4Q8GA

Structure of the saccharomyces cerevisiae pan2 pseudoubiquitin-hydrolase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
403
structure length
344
Chain Sequence
TSDIQTYTSINKYEVPPAYSRLPLTFDFTPFNNTEYSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDTTLLTDLGYLFDMMERSHGKICSSSNFQASLKSLTSIKRNMPQKFNRFLLSQLIKEEAQTVNHNITLNQCFGLETEIRTECSCDHYDTTVKLLPSLSISGINQNILPYIEYAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLDTEFSNIRSSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNNNETRLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEELRKPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the Pan2-Pan3 core complex reveals cross-talk between deadenylase and pseudokinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords PAB-dependent poly(A)-specific ribonuclease subunit PAN2
total genus 98
structure length 344
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4q8gA00
2AVWA 1F2CA 4X6HA 2BDZA 5FPWA 4WA6A 1AYWA 3MTNA 7PCKA 2YJCA 2E02A 1ZCMA 3N4CA 3CH3X 1VSNA 2R9NA 1EWPA 2JQGR 2G8EA 2R6NA 1PPNA 3H8BA 1BY8A 1CPJA 4OEMA 3BCNA 2VHFA 2E03A 2XU5A 1AECA 5F02A 3BPFA 1U9QX 9PAPA 4X6JA 2DCDA 5J94A 3KX1A 2ARYA 2HHNA 2HXZA 4Q8GA 1KXRA 2R9FA 3I06A 3QT4A 1GMYA 1JQPA 2P86A 3H6SA 1KFXL 3F5VA 2G7YA 4OELA 2HH5A 2O6XA 5K16A 3K9MA 1VJVA 3OVZA 2F7DA 1Y4HA 1YK8A 2DCCA 1PXVA 2OP3A 3IOQA 1U9VA 3D6SA 3O1GA 1CQDA 4CDDB 2OZ2A 2H7JA 4XR7A 4YYRA 2CB5A 2DC7A 3V6CA 4CZWA 4CDCB 4N79A 1ICFA 2DC6A 3WXEA 2AYOA 5CVMA 2P0RA 1CB5A 4DMYA 1NPZA 3RVXA 1U9WA 4BQVA 4QH6A 1AU4A 4QBBA 4W5BA 3K8UA 4ZUXU 3HWNA 4QRGA 1DF0A 2IPPB 3BPMA 3CBJA 2FT2A 3B79A 4BPVA 2FRAA 1HUCB 2Y6EA 4K7CA 2GHUA 2Y5BA 3I3TA 3PNRA 1F29A 5EGWA 3WXGA 2F1GA 1AYUA 4I04A 3HHAA 1PPOA 1MS6A 1YVBA 3IHPA 1AU2A 3OISA 1NB5A 1ATKA 1PPDA 1KFUL 4PI3A 2YJBA 3ERVA 3BOWA 1MEGA 2G6DA 2R9CA 1MDWA 1SNKA 2IBIA 2NQGA 1IWDA 3WXFA 3OF8A 1EF7A 3HHIA 2AU1A 5JH3A 1CVZA 5JA7A 2FQ9A 3LFYA 1CTEA 3P5VA 3E1ZB 2R9OA 2DCBA 4PP1A 3N3KA 3KWBX 2PBHA 2VHSA 1NL6A 1MHWA 3MHSA 2DJGB 2BDLA 2ATOA 1DEUA 4CDFB 2AUXA 3MORA 2PNSA 3LXSA 3TNXA 3IUTA 2B1NA 4X6IA 2P7UA 2G8JA 1F2BA 4FK5A 3KW9A 3PBHA 2DZZA 3N3GA 1TL9A 1XKGA 2FYEA 4YYQA 4I07A 1AU3A 1CJLA 2FUDA 2DC8A 3KKUA 1BP4A 3KWZA 4DMXA 1AYVA 2HD5A 3ZUAA 2DCAA 3P5WA 4I05A 1SP4B 4P6GA 3QJ3A 3BWKA 2JQFR 2E01A 2XU3A 3K24A 2YJ8A 1PIPA 3H89A 2XU4A 1QOLA 1S4VA 3S3RA 3CH2X 1PADA 2DJFB 5PADA 1GCBA 1EWMA 2AS8A 2NQAA 4RY2A 3HD3A 3DF0A 2WBFX 1BGOA 1X9YA 1NLJA 1Q6KA 4HWYA 3O0UA 1YK7A 1PPPA 3H7DA 4AXMA 1A6RA 3RVVA 3V6EA 1FH0A 1STFE 4YYSA 4W4UA 4N8WA 2E00A 