 1F2CA 1YVBA 2CIOA 4OELA 4YYVA 1PPOA 2GFOA 1X9YA 3H6SA 1AU0A 4QRXA 4N79A 5K16A 2C0YA 3HHIA 4BQVA 4YYSA 1EWOA 4PI3A 1U5IA 3IOQA 4N4ZA 2DCDA 2G8EA 3I3TA 1KHQA 1KFUL 1EWMA 1PIPA 1ME3A 4PP2E 1NQCA 4YVAA 2VHSA 4PADA 2FO5A 2HD5A 2R9CA 1Y4HA 1GLOA 2FUDA 1MEMA 1F2AA 1FH0A 1SP4B 3NHEA 2DCAA 4X6HA 2VHFA 4Q8GA 2DJFB 3HWNA 4YYUA 1YT7A 3S3QA 3B79A 2AYNA 3OVZA 3CBJA 1QDQA 3MHHA 4MSXA 1Y08A 4BS6A 1CV8A 2JQGR 3V6EA 3KW9A 1O0EA 1GCBA 4HWYA 2IPPB 4MZOA 1NB5A 1PE6A 2DZYA 3E1ZB 2AS8A 2DC9A 3BPMA 2BDLA 6PADA 3LXSA 1ITOA 2YJ9A 1STFE 3P5VA 3OVXA 3LFYA 2XU5A 2G7YA 1VSNA 1PBHA 4P6GA 4CZWA 2NQAA 3H89A 2E03A 4N8WA 1PCIA 8PCHA 4FK5A 3P5XA 3H8BA 4RY2A 3GCBA 5EGWA 1K3BB 3BC3A 1XKGA 3KKUA 2YJ8A 1NL6A 1ZIVA 3M99A 4X6JA 2Y6EA 1EWLA 2FYEA 4XUIA 3QJ3A 1PADA 1TU6A 2AYOA 2PBHA 4P6EA 4QBBA 5A24A 4AXMA 1MDWA 1CQDA 4YV8A 1EWPA 1JQPA 1MIRA 2OP3A 2E02A 9PAPA 2R9MA 4I04A 2BDZA 3CH3X 3F75A 1QMYA 1AYUA 5CVMA 4CDDB 2R9OA 3IMAA 1U9VA 1TL9A 2DC7A 7PCKA 4CDEB 1PXVA 1MS6A 1PPDA 3HHAA 1A6RA 1POPA 1KHPA 3PNRA 2FQ9A 1CB5A 1HUCB 4Q8HA 2ACTA 1ZCMA 2HXZA 2NQIA 3N4CA 3KSEA 3RVWA 4W5CA 2XU3A 3CBKA 1U9WA 2DC8A 3WXEA 4KLBA 3IUTA 3PDFA 3BCNA 3N3GA 2R6NA 2R9NA 2OZ2A 3F5VA 3KWBX 3PW3A 3KWZA 2FRQA 1S4VA 2AU1A 2PNSA 2B1MA 4XR7A 3O1GA 2NQDB 5CHVA 1NLJA 4QRGA 4PP1A 2XU4A 5CVOB 4BSQA 4WA6A 1M6DA 4CDFB 1QOLA 3OF9A 4MZSA 4YYRA 3OF8A 1ICFA 1BP4A 1ME4A 2AUXA 2DZZA 3KX1A 1AU3A 5F02A 2G6DA 2H7JA 3IHPA 1CTEA 1Q6KA 3ERVA 1IWDA 3BWKA 2CB5A 2WBFX 2FT2A 2P7UA 1PPPA 2O6XA 1AYVA 3O0UA 4X6IA 1TLOA 4G54A 4YYQA 3WXFA 3H8CA 3U8EA 1CSBB 2DCCA 2NQGA 2DC6A 1EF7A 1U9XA 1PPNA 3K24A 3AI8A 3P5WA 4K7CA 2P86A 2YJ2A 2P0RA 2F7DA 3CH2X 3P5UA 2ARYA 2Y5BA 3V6CA 3KFQA 4BS5A 4QRVA 1NPZA 5PADA 3H7DA 2HH5A 3BOWA 2PADA 3MTNA 3OISA 4AXLA 1YALA 2B1NA 1KXRA 1CJLA 1AU2A 1BQIA 3MORA 4W4UA 3RVXA 1KFXL 3WXGA 3TNXA 1AU4A 1AYWA 2R9FA 5CVNB 5J94A 4QH6A 3PBHA 1NB3A 4I05A 2FRAA 3IV2A 4BPVA 1QXPA 2AIMA 2G8JA 3N3KA 5EF4A 1SNKA 1MEGA 3USVA 1GECE 5CHTA 4FJCA 2ATOA 1F29A 1CVZA 3C9EA 2FTDA 1CS8A 1BY8A 3IEJA 3RVVA 2F1GA 5FPWA 1DF0A 1DEUA 4DMYA 3I06A 4OEMA 3ZUAA 4ZUXU 1CPJA 2HHNA 2YJCA 1AECA 1BGOA 2E00A 3MHSA 4YYWA 2AUZA 1AIMA 3QSDA 1GMYA 2JQFR 1YK8A 2AVWA 4CDCB 4I07A 2YJBA 1YK7A 2PREA 5JH3A 4W5BA 2GHUA 4FIPA 1VJVA 3S3RA 2XU1A 2OULA 3BPFA 5JA7A 3D6SA 2DCBA 3K8UA 3HD3A 3QT4A 4DMXA 3DF0A 3K9MA 1THEA 2E01A 1MHWA 2DJGB 2IBIA
chains in the Genus database with same CATH superfamily