4FJCA 3KFQA 4QRXA 3P5XA 4FIPA 1MIRA 3QSDA 1QXPA 4YYWA 5A24A 5EF4A 1MEMA 5CVNB 4YYVA 1POPA 2NQIA 1QMYA 3IV2A 1GLOA 3GCBA 6PADA 1NQCA 3U8EA 3USVA 4BS6A 1ZIVA 1PCIA 3IMAA 4MSXA 2R9MA 2PADA 1ITOA 2NQDB 2CIOA 4PP2E 3S3QA 2B1MA 4MZOA 3AI8A 1M6DA 4QRVA 1U9XA 1AIMA 1QDQA 2YJ9A 4YYUA 3P5UA 3OVXA 2FRQA 4W5CA 5CHTA 1EWOA 5CVOB 2PREA 2YJ2A 1BQIA 1PE6A 2FTDA 1GECE 4P6EA 1Y08A 4CDEB 1AU0A 3H8CA 1U5IA 2AYNA 1EWLA 1THEA 1CS8A 4G54A 1TLOA 2AIMA 4XUIA 3C9EA 3PDFA 3IEJA 8PCHA 2XU1A 4Q8HA 1TU6A 4MZSA 1CV8A 2AUZA 5CHVA 4BSQA 1O0EA 4YV8A 3M99A 1YALA 1CSBB 2C0YA 2ACTA 4YVAA 3OF9A 3F75A 3BC3A 3PW3A 1F2AA 1PBHA 1KHQA 1ME3A 2DZYA 4AXLA 1NB3A 3RVWA 4BS5A 2DC9A 3NHEA 4N4ZA 1ME4A 1KHPA 2OULA 4PADA 2GFOA 2FO5A 3CBKA 1YT7A 1K3BB 3KSEA 3MHHA 4KLBA
chains in the Genus database with same CATH superfamily
2AVWA 2DOSA 1F2CA 4X6HA 2BDZA 5FPWA 4WA6A 1AYWA 3MTNA 7PCKA 2YJCA 2E02A 1ZCMA 3N4CA 3CH3X 4RF1A 1VSNA 2R9NA 1EWPA 2JQGR 2G8EA 2R6NA 4MM3B 1PPNA 3H8BA 1BY8A 1CPJA 4OEMA 3BCNA 2J7QC 2VHFA 2E03A 2XU5A 1AECA 5F02A 3BPFA 1U9QX 9PAPA 4X6JA 2DCDA 5J94A 3KX1A 2ARYA 2HHNA 2HXZA 4Q8GA 3TRKA 1KXRA 2R9FA 3I06A 3QT4A 1GMYA 1JQPA 2P86A 3H6SA 1KFXL 3F5VA 2G7YA 4OELA 2HH5A 2O6XA 5K16A 3K9MA 3B21A 1VJVA 3OVZA 2F7DA 1Y4HA 1YK8A 2DCCA 1PXVA 2OP3A 3IOQA 1U9VA 3D6SA 3O1GA 1CQDA 4CDDB 4OVZA 2OZ2A 2H7JA 4XR7A 4YYRA 2CB5A 2DC7A 2J7QA 3V6CA 3BB7A 4CZWA 4CDCB 4N79A 1DKIA 1ICFA 4A5UA 2DC6A 3WXEA 2AYOA 3IFUA 4BOSA 5CVMA 2P0RA 1CB5A 4DMYA 1NPZA 3RVXA 1U9WA 4BQVA 4QH6A 1AU4A 4QBBA 4W5BA 3K8UA 4ZUXU 3HWNA 4QRGA 1DF0A 2IPPB 3BPMA 2AGAA 3ZNHA 3CBJA 2FT2A 3B79A 4BPVA 2FRAA 2BTWA 1HUCB 4D8BA 5E6JA 4M0WA 2Y6EA 4K7CA 2GHUA 2Y5BA 3I3TA 4RKXA 5KO3A 3PNRA 1F29A 5EGWA 3TMPA 3PHXA 3WXGA 2F1GA 1AYUA 4I04A 3HHAA 2FE8A 1PPOA 1MS6A 1YVBA 4BOQA 3IHPA 1AU2A 3OISA 1NB5A 1ATKA 1PPDA 1KFUL 4PI3A 2YJBA 3ERVA 3BOWA 1MEGA 2G6DA 2R9CA 1MDWA 1SNKA 3O65A 2IBIA 2NQGA 3C0RA 1IWDA 3WXFA 3OF8A 4RF0A 1EF7A 3HHIA 2AU1A 5JH3A 1CVZA 5JA7A 2FQ9A 3LFYA 1CTEA 5JZEA 3P5VA 3E1ZB 2R9OA 2DCBA 4PP1A 3N3KA 4BOPA 3W31A 3KWBX 4BOZA 2Z84A 2PBHA 2VHSA 1NL6A 1MHWA 3MHSA 2DJGB 4PT5A 2BDLA 3PRMA 2ATOA 1DEUA 4CDFB 2AUXA 3MORA 2PNSA 3LXSA 3TNXA 3IUTA 2B1NA 4X6IA 1UKFA 2P7UA 2G8JA 1F2BA 4FK5A 3KW9A 3PBHA 2DZZA 3N3GA 1TL9A 1XKGA 2FYEA 4YYQA 4I07A 1AU3A 1CJLA 2BTWB 2FUDA 2DC8A 3KKUA 1BP4A 4REZA 3KWZA 4DMXA 1AYVA 2HD5A 3ZUAA 2DCAA 3P5WA 4I05A 3PHWA 1SP4B 4P6GA 3QJ3A 3BWKA 2JQFR 2E01A 2XU3A 3K24A 2YJ8A 1PIPA 3H89A 2XU4A 4WURA 1QOLA 1S4VA 3MTVA 3S3RA 3CH2X 1PADA 2DJFB 5PADA 1GCBA 1EWMA 4ZTBA 4MI7A 2AS8A 2NQAA 