1ATKA 1U9QX 1F2BA 1F2CA 1YVBA 4OVZA 2CIOA 4OELA 4YYVA 1PPOA 2GFOA 3RNVA 3MTVA 1X9YA 3H6SA 1AU0A 3MP2A 4QRXA 4N79A 5K16A 2C0YA 3HHIA 4BQVA 4YYSA 1EWOA 4PI3A 5EZQA 1U5IA 3IOQA 3PHXA 4N4ZA 2DCDA 2G8EA 3I3TA 1KHQA 4RKXA 3IFUA 1KFUL 1EWMA 1PIPA 1ME3A 4D8BA 4PP2E 1NQCA 2J7QA 4YVAA 2VHSA 4PADA 4MM3B 3BBAA 2FO5A 2HD5A 2R9CA 1Y4HA 1GLOA 2FUDA 1MEMA 1F2AA 1FH0A 1SP4B 3BY4A 3NHEA 2DCAA 4X6HA 2VHFA 4IUMA 4Q8GA 2DJFB 3HWNA 4YYUA 1YT7A 3S3QA 3B79A 2AYNA 3OVZA 3CBJA 1QDQA 3MHHA 4OVZB 4MSXA 1Y08A 4BS6A 4P16A 4BOQA 1CV8A 2JQGR 3V6EA 1DKIA 3KW9A 4IP3A 1O0EA 1GCBA 4HWYA 2IPPB 4MZOA 1NB5A 1PE6A 2DZYA 3E1ZB 1YZBA 2AS8A 2DC9A 3MJ5A 3BPMA 2BDLA 6PADA 3LXSA 1ITOA 2FE8A 2YJ9A 1STFE 3P5VA 3OVXA 3LFYA 2XU5A 2G7YA 1VSNA 1PBHA 3PT2A 4P6GA 4CZWA 2NQAA 3H89A 2E03A 4N8WA 1PCIA 8PCHA 4FK5A 3P5XA 4GUAA 3H8BA 4RY2A 3GCBA 3TRKA 5EGWA 1K3BB 3BC3A 1XKGA 3KKUA 2YJ8A 1NL6A 1ZIVA 3M99A 4X6JA 2Y6EA 1EWLA 2FYEA 4XUIA 3QJ3A 1PADA 1TU6A 2AYOA 2PBHA 4P6EA 4QBBA 5A24A 4AXMA 5E6JA 1MDWA 1CQDA 4YV8A 1EWPA 4R3DA 1JQPA 1MIRA 2OP3A 2E02A 3W30A 9PAPA 2R9MA 4I04A 2BDZA 3B21A 3CH3X 3PSEA 3F75A 1QMYA 3W31A 1AYUA 5CVMA 4CDDB 2R9OA 3IMAA 1U9VA 1TL9A 2DC7A 2BTWA 7PCKA 4CDEB 1PXVA 2BU3A 1MS6A 1PPDA 3HHAA 1A6RA 1POPA 1KHPA 3PNRA 2FQ9A 3PRPA 1CB5A 1HUCB 4Q8HA 2ACTA 1ZCMA 2HXZA 4RNAA 2NQIA 3N4CA 3KSEA 3RVWA 4W5CA 2XU3A 3CBKA 1U9WA 2DC8A 3WXEA 4KLBA 3IUTA 4BOUA 3PDFA 3BCNA 3N3GA 2R6NA 2HWKA 2R9NA 3BB7A 2OZ2A 3F5VA 3KWBX 3E9SA 3KWZA 3PW3A 2FRQA 2UZJA 1S4VA 2AU1A 5JZEA 4XZXA 2PNSA 2B1MA 4XR7A 3O1GA 2NQDB 5CHVA 1NLJA 4QRGA 4PP1A 1PVJA 2DOSA 2XU4A 5CVOB 4BSQA 4WA6A 1M6DA 3O65A 4BOZA 4CDFB 1QOLA 3OF9A 4MZSA 4YYRA 3OF8A 1ICFA 1BP4A 1ME4A 2AUXA 2DZZA 3KX1A 1AU3A 5F02A 1UKFA 2G6DA 2BTWB 2H7JA 3IHPA 1CTEA 1Q6KA 3ERVA 1IWDA 3BWKA 2CB5A 2WBFX 2FT2A 2P7UA 4ZTBA 1PPPA 2O6XA 1AYVA 3O0UA 4X6IA 1TLOA 4G54A 5KO3A 4YYQA 3WXFA 3H8CA 4RF1A 3U8EA 1CSBB 2DCCA 2NQGA 2DC6A 1EF7A 3TMPA 1U9XA 1PPNA 4OW0A 3K24A 3AI8A 4REZA 3P5WA 4K7CA 2P86A 2AGAA 2YJ2A 2P0RA 2F7DA 3CH2X 4A5UA 3P5UA 2ARYA 2Y5BA 3V6CA 3KFQA 4WURA 4D8EA 3OQCA 4BS5A 4QRVA 1NPZA 5PADA 3H7DA 2HH5A 3BOWA 2PADA 4RF0A 3MTNA 3OISA 4AXLA 1YALA 2B1NA 1KXRA 2JTCA 1CJLA 1AU2A 1BQIA 3MORA 4W4UA 3RVXA 1KFXL 3WXGA 3TNXA 5EZSA 4PT5A 1AU4A 1AYWA 2R9FA 5CVNB 5J94A 4QH6A 3PBHA 1NB3A 2JRIA 2Z84A 4I05A 2FRAA 4BOSA 3IV2A 4BPVA 1QXPA 2AIMA 2G8JA 3N3KA 5EF4A 1SNKA 1MEGA 4M0WA 1GECE 3USVA 5CHTA 4FJCA 2ATOA 1F29A 4D8IA 1CVZA 3C9EA 2FTDA 1CS8A 1BY8A 3IEJA 3RVVA 2F1GA 5FPWA 1DF0A 3PHUA 1DEUA 4DMYA 3I06A 4OEMA 3PRMA 4HXDB 3ZNHA 3ZUAA 4MI7A 4ZUXU 1CPJA 2HHNA 2YJCA 1AECA 1BGOA 2E00A 3MHSA 4YYWA 2AUZA 1AIMA 3QSDA 1GMYA 2JQFR 1YK8A 2AVWA 3PHWA 4CDCB 4I07A 2YJBA 1YK7A 2J7QC 2PREA 5JH3A 4W5BA 2GHUA 4FIPA 1VJVA 3S3RA 2XU1A 2OULA 3BPFA 3C0RA 5JA7A 3D6SA 2DCBA 3K8UA 3HD3A 3QT4A 4BOPA 4DMXA 3DF0A 3K9MA 1THEA 2E01A 1MHWA 2DJGB 2IBIA
chains in the Genus database with same CATH topology
1ATKA 1U9QX 1F2BA 1F2CA 1YVBA 2CIOA 4OELA 4YYVA 1PPOA 2GFOA 2VFBA 1X9YA 3H6SA 1AU0A 4QRXA 4N79A 5K16A 2C0YA 3HHIA 4BQVA 4YYSA 1EWOA 4PI3A 1U5IA 3IOQA 4N4ZA 2DCDA 2G8EA 3I3TA 1KHQA 1KFUL 1EWMA 1PIPA 1ME3A 4PP2E 1NQCA 4YVAA 2VHSA 4PADA 2FO5A 4BGFA 2HD5A 2R9CA 1Y4HA 1GLOA 2FUDA 1MEMA 1F2AA 1FH0A 1SP4B 3NHEA 2DCAA 4X6HA 2VHFA 4Q8GA 2DJFB 3HWNA 4YYUA 1YT7A 3S3QA 3B79A 2AYNA 3OVZA 3CBJA 1QDQA 3MHHA 4MSXA 1Y08A 4BS6A 1CV8A 2JQGR 3V6EA 3KW9A 1O0EA 1GCBA 4HWYA 2IPPB 4MZOA 1NB5A 1PE6A 2DZYA 3E1ZB 2AS8A 2DC9A 3D9WA 3BPMA 4NV7A 2BDLA 6PADA 3LXSA 1ITOA 2YJ9A 1STFE 3P5VA 3OVXA 3LFYA 2XU5A 2G7YA 1VSNA 1PBHA 4P6GA 4CZWA 2NQAA 3H89A 2E03A 4N8WA 1PCIA 8PCHA 4FK5A 3P5XA 3H8BA 4RY2A 3GCBA 5EGWA 1K3BB 3BC3A 1XKGA 3KKUA 2YJ8A 1NL6A 1ZIVA 3M99A 4X6JA 4GUZA 2Y6EA 1EWLA 2FYEA 4XUIA 3QJ3A 1PADA 1TU6A 2AYOA 2PBHA 4P6EA 4QBBA 5A24A 4AXMA 1MDWA 1CQDA 4YV8A 1EWPA 1JQPA 1MIRA 2OP3A 2E02A 9PAPA 2R9MA 4I04A 2BDZA 4B55A 3CH3X 3F75A 1QMYA 1AYUA 1W4TA 5CVMA 4CDDB 2R9OA 3IMAA 1U9VA 1TL9A 2DC7A 7PCKA 4CDEB 1PXVA 1MS6A 1PPDA 3HHAA 1A6RA 1POPA 1KHPA 3PNRA 2FQ9A 1CB5A 1HUCB 4Q8HA 2ACTA 4NV8A 1ZCMA 2HXZA 2NQIA 3N4CA 3KSEA 3RVWA 4W5CA 2XU3A 1W5RA 3CBKA 1U9WA 2DC8A 3WXEA 4KLBA 4C5PA 2VFCA 3IUTA 3PDFA 3BCNA 3N3GA 2R6NA 2R9NA 2OZ2A 3F5VA 3KWBX 3PW3A 3KWZA 2FRQA 1S4VA 2AU1A 2PNSA 2B1MA 4XR7A 3O1GA 2NQDB 5CHVA 1NLJA 4QRGA 4PP1A 2XU4A 5CVOB 4BSQA 4WA6A 1M6DA 4CDFB 1QOLA 3OF9A 4MZSA 4YYRA 3OF8A 1ICFA 1BP4A 1ME4A 2AUXA 2DZZA 3KX1A 1AU3A 5F02A 2BSZA 2G6DA 2H7JA 3IHPA 1CTEA 1Q6KA 3ERVA 1IWDA 3BWKA 2CB5A 2WBFX 2FT2A 2P7UA 1PPPA 2O6XA 1AYVA 3O0UA 4X6IA 1TLOA 4G54A 4YYQA 3WXFA 3H8CA 3U8EA 1CSBB 2DCCA 2NQGA 2DC6A 1EF7A 1U9XA 1PPNA 3K24A 3AI8A 3LTWA 3P5WA 4K7CA 2P86A 2YJ2A 2P0RA 2F7DA 3CH2X 3P5UA 2ARYA 2Y5BA 3V6CA 3KFQA 4BS5A 1W6FA 4QRVA 1NPZA 5PADA 3H7DA 2HH5A 3BOWA 2PADA 3MTNA 3OISA 4AXLA 1YALA 2B1NA 1KXRA 1CJLA 1AU2A 1BQIA 3MORA 4W4UA 3RVXA 1KFXL 3WXGA 3TNXA 1AU4A 1AYWA 2R9FA 5CVNB 5J94A 4QH6A 3PBHA 1NB3A 4I05A 2FRAA 3IV2A 4BPVA 1QXPA 