4RY2A 3HD3A 3DF0A 2WBFX 3MJ5A 1BGOA 1X9YA 1NLJA 1Q6KA 4HWYA 3O0UA 1YK7A 1PPPA 3H7DA 4AXMA 1A6RA 3W30A 2JRIA 3RVVA 3V6EA 1FH0A 1STFE 4YYSA 4W4UA 4RNAA 4N8WA 2E00A 3PRPA 4FJCA 3KFQA 4QRXA 3P5XA 4FIPA 1MIRA 3QSDA 1QXPA 4YYWA 5A24A 5EF4A 1MEMA 3RNVA 5EZQA 5CVNB 4YYVA 4IUMA 1POPA 2NQIA 1QMYA 3IV2A 1GLOA 4D8IA 3GCBA 6PADA 1NQCA 3U8EA 3USVA 4BS6A 4OVZB 1ZIVA 1PCIA 3IMAA 4MSXA 2R9MA 2PADA 1ITOA 4BOUA 3PSEA 2NQDB 2CIOA 4PP2E 3S3QA 2B1MA 4MZOA 3AI8A 1M6DA 4IP3A 4QRVA 1U9XA 4XZXA 4HXDB 1AIMA 1QDQA 2YJ9A 3PHUA 4YYUA 5EZSA 3P5UA 3OVXA 2FRQA 3PT2A 4W5CA 5CHTA 4GUAA 1EWOA 5CVOB 2PREA 2YJ2A 1PE6A 1BQIA 2UZJA 2FTDA 1GECE 4P6EA 1Y08A 4CDEB 1AU0A 3H8CA 1U5IA 2AYNA 1EWLA 1THEA 1CS8A 4G54A 1TLOA 2AIMA 4XUIA 2BU3A 3C9EA 3PDFA 3IEJA 8PCHA 2XU1A 3E9SA 4Q8HA 1TU6A 4MZSA 1PVJA 1CV8A 4P16A 4OW0A 2AUZA 5CHVA 4BSQA 2JTCA 1O0EA 4YV8A 3M99A 1YALA 3BBAA 1CSBB 4D8EA 2C0YA 2ACTA 3MP2A 4R3DA 4YVAA 3OF9A 3BY4A 3F75A 3BC3A 3PW3A 1F2AA 1PBHA 1KHQA 1ME3A 2DZYA 4AXLA 1NB3A 3RVWA 4BS5A 2DC9A 2HWKA 3NHEA 4N4ZA 1ME4A 1KHPA 2OULA 4PADA 2GFOA 2FO5A 3CBKA 1YT7A 1K3BB 3KSEA 3MHHA 1YZBA 4KLBA 3OQCA
chains in the Genus database with same CATH topology
2AVWA 1F2CA 4X6HA 2BDZA 5FPWA 4WA6A 1AYWA 3MTNA 7PCKA 2YJCA 2E02A 1ZCMA 3N4CA 3CH3X 1VSNA 2R9NA 1EWPA 2JQGR 2G8EA 2R6NA 1PPNA 3H8BA 1BY8A 1CPJA 4OEMA 3BCNA 2VHFA 2E03A 2XU5A 1AECA 5F02A 3BPFA 1U9QX 9PAPA 4X6JA 2DCDA 5J94A 3KX1A 2ARYA 2HHNA 2HXZA 1W5RA 4Q8GA 1KXRA 2R9FA 3I06A 3QT4A 1GMYA 1JQPA 2P86A 3H6SA 1KFXL 3F5VA 2G7YA 4OELA 2HH5A 2O6XA 5K16A 3K9MA 1VJVA 3OVZA 4C5PA 2F7DA 1Y4HA 1YK8A 2DCCA 1PXVA 2OP3A 3IOQA 1U9VA 3D6SA 3O1GA 1CQDA 4BGFA 4CDDB 2OZ2A 2H7JA 4XR7A 4YYRA 2CB5A 2DC7A 3V6CA 4CZWA 4NV8A 4N79A 4CDCB 1ICFA 2DC6A 3WXEA 2AYOA 5CVMA 2P0RA 1CB5A 4DMYA 1NPZA 3RVXA 2VFCA 1U9WA 4BQVA 4QH6A 1AU4A 4QBBA 4W5BA 3K8UA 4ZUXU 3HWNA 4QRGA 1DF0A 2IPPB 3BPMA 3CBJA 2FT2A 3B79A 4BPVA 2FRAA 1HUCB 2Y6EA 4K7CA 2GHUA 2Y5BA 3I3TA 3PNRA 1F29A 5EGWA 3WXGA 2F1GA 1AYUA 4I04A 3HHAA 1PPOA 1MS6A 1YVBA 3IHPA 1AU2A 3OISA 1NB5A 1ATKA 1PPDA 1KFUL 4PI3A 2YJBA 3ERVA 2VFBA 3BOWA 1MEGA 2G6DA 2R9CA 3D9WA 1MDWA 1SNKA 2IBIA 2NQGA 1IWDA 3WXFA 3OF8A 1EF7A 3HHIA 2AU1A 5JH3A 1CVZA 5JA7A 2FQ9A 3LFYA 1CTEA 3P5VA 1GX3A 3E1ZB 2R9OA 2DCBA 4PP1A 3N3KA 3KWBX 2BSZA 2PBHA 2VHSA 1NL6A 1MHWA 3MHSA 2DJGB 1W4TA 2BDLA 2ATOA 1DEUA 4CDFB 2AUXA 3MORA 2PNSA 3LXSA 3TNXA 3IUTA 2B1NA 4X6IA 2P7UA 2G8JA 1F2BA 4FK5A 3KW9A 3PBHA 2DZZA 3N3GA 1TL9A 4B55A 1XKGA 2FYEA 4YYQA 4I07A 1AU3A 4GUZA 1CJLA 2FUDA 2DC8A 3KKUA 1BP4A 3KWZA 4DMXA 1AYVA 2HD5A 3ZUAA 2DCAA 