2AIMA 2G8JA 3N3KA 5EF4A 1SNKA 1MEGA 3USVA 1GECE 5CHTA 4FJCA 2ATOA 1F29A 1CVZA 3C9EA 2FTDA 1CS8A 1BY8A 3IEJA 3RVVA 2F1GA 5FPWA 1DF0A 1DEUA 4DMYA 3I06A 4OEMA 3ZUAA 4ZUXU 1CPJA 2HHNA 2YJCA 1AECA 1BGOA 2E00A 3MHSA 4YYWA 2AUZA 1AIMA 3QSDA 1GMYA 1GX3A 2JQFR 1YK8A 2AVWA 4CDCB 4I07A 2YJBA 1E2TA 1YK7A 2PREA 5JH3A 4W5BA 2GHUA 4FIPA 1VJVA 3S3RA 2XU1A 2OULA 3BPFA 5JA7A 3D6SA 2DCBA 3K8UA 3HD3A 3QT4A 4DMXA 3DF0A 3K9MA 1THEA 2E01A 1MHWA 2DJGB 2IBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATK A;  1U9Q X;  1F2B A;  1F2C A;  1YVB A;  2CIO A;  4OEL A;  4YYV A;  1PPO A;  2GFO A;  1X9Y A;  3H6S A;  1AU0 A;  4QRX A;  4N79 A;  5K16 A;  2C0Y A;  3HHI A;  4BQV A;  4YYS A;  1EWO A;  4PI3 A;  1U5I A;  3IOQ A;  4N4Z A;  2DCD A;  2G8E A;  3I3T A;  1KHQ A;  1KFU L;  1EWM A;  1PIP A;  1ME3 A;  4PP2 E;  1NQC A;  4YVA A;  2VHS A;  4PAD A;  2FO5 A;  2HD5 A;  2R9C A;  1Y4H A;  1GLO A;  2FUD A;  1MEM A;  1F2A A;  1FH0 A;  1SP4 B;  3NHE A;  2DCA A;  4X6H A;  2VHF A;  4Q8G A;  2DJF B;  3HWN A;  4YYU A;  1YT7 A;  3S3Q A;  3B79 A;  2AYN A;  3OVZ A;  3CBJ A;  1QDQ A;  3MHH A;  4MSX A;  1Y08 A;  4BS6 A;  1CV8 A;  2JQG R;  3V6E A;  3KW9 A;  1O0E A;  1GCB A;  4HWY A;  2IPP B;  4MZO A;  1NB5 A;  1PE6 A;  2DZY A;  3E1Z B;  2AS8 A;  2DC9 A;  3BPM A;  2BDL A;  6PAD A;  3LXS A;  1ITO A;  2YJ9 A;  1STF E;  3P5V A;  3OVX A;  3LFY A;  2XU5 A;  2G7Y A;  1VSN A;  1PBH A;  4P6G A;  4CZW A;  2NQA A;  3H89 A;  2E03 A;  4N8W A;  1PCI A;  8PCH A;  4FK5 A;  3P5X A;  3H8B A;  4RY2 A;  3GCB A;  5EGW A;  1K3B B;  3BC3 A;  1XKG A;  3KKU A;  2YJ8 A;  1NL6 A;  1ZIV A;  3M99 A;  4X6J A;  2Y6E A;  1EWL A;  2FYE A;  4XUI A;  3QJ3 A;  1PAD A;  1TU6 A;  2AYO A;  2PBH A;  4P6E A;  4QBB A;  5A24 A;  4AXM A;  1MDW A;  1CQD A;  4YV8 A;  1EWP A;  1JQP A;  1MIR A;  2OP3 A;  2E02 A;  9PAP A;  2R9M A;  4I04 A;  2BDZ A;  3CH3 X;  3F75 A;  1QMY A;  1AYU A;  5CVM A;  4CDD B;  2R9O A;  3IMA A;  1U9V A;  1TL9 A;  2DC7 A;  7PCK A;  4CDE B;  1PXV A;  1MS6 A;  1PPD A;  3HHA A;  1A6R A;  1POP A;  1KHP A;  3PNR A;  2FQ9 A;  1CB5 A;  1HUC B;  4Q8H A;  2ACT A;  1ZCM A;  2HXZ A;  2NQI A;  3N4C A;  3KSE A;  3RVW A;  4W5C A;  2XU3 A;  3CBK A;  1U9W A;  2DC8 A;  3WXE A;  4KLB A;  3IUT A;  3PDF A;  3BCN A;  3N3G A;  2R6N A;  2R9N A;  2OZ2 A;  3F5V A;  3KWB X;  3PW3 A;  3KWZ A;  2FRQ A;  1S4V A;  2AU1 A;  2PNS A;  2B1M A;  4XR7 A;  3O1G A;  2NQD B;  5CHV A;  1NLJ A;  4QRG