3P5WA 4I05A 1SP4B 4P6GA 3QJ3A 3BWKA 2JQFR 2E01A 2XU3A 3K24A 2YJ8A 1PIPA 3H89A 2XU4A 1QOLA 1S4VA 3S3RA 3CH2X 1PADA 2DJFB 5PADA 1GCBA 1EWMA 2AS8A 2NQAA 4RY2A 3HD3A 3DF0A 2WBFX 1BGOA 1X9YA 1NLJA 1Q6KA 4HWYA 3O0UA 1YK7A 1PPPA 3H7DA 4AXMA 1A6RA 3RVVA 3V6EA 1FH0A 1STFE 4YYSA 4W4UA 4N8WA 2E00A 4FJCA 3KFQA 4QRXA 3P5XA 4FIPA 1MIRA 3QSDA 1QXPA 4YYWA 5A24A 5EF4A 1MEMA 5CVNB 4YYVA 1POPA 2NQIA 1W6FA 1QMYA 3IV2A 1GLOA 3GCBA 6PADA 1NQCA 3U8EA 3USVA 4BS6A 1ZIVA 1PCIA 3IMAA 4MSXA 2R9MA 2PADA 1ITOA 2NQDB 2CIOA 4PP2E 3S3QA 2B1MA 4MZOA 3AI8A 1M6DA 4QRVA 1U9XA 1AIMA 1QDQA 2YJ9A 4YYUA 3P5UA 3OVXA 2FRQA 4W5CA 5CHTA 1EWOA 5CVOB 2PREA 2YJ2A 1BQIA 1PE6A 2FTDA 3LTWA 1GECE 4P6EA 1Y08A 4CDEB 1AU0A 3H8CA 1U5IA 2AYNA 1EWLA 1THEA 1CS8A 4G54A 1TLOA 2AIMA 1E2TA 4XUIA 3C9EA 3PDFA 3IEJA 8PCHA 2XU1A 4Q8HA 1TU6A 4MZSA 1CV8A 2AUZA 5CHVA 4BSQA 1O0EA 4YV8A 3M99A 1YALA 1CSBB 2C0YA 2ACTA 4YVAA 3OF9A 4NV7A 3F75A 3BC3A 3PW3A 1F2AA 1PBHA 1KHQA 1ME3A 2DZYA 4AXLA 1NB3A 3RVWA 4BS5A 2DC9A 3NHEA 4N4ZA 1ME4A 1KHPA 2OULA 4PADA 2GFOA 2FO5A 3CBKA 1YT7A 1K3BB 3KSEA 3MHHA 4KLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVW A;  1F2C A;  4X6H A;  2BDZ A;  5FPW A;  4WA6 A;  1AYW A;  3MTN A;  7PCK A;  2YJC A;  2E02 A;  1ZCM A;  3N4C A;  3CH3 X;  1VSN A;  2R9N A;  1EWP A;  2JQG R;  2G8E A;  2R6N A;  1PPN A;  3H8B A;  1BY8 A;  1CPJ A;  4OEM A;  3BCN A;  2VHF A;  2E03 A;  2XU5 A;  1AEC A;  5F02 A;  3BPF A;  1U9Q X;  9PAP A;  4X6J A;  2DCD A;  5J94 A;  3KX1 A;  2ARY A;  2HHN A;  2HXZ A;  4Q8G A;  1KXR A;  2R9F A;  3I06 A;  3QT4 A;  1GMY A;  1JQP A;  2P86 A;  3H6S A;  1KFX L;  3F5V A;  2G7Y A;  4OEL A;  2HH5 A;  2O6X A;  5K16 A;  3K9M A;  1VJV A;  3OVZ A;  2F7D A;  1Y4H A;  1YK8 A;  2DCC A;  1PXV A;  2OP3 A;  3IOQ A;  1U9V A;  3D6S A;  3O1G A;  1CQD A;  4CDD B;  2OZ2 A;  2H7J A;  4XR7 A;  4YYR A;  2CB5 A;  2DC7 A;  3V6C A;  4CZW A;  4CDC B;  4N79 A;  1ICF A;  2DC6 A;  3WXE A;  2AYO A;  5CVM A;  2P0R A;  1CB5 A;  4DMY A;  1NPZ A;  3RVX A;  1U9W A;  4BQV A;  4QH6 A;  1AU4 A;  4QBB A;  4W5B A;  3K8U A;  4ZUX U;  3HWN A;  4QRG A;  1DF0 A;  2IPP B;  3BPM A;  3CBJ A;  2FT2 A;  3B79 A;  4BPV A;  2FRA A;  1HUC B;  2Y6E A;  4K7C A;  2GHU A;  2Y5B A;  3I3T A;  3PNR A;  1F29 A;  5EGW A;  3WXG A;  2F1G A;  1AYU A;  4I04 A;  3HHA A;  1PPO A;  1MS6 A;  1YVB A;  3IHP A;  1AU2 A;  3OIS A;  1NB5 A;  1ATK A;  1PPD A;  1KFU L;  4PI3 A;  2YJB A;  3ERV A;  3BOW A;  1MEG A;  2G6D A;  2R9C A;  1MDW A;  1SNK A;  2IBI A;  2NQG A;  1IWD A;  3WXF A;  3OF8 A;  1EF7 A;  3HHI A;  2AU1 A;  5JH3 A;  1CVZ A;  5JA7 A;  2FQ9 A;  3LFY A;  1CTE A;  3P5V A;  3E1Z B;  2R9O A;  2DCB A;  4PP1 A;  3N3K A;  3KWB X;  2PBH A;  2VHS A;  1NL6 A;  1MHW A;  3MHS A;  2DJG B;  2BDL A;  2ATO A;  1DEU A;  4CDF B;  2AUX A;  3MOR A;  2PNS A;  3LXS A;  3TNX A;  3IUT A;  2B1N A;  4X6I A;  2P7U A;  2G8J A;  1F2B A;  4FK5 A;  3KW9 A;  3PBH A;  2DZZ A;  3N3G A;  1TL9 A;  1XKG A;  2FYE A;  4YYQ A;  4I07 A;  1AU3 A;  1CJL A;  2FUD A;  2DC8 A;  3KKU A;  1BP4 A;  3KWZ A;  4DMX A;  1AYV A;  2HD5 A;  3ZUA A;  2DCA A;  3P5W A;  4I05 A;  1SP4 B;  4P6G A;  3QJ3 A;  3BWK A;  2JQF R;  2E01 A;  2XU3 A;  3K24 A;  2YJ8 A;  1PIP A;  3H89 A;  2XU4 A;  1QOL A;  1S4V A;  3S3R A;  3CH2 X;  1PAD A;  2DJF B;  5PAD A;  1GCB A;  1EWM A;  2AS8 A;  2NQA A;  4RY2 A;  3HD3 A;  3DF0 A;  2WBF X;  1BGO A;  1X9Y A;  1NLJ A;  1Q6K A;  4HWY A;  3O0U A;  1YK7 A;  1PPP A;  3H7D A;  4AXM A;  1A6R A;  3RVV A;  3V6E A;  1FH0 A;  1STF E;  4YYS A;  4W4U A;  4N8W A;  2E00 A;  4FJC A;  3KFQ A;  4QRX A;  3P5X A;  4FIP A;  1MIR A;  3QSD A;  1QXP A;  4YYW A;  5A24 A;  5EF4 A;  1MEM A;  5CVN B;  4YYV A;  1POP A;  2NQI A;  1QMY A;  3IV2 A;  1GLO A;  3GCB A;  6PAD A;  1NQC A;  3U8E A;  3USV A;  4BS6 A;  1ZIV A;  1PCI A;  3IMA A;  4MSX A;  2R9M A;  2PAD A;  1ITO A;  2NQD B;  2CIO A;  4PP2 E;  3S3Q A;  2B1M A;  4MZO A;  3AI8 A;  1M6D A;  4QRV A;  1U9X A;  1AIM A;  1QDQ A;  2YJ9 A;  4YYU A;  3P5U A;  3OVX A;  2FRQ A;  4W5C A;  5CHT A;  1EWO A;  5CVO B;  2PRE A;  2YJ2 A;  1BQI A;  1PE6 A;  2FTD A;  1GEC E;  4P6E A;  1Y08 A;  4CDE B;  1AU0 A;  3H8C A;  1U5I A;  2AYN A;  1EWL A;  1THE A;  1CS8 A;  4G54 A;  1TLO A;  2AIM A;  4XUI A;  3C9E A;  3PDF A;  3IEJ A;  8PCH A;  2XU1 A;  4Q8H A;  1TU6 A;  4MZS A;  1CV8 A;  2AUZ A;  5CHV A;  4BSQ A;  1O0E A;  4YV8 A;  3M99 A;  1YAL A;  1CSB B;  2C0Y A;  2ACT A;  4YVA A;  3OF9 A;  3F75 A;  3BC3 A;  3PW3 A;  1F2A A;  1PBH A;  1KHQ A;  1ME3 A;  2DZY A;  4AXL A;  1NB3 A;  3RVW A;  4BS5 A;  2DC9 A;  3NHE A;  4N4Z A;  1ME4 A;  1KHP A;  2OUL A;  4PAD A;  2GFO A;  2FO5 A;  3CBK A;  1YT7 A;  1K3B B;  3KSE A;  3MHH A;  4KLB A; 
#chains in the Genus database with same CATH topology