A;  4PP1 A;  2XU4 A;  5CVO B;  4BSQ A;  4WA6 A;  1M6D A;  4CDF B;  1QOL A;  3OF9 A;  4MZS A;  4YYR A;  3OF8 A;  1ICF A;  1BP4 A;  1ME4 A;  2AUX A;  2DZZ A;  3KX1 A;  1AU3 A;  5F02 A;  2G6D A;  2H7J A;  3IHP A;  1CTE A;  1Q6K A;  3ERV A;  1IWD A;  3BWK A;  2CB5 A;  2WBF X;  2FT2 A;  2P7U A;  1PPP A;  2O6X A;  1AYV A;  3O0U A;  4X6I A;  1TLO A;  4G54 A;  4YYQ A;  3WXF A;  3H8C A;  3U8E A;  1CSB B;  2DCC A;  2NQG A;  2DC6 A;  1EF7 A;  1U9X A;  1PPN A;  3K24 A;  3AI8 A;  3P5W A;  4K7C A;  2P86 A;  2YJ2 A;  2P0R A;  2F7D A;  3CH2 X;  3P5U A;  2ARY A;  2Y5B A;  3V6C A;  3KFQ A;  4BS5 A;  4QRV A;  1NPZ A;  5PAD A;  3H7D A;  2HH5 A;  3BOW A;  2PAD A;  3MTN A;  3OIS A;  4AXL A;  1YAL A;  2B1N A;  1KXR A;  1CJL A;  1AU2 A;  1BQI A;  3MOR A;  4W4U A;  3RVX A;  1KFX L;  3WXG A;  3TNX A;  1AU4 A;  1AYW A;  2R9F A;  5CVN B;  5J94 A;  4QH6 A;  3PBH A;  1NB3 A;  4I05 A;  2FRA A;  3IV2 A;  4BPV A;  1QXP A;  2AIM A;  2G8J A;  3N3K A;  5EF4 A;  1SNK A;  1MEG A;  3USV A;  1GEC E;  5CHT A;  4FJC A;  2ATO A;  1F29 A;  1CVZ A;  3C9E A;  2FTD A;  1CS8 A;  1BY8 A;  3IEJ A;  3RVV A;  2F1G A;  5FPW A;  1DF0 A;  1DEU A;  4DMY A;  3I06 A;  4OEM A;  3ZUA A;  4ZUX U;  1CPJ A;  2HHN A;  2YJC A;  1AEC A;  1BGO A;  2E00 A;  3MHS A;  4YYW A;  2AUZ A;  1AIM A;  3QSD A;  1GMY A;  2JQF R;  1YK8 A;  2AVW A;  4CDC B;  4I07 A;  2YJB A;  1YK7 A;  2PRE A;  5JH3 A;  4W5B A;  2GHU A;  4FIP A;  1VJV A;  3S3R A;  2XU1 A;  2OUL A;  3BPF A;  5JA7 A;  3D6S A;  2DCB A;  3K8U A;  3HD3 A;  3QT4 A;  4DMX A;  3DF0 A;  3K9M A;  1THE A;  2E01 A;  1MHW A;  2DJG B;  2IBI A; 
#chains in the Genus database with same CATH topology
 1ATK A;  1U9Q X;  1F2B A;  1F2C A;  1YVB A;  4OVZ A;  2CIO A;  4OEL A;  4YYV A;  1PPO A;  2GFO A;  3RNV A;  3MTV A;  1X9Y A;  3H6S A;  1AU0 A;  3MP2 A;  4QRX A;  4N79 A;  5K16 A;  2C0Y A;  3HHI A;  4BQV A;  4YYS A;  1EWO A;  4PI3 A;  5EZQ A;  1U5I A;  3IOQ A;  3PHX A;  4N4Z A;  2DCD A;  2G8E A;  3I3T A;  1KHQ A;  4RKX A;  3IFU A;  1KFU L;  1EWM A;  1PIP A;  1ME3 A;  4D8B A;  4PP2 E;  1NQC A;  2J7Q A;  4YVA A;  2VHS A;  4PAD A;  4MM3 B;  3BBA A;  2FO5 A;  2HD5 A;  2R9C A;  1Y4H A;  1GLO A;  2FUD A;  1MEM A;  1F2A A;  1FH0 A;  1SP4 B;  3BY4 A;  3NHE A;  2DCA A;  4X6H A;  2VHF A;  4IUM A;  4Q8G A;  2DJF B;  3HWN A;  4YYU A;  1YT7 A;  3S3Q A;  3B79 A;  2AYN A;  3OVZ A;  3CBJ A;  1QDQ A;  3MHH A;  4OVZ B;  4MSX A;  1Y08 A;  4BS6 A;  4P16 A;  4BOQ A;  1CV8 A;  2JQG R;  3V6E A;  1DKI A;  3KW9 A;  4IP3 A;  1O0E A;  1GCB A;  4HWY A;  2IPP B;  4MZO A;  1NB5 A;  1PE6 A;  2DZY A;  3E1Z B;  1YZB A;  2AS8 A;  2DC9 A;  3MJ5 A;  3BPM A;  2BDL A;  6PAD A;  3LXS A;  1ITO A;  2FE8 A;  2YJ9 A;  1STF E;  3P5V A;  3OVX A;  3LFY A;  2XU5 A;  2G7Y A;  1VSN A;  1PBH A;  3PT2 A;  4P6G A;  4CZW A;  2NQA A;  3H89 A;  2E03 A;  4N8W A;  1PCI A;  8PCH A;  4FK5 A;  3P5X A;  4GUA A;  3H8B A;  4RY2 A;  3GCB A;  3TRK A;  5EGW A;  1K3B B;  3BC3 A;  1XKG A;  3KKU A;  2YJ8 A;  1NL6 A;  1ZIV A;  3M99 A;  4X6J A;  2Y6E A;  1EWL A;  2FYE A;  4XUI A;  3QJ3 A;  1PAD A;  1TU6 A;  2AYO A;  2PBH A;  4P6E A;  4QBB A;  5A24 A;  4AXM A;  5E6J A;  1MDW A;  1CQD A;  4YV8 A;  1EWP A;  4R3D A;  1JQP A;  1MIR A;  2OP3 A;  2E02 A;  3W30 A;  9PAP A;  2R9M A;  4I04 A;  2BDZ A;  3B21 A;  3CH3 X;  3PSE A;  3F75 A;  1QMY A;  3W31 A;  1AYU A;  5CVM A;  4CDD B;  2R9O A;  3IMA A;  1U9V A;  1TL9 A;  2DC7 A;  2BTW A;  7PCK A;  4CDE B;  1PXV A;  2BU3 A;  1MS6 A;  1PPD A;  3HHA A;  1A6R A;  1POP A;  1KHP A;  3PNR A;  2FQ9 A;  3PRP A;  1CB5 A;  1HUC B;  4Q8H A;  2ACT A;  1ZCM A;  2HXZ A;  4RNA A;  2NQI A;  3N4C A;  3KSE A;  3RVW A;  4W5C A;  2XU3 A;  3CBK A;  1U9W A;  2DC8 A;  3WXE A;  4KLB A;  3IUT A;  4BOU A;  3PDF A;  3BCN A;  3N3G A;  2R6N A;  2HWK A;  2R9N A;  3BB7 A;  2OZ2 A;  3F5V A;  3KWB X;  3E9S A;  3KWZ A;  3PW3 A;  2FRQ A;  2UZJ A;  1S4V A;  2AU1 A;  5JZE A;  4XZX A;  2PNS A;  2B1M A;  4XR7 A;  3O1G A;  2NQD B;  5CHV A;  1NLJ A;  4QRG A;  4PP1 A;  1PVJ A;  2DOS A;  2XU4 A;  5CVO B;  4BSQ A;  4WA6 A;  1M6D A;  3O65 A;  4BOZ A;  4CDF B;  1QOL A;  3OF9 A;  4MZS A;  4YYR A;  3OF8 A;  1ICF A;  1BP4 A;  1ME4 A;  2AUX A;  2DZZ A;  3KX1 A;  1AU3 A;  5F02 A;  1UKF A;  2G6D A;  2BTW B;  2H7J A;  3IHP A;  1CTE A;  1Q6K A;  3ERV A;  1IWD A;  3BWK A;  2CB5 A;  2WBF X;  2FT2 A;  2P7U A;  4ZTB A;  1PPP A;  2O6X A;  1AYV A;  3O0U A;  4X6I A;  1TLO A;  4G54 A;  5KO3 A;  4YYQ A;  3WXF A;  3H8C A;  4RF1 A;  3U8E A;  1CSB B;  2DCC A;  2NQG A;  2DC6 A;  1EF7 A;  3TMP A;  1U9X A;  1PPN A;  4OW0 A;  3K24 A;  3AI8 A;  4REZ A;  3P5W A;  4K7C A;  2P86 A;  2AGA A;  2YJ2 A;  2P0R A;  2F7D A;  3CH2 X;  4A5U A;  3P5U A;  2ARY A;  2Y5B A;  3V6C A;  3KFQ A;  4WUR A;  4D8E A;  3OQC A;  4BS5 A;  4QRV A;  1NPZ A;  5PAD A;  3H7D A;  2HH5 A;  3BOW A;  2PAD A;  4RF0 A;  3MTN A;  3OIS A;  4AXL