 2AVW A;  2DOS A;  1F2C A;  4X6H A;  2BDZ A;  5FPW A;  4WA6 A;  1AYW A;  3MTN A;  7PCK A;  2YJC A;  2E02 A;  1ZCM A;  3N4C A;  3CH3 X;  4RF1 A;  1VSN A;  2R9N A;  1EWP A;  2JQG R;  2G8E A;  2R6N A;  4MM3 B;  1PPN A;  3H8B A;  1BY8 A;  1CPJ A;  4OEM A;  3BCN A;  2J7Q C;  2VHF A;  2E03 A;  2XU5 A;  1AEC A;  5F02 A;  3BPF A;  1U9Q X;  9PAP A;  4X6J A;  2DCD A;  5J94 A;  3KX1 A;  2ARY A;  2HHN A;  2HXZ A;  4Q8G A;  3TRK A;  1KXR A;  2R9F A;  3I06 A;  3QT4 A;  1GMY A;  1JQP A;  2P86 A;  3H6S A;  1KFX L;  3F5V A;  2G7Y A;  4OEL A;  2HH5 A;  2O6X A;  5K16 A;  3K9M A;  3B21 A;  1VJV A;  3OVZ A;  2F7D A;  1Y4H A;  1YK8 A;  2DCC A;  1PXV A;  2OP3 A;  3IOQ A;  1U9V A;  3D6S A;  3O1G A;  1CQD A;  4CDD B;  4OVZ A;  2OZ2 A;  2H7J A;  4XR7 A;  4YYR A;  2CB5 A;  2DC7 A;  2J7Q A;  3V6C A;  3BB7 A;  4CZW A;  4CDC B;  4N79 A;  1DKI A;  1ICF A;  4A5U A;  2DC6 A;  3WXE A;  2AYO A;  3IFU A;  4BOS A;  5CVM A;  2P0R A;  1CB5 A;  4DMY A;  1NPZ A;  3RVX A;  1U9W A;  4BQV A;  4QH6 A;  1AU4 A;  4QBB A;  4W5B A;  3K8U A;  4ZUX U;  3HWN A;  4QRG A;  1DF0 A;  2IPP B;  3BPM A;  2AGA A;  3ZNH A;  3CBJ A;  2FT2 A;  3B79 A;  4BPV A;  2FRA A;  2BTW A;  1HUC B;  4D8B A;  5E6J A;  4M0W A;  2Y6E A;  4K7C A;  2GHU A;  2Y5B A;  3I3T A;  4RKX A;  5KO3 A;  3PNR A;  1F29 A;  5EGW A;  3TMP A;  3PHX A;  3WXG A;  2F1G A;  1AYU A;  4I04 A;  3HHA A;  2FE8 A;  1PPO A;  1MS6 A;  1YVB A;  4BOQ A;  3IHP A;  1AU2 A;  3OIS A;  1NB5 A;  1ATK A;  1PPD A;  1KFU L;  4PI3 A;  2YJB A;  3ERV A;  3BOW A;  1MEG A;  2G6D A;  2R9C A;  1MDW A;  1SNK A;  3O65 A;  2IBI A;  2NQG A;  3C0R A;  1IWD A;  3WXF A;  3OF8 A;  4RF0 A;  1EF7 A;  3HHI A;  2AU1 A;  5JH3 A;  1CVZ A;  5JA7 A;  2FQ9 A;  3LFY A;  1CTE A;  5JZE A;  3P5V A;  3E1Z B;  2R9O A;  2DCB A;  4PP1 A;  3N3K A;  4BOP A;  3W31 A;  3KWB X;  4BOZ A;  2Z84 A;  2PBH A;  2VHS A;  1NL6 A;  1MHW A;  3MHS A;  2DJG B;  4PT5 A;  2BDL A;  3PRM A;  2ATO A;  1DEU A;  4CDF B;  2AUX A;  3MOR A;  2PNS A;  3LXS A;  3TNX A;  3IUT A;  2B1N A;  4X6I A;  1UKF A;  2P7U A;  2G8J A;  1F2B A;  4FK5 A;  3KW9 A;  3PBH A;  2DZZ A;  3N3G A;  1TL9 A;  1XKG A;  2FYE A;  4YYQ A;  4I07 A;  1AU3 A;  1CJL A;  2BTW B;  2FUD A;  2DC8 A;  3KKU A;  1BP4 A;  4REZ A;  3KWZ A;  4DMX A;  1AYV A;  2HD5 A;  3ZUA A;  2DCA A;  3P5W A;  4I05 A;  3PHW A;  1SP4 B;  4P6G A;  3QJ3 A;  3BWK A;  2JQF R;  2E01 A;  2XU3 A;  3K24 A;  2YJ8 A;  1PIP A;  3H89 A;  2XU4 A;  4WUR A;  1QOL A;  1S4V A;  3MTV A;  3S3R A;  3CH2 X;  1PAD A;  2DJF B;  5PAD A;  1GCB A;  1EWM A;  4ZTB A;  4MI7 A;  2AS8 A;  2NQA A;  4RY2 A;  3HD3 A;  3DF0 A;  2WBF X;  3MJ5 A;  1BGO A;  1X9Y A;  1NLJ A;  1Q6K A;  4HWY A;  3O0U A;  1YK7 A;  1PPP A;  3H7D A;  4AXM A;  1A6R A;  3W30 A;  2JRI A;  3RVV A;  3V6E A;  1FH0 A;  1STF E;  4YYS A;  4W4U A;  4RNA A;  4N8W A;  2E00 A;  3PRP A;  4FJC A;  3KFQ A;  4QRX A;  3P5X A;  4FIP A;  