A;  1YAL A;  2B1N A;  1KXR A;  2JTC A;  1CJL A;  1AU2 A;  1BQI A;  3MOR A;  4W4U A;  3RVX A;  1KFX L;  3WXG A;  3TNX A;  5EZS A;  4PT5 A;  1AU4 A;  1AYW A;  2R9F A;  5CVN B;  5J94 A;  4QH6 A;  3PBH A;  1NB3 A;  2JRI A;  2Z84 A;  4I05 A;  2FRA A;  4BOS A;  3IV2 A;  4BPV A;  1QXP A;  2AIM A;  2G8J A;  3N3K A;  5EF4 A;  1SNK A;  1MEG A;  4M0W A;  1GEC E;  3USV A;  5CHT A;  4FJC A;  2ATO A;  1F29 A;  4D8I A;  1CVZ A;  3C9E A;  2FTD A;  1CS8 A;  1BY8 A;  3IEJ A;  3RVV A;  2F1G A;  5FPW A;  1DF0 A;  3PHU A;  1DEU A;  4DMY A;  3I06 A;  4OEM A;  3PRM A;  4HXD B;  3ZNH A;  3ZUA A;  4MI7 A;  4ZUX U;  1CPJ A;  2HHN A;  2YJC A;  1AEC A;  1BGO A;  2E00 A;  3MHS A;  4YYW A;  2AUZ A;  1AIM A;  3QSD A;  1GMY A;  2JQF R;  1YK8 A;  2AVW A;  3PHW A;  4CDC B;  4I07 A;  2YJB A;  1YK7 A;  2J7Q C;  2PRE A;  5JH3 A;  4W5B A;  2GHU A;  4FIP A;  1VJV A;  3S3R A;  2XU1 A;  2OUL A;  3BPF A;  3C0R A;  5JA7 A;  3D6S A;  2DCB A;  3K8U A;  3HD3 A;  3QT4 A;  4BOP A;  4DMX A;  3DF0 A;  3K9M A;  1THE A;  2E01 A;  1MHW A;  2DJG B;  2IBI A; 
#chains in the Genus database with same CATH homology
 1ATK A;  1U9Q X;  1F2B A;  1F2C A;  1YVB A;  2CIO A;  4OEL A;  4YYV A;  1PPO A;  2GFO A;  2VFB A;  1X9Y A;  3H6S A;  1AU0 A;  4QRX A;  4N79 A;  5K16 A;  2C0Y A;  3HHI A;  4BQV A;  4YYS A;  1EWO A;  4PI3 A;  1U5I A;  3IOQ A;  4N4Z A;  2DCD A;  2G8E A;  3I3T A;  1KHQ A;  1KFU L;  1EWM A;  1PIP A;  1ME3 A;  4PP2 E;  1NQC A;  4YVA A;  2VHS A;  4PAD A;  2FO5 A;  4BGF A;  2HD5 A;  2R9C A;  1Y4H A;  1GLO A;  2FUD A;  1MEM A;  1F2A A;  1FH0 A;  1SP4 B;  3NHE A;  2DCA A;  4X6H A;  2VHF A;  4Q8G A;  2DJF B;  3HWN A;  4YYU A;  1YT7 A;  3S3Q A;  3B79 A;  2AYN A;  3OVZ A;  3CBJ A;  1QDQ A;  3MHH A;  4MSX A;  1Y08 A;  4BS6 A;  1CV8 A;  2JQG R;  3V6E A;  3KW9 A;  1O0E A;  1GCB A;  4HWY A;  2IPP B;  4MZO A;  1NB5 A;  1PE6 A;  2DZY A;  3E1Z B;  2AS8 A;  2DC9 A;  3D9W A;  3BPM A;  4NV7 A;  2BDL A;  6PAD A;  3LXS A;  1ITO A;  2YJ9 A;  1STF E;  3P5V A;  3OVX A;  3LFY A;  2XU5 A;  2G7Y A;  1VSN A;  1PBH A;  4P6G A;  4CZW A;  2NQA A;  3H89 A;  2E03 A;  4N8W A;  1PCI A;  8PCH A;  4FK5 A;  3P5X A;  3H8B A;  4RY2 A;  3GCB A;  5EGW A;  1K3B B;  3BC3 A;  1XKG A;  3KKU A;  2YJ8 A;  1NL6 A;  1ZIV A;  3M99 A;  4X6J A;  4GUZ A;  2Y6E A;  1EWL A;  2FYE A;  4XUI A;  3QJ3 A;  1PAD A;  1TU6 A;  2AYO A;  2PBH A;  4P6E A;  4QBB A;  5A24 A;  4AXM A;  1MDW A;  1CQD A;  