1MIR A;  3QSD A;  1QXP A;  4YYW A;  5A24 A;  5EF4 A;  1MEM A;  3RNV A;  5EZQ A;  5CVN B;  4YYV A;  4IUM A;  1POP A;  2NQI A;  1QMY A;  3IV2 A;  1GLO A;  4D8I A;  3GCB A;  6PAD A;  1NQC A;  3U8E A;  3USV A;  4BS6 A;  4OVZ B;  1ZIV A;  1PCI A;  3IMA A;  4MSX A;  2R9M A;  2PAD A;  1ITO A;  4BOU A;  3PSE A;  2NQD B;  2CIO A;  4PP2 E;  3S3Q A;  2B1M A;  4MZO A;  3AI8 A;  1M6D A;  4IP3 A;  4QRV A;  1U9X A;  4XZX A;  4HXD B;  1AIM A;  1QDQ A;  2YJ9 A;  3PHU A;  4YYU A;  5EZS A;  3P5U A;  3OVX A;  2FRQ A;  3PT2 A;  4W5C A;  5CHT A;  4GUA A;  1EWO A;  5CVO B;  2PRE A;  2YJ2 A;  1PE6 A;  1BQI A;  2UZJ A;  2FTD A;  1GEC E;  4P6E A;  1Y08 A;  4CDE B;  1AU0 A;  3H8C A;  1U5I A;  2AYN A;  1EWL A;  1THE A;  1CS8 A;  4G54 A;  1TLO A;  2AIM A;  4XUI A;  2BU3 A;  3C9E A;  3PDF A;  3IEJ A;  8PCH A;  2XU1 A;  3E9S A;  4Q8H A;  1TU6 A;  4MZS A;  1PVJ A;  1CV8 A;  4P16 A;  4OW0 A;  2AUZ A;  5CHV A;  4BSQ A;  2JTC A;  1O0E A;  4YV8 A;  3M99 A;  1YAL A;  3BBA A;  1CSB B;  4D8E A;  2C0Y A;  2ACT A;  3MP2 A;  4R3D A;  4YVA A;  3OF9 A;  3BY4 A;  3F75 A;  3BC3 A;  3PW3 A;  1F2A A;  1PBH A;  1KHQ A;  1ME3 A;  2DZY A;  4AXL A;  1NB3 A;  3RVW A;  4BS5 A;  2DC9 A;  2HWK A;  3NHE A;  4N4Z A;  1ME4 A;  1KHP A;  2OUL A;  4PAD A;  2GFO A;  2FO5 A;  3CBK A;  1YT7 A;  1K3B B;  3KSE A;  3MHH A;  1YZB A;  4KLB A;  3OQC A; 
#chains in the Genus database with same CATH homology
 2AVW A;  1F2C A;  4X6H A;  2BDZ A;  5FPW A;  4WA6 A;  1AYW A;  3MTN A;  7PCK A;  2YJC A;  2E02 A;  1ZCM A;  3N4C A;  3CH3 X;  1VSN A;  2R9N A;  1EWP A;  2JQG R;  2G8E A;  2R6N A;  1PPN A;  3H8B A;  1BY8 A;  1CPJ A;  4OEM A;  3BCN A;  2VHF A;  2E03 A;  2XU5 A;  1AEC A;  5F02 A;  3BPF A;  1U9Q X;  9PAP A;  4X6J A;  2DCD A;  5J94 A;  3KX1 A;  2ARY A;  2HHN A;  2HXZ A;  1W5R A;  4Q8G A;  1KXR A;  2R9F A;  3I06 A;  3QT4 A;  1GMY A;  1JQP A;  2P86 A;  3H6S A;  1KFX L;  3F5V A;  2G7Y A;  4OEL A;  2HH5 A;  2O6X A;  5K16 A;  3K9M A;  1VJV A;  3OVZ A;  4C5P A;  2F7D A;  1Y4H A;  1YK8 A;  2DCC A;  1PXV A;  2OP3 A;  3IOQ A;  1U9V A;  3D6S A;  3O1G A;  1CQD A;  4BGF A;  4CDD B;  2OZ2 A;  2H7J A;  4XR7 A;  4YYR A;  2CB5 A;  2DC7 A;  3V6C A;  4CZW A;  4NV8 A;  4N79 A;  4CDC B;  1ICF A;  2DC6 A;  3WXE A;  2AYO A;  5CVM A;  2P0R A;  1CB5 A;  4DMY A;  1NPZ A;  3RVX A;  2VFC A;  1U9W A;  4BQV A;  4QH6 A;  1AU4 A;  4QBB A;  4W5B A;  3K8U A;  4ZUX U;  3HWN A;  4QRG A;  1DF0 A;  2IPP B;  3BPM A;  3CBJ A;  2FT2 A;  3B79 A;  4BPV A;  2FRA A;  1HUC B;  2Y6E A;  4K7C A;  2GHU A;  