4YV8 A;  1EWP A;  1JQP A;  1MIR A;  2OP3 A;  2E02 A;  9PAP A;  2R9M A;  4I04 A;  2BDZ A;  4B55 A;  3CH3 X;  3F75 A;  1QMY A;  1AYU A;  1W4T A;  5CVM A;  4CDD B;  2R9O A;  3IMA A;  1U9V A;  1TL9 A;  2DC7 A;  7PCK A;  4CDE B;  1PXV A;  1MS6 A;  1PPD A;  3HHA A;  1A6R A;  1POP A;  1KHP A;  3PNR A;  2FQ9 A;  1CB5 A;  1HUC B;  4Q8H A;  2ACT A;  4NV8 A;  1ZCM A;  2HXZ A;  2NQI A;  3N4C A;  3KSE A;  3RVW A;  4W5C A;  2XU3 A;  1W5R A;  3CBK A;  1U9W A;  2DC8 A;  3WXE A;  4KLB A;  4C5P A;  2VFC A;  3IUT A;  3PDF A;  3BCN A;  3N3G A;  2R6N A;  2R9N A;  2OZ2 A;  3F5V A;  3KWB X;  3PW3 A;  3KWZ A;  2FRQ A;  1S4V A;  2AU1 A;  2PNS A;  2B1M A;  4XR7 A;  3O1G A;  2NQD B;  5CHV A;  1NLJ A;  4QRG A;  4PP1 A;  2XU4 A;  5CVO B;  4BSQ A;  4WA6 A;  1M6D A;  4CDF B;  1QOL A;  3OF9 A;  4MZS A;  4YYR A;  3OF8 A;  1ICF A;  1BP4 A;  1ME4 A;  2AUX A;  2DZZ A;  3KX1 A;  1AU3 A;  5F02 A;  2BSZ A;  2G6D A;  2H7J A;  3IHP A;  1CTE A;  1Q6K A;  3ERV A;  1IWD A;  3BWK A;  2CB5 A;  2WBF X;  2FT2 A;  2P7U A;  1PPP A;  2O6X A;  1AYV A;  3O0U A;  4X6I A;  1TLO A;  4G54 A;  4YYQ A;  3WXF A;  3H8C A;  3U8E A;  1CSB B;  2DCC A;  2NQG A;  2DC6 A;  1EF7 A;  1U9X A;  1PPN A;  3K24 A;  3AI8 A;  3LTW A;  3P5W A;  4K7C A;  2P86 A;  2YJ2 A;  2P0R A;  2F7D A;  3CH2 X;  3P5U A;  2ARY A;  2Y5B A;  3V6C A;  3KFQ A;  4BS5 A;  1W6F A;  4QRV A;  1NPZ A;  5PAD A;  3H7D A;  2HH5 A;  3BOW A;  2PAD A;  3MTN A;  3OIS A;  4AXL A;  1YAL A;  2B1N A;  1KXR A;  1CJL A;  1AU2 A;  1BQI A;  3MOR A;  4W4U A;  3RVX A;  1KFX L;  3WXG A;  3TNX A;  1AU4 A;  1AYW A;  2R9F A;  5CVN B;  5J94 A;  4QH6 A;  3PBH A;  1NB3 A;  4I05 A;  2FRA A;  3IV2 A;  4BPV A;  1QXP A;  2AIM A;  2G8J A;  3N3K A;  5EF4 A;  1SNK A;  1MEG A;  3USV A;  1GEC E;  5CHT A;  4FJC A;  2ATO A;  1F29 A;  1CVZ A;  3C9E A;  2FTD A;  1CS8 A;  1BY8 A;  3IEJ A;  3RVV A;  2F1G A;  5FPW A;  1DF0 A;  1DEU A;  4DMY A;  3I06 A;  4OEM A;  3ZUA A;  4ZUX U;  1CPJ A;  2HHN A;  2YJC A;  1AEC A;  1BGO A;  2E00 A;  3MHS A;  4YYW A;  2AUZ A;  1AIM A;  3QSD A;  1GMY A;  1GX3 A;  2JQF R;  1YK8 A;  2AVW A;  4CDC B;  4I07 A;  2YJB A;  1E2T A;  1YK7 A;  2PRE A;  5JH3 A;  4W5B A;  2GHU A;  4FIP A;  1VJV A;  3S3R A;  2XU1 A;  2OUL A;  3BPF A;  5JA7 A;  3D6S A;  2DCB A;  3K8U A;  3HD3 A;  3QT4 A;  4DMX A;  3DF0 A;  3K9M A;  1THE A;  2E01 A;  1MHW A;  2DJG B;  2IBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...