2Y5B A;  3I3T A;  3PNR A;  1F29 A;  5EGW A;  3WXG A;  2F1G A;  1AYU A;  4I04 A;  3HHA A;  1PPO A;  1MS6 A;  1YVB A;  3IHP A;  1AU2 A;  3OIS A;  1NB5 A;  1ATK A;  1PPD A;  1KFU L;  4PI3 A;  2YJB A;  3ERV A;  2VFB A;  3BOW A;  1MEG A;  2G6D A;  2R9C A;  3D9W A;  1MDW A;  1SNK A;  2IBI A;  2NQG A;  1IWD A;  3WXF A;  3OF8 A;  1EF7 A;  3HHI A;  2AU1 A;  5JH3 A;  1CVZ A;  5JA7 A;  2FQ9 A;  3LFY A;  1CTE A;  3P5V A;  1GX3 A;  3E1Z B;  2R9O A;  2DCB A;  4PP1 A;  3N3K A;  3KWB X;  2BSZ A;  2PBH A;  2VHS A;  1NL6 A;  1MHW A;  3MHS A;  2DJG B;  1W4T A;  2BDL A;  2ATO A;  1DEU A;  4CDF B;  2AUX A;  3MOR A;  2PNS A;  3LXS A;  3TNX A;  3IUT A;  2B1N A;  4X6I A;  2P7U A;  2G8J A;  1F2B A;  4FK5 A;  3KW9 A;  3PBH A;  2DZZ A;  3N3G A;  1TL9 A;  4B55 A;  1XKG A;  2FYE A;  4YYQ A;  4I07 A;  1AU3 A;  4GUZ A;  1CJL A;  2FUD A;  2DC8 A;  3KKU A;  1BP4 A;  3KWZ A;  4DMX A;  1AYV A;  2HD5 A;  3ZUA A;  2DCA A;  3P5W A;  4I05 A;  1SP4 B;  4P6G A;  3QJ3 A;  3BWK A;  2JQF R;  2E01 A;  2XU3 A;  3K24 A;  2YJ8 A;  1PIP A;  3H89 A;  2XU4 A;  1QOL A;  1S4V A;  3S3R A;  3CH2 X;  1PAD A;  2DJF B;  5PAD A;  1GCB A;  1EWM A;  2AS8 A;  2NQA A;  4RY2 A;  3HD3 A;  3DF0 A;  2WBF X;  1BGO A;  1X9Y A;  1NLJ A;  1Q6K A;  4HWY A;  3O0U A;  1YK7 A;  1PPP A;  3H7D A;  4AXM A;  1A6R A;  3RVV A;  3V6E A;  1FH0 A;  1STF E;  4YYS A;  4W4U A;  4N8W A;  2E00 A;  4FJC A;  3KFQ A;  4QRX A;  3P5X A;  4FIP A;  1MIR A;  3QSD A;  1QXP A;  4YYW A;  5A24 A;  5EF4 A;  1MEM A;  5CVN B;  4YYV A;  1POP A;  2NQI A;  1W6F A;  1QMY A;  3IV2 A;  1GLO A;  3GCB A;  6PAD A;  1NQC A;  3U8E A;  3USV A;  4BS6 A;  1ZIV A;  1PCI A;  3IMA A;  4MSX A;  2R9M A;  2PAD A;  1ITO A;  2NQD B;  2CIO A;  4PP2 E;  3S3Q A;  2B1M A;  4MZO A;  3AI8 A;  1M6D A;  4QRV A;  1U9X A;  1AIM A;  1QDQ A;  2YJ9 A;  4YYU A;  3P5U A;  3OVX A;  2FRQ A;  4W5C A;  5CHT A;  1EWO A;  5CVO B;  2PRE A;  2YJ2 A;  1BQI A;  1PE6 A;  2FTD A;  3LTW A;  1GEC E;  4P6E A;  1Y08 A;  4CDE B;  1AU0 A;  3H8C A;  1U5I A;  2AYN A;  1EWL A;  1THE A;  1CS8 A;  4G54 A;  1TLO A;  2AIM A;  1E2T A;  4XUI A;  3C9E A;  3PDF A;  3IEJ A;  8PCH A;  2XU1 A;  4Q8H A;  1TU6 A;  4MZS A;  1CV8 A;  2AUZ A;  5CHV A;  4BSQ A;  1O0E A;  4YV8 A;  3M99 A;  1YAL A;  1CSB B;  2C0Y A;  2ACT A;  4YVA A;  3OF9 A;  4NV7 A;  3F75 A;  3BC3 A;  3PW3 A;  1F2A A;  1PBH A;  1KHQ A;  1ME3 A;  2DZY A;  4AXL A;  1NB3 A;  3RVW A;  4BS5 A;  2DC9 A;  3NHE A;  4N4Z A;  1ME4 A;  1KHP A;  2OUL A;  4PAD A;  2GFO A;  2FO5 A;  3CBK A;  1YT7 A;  1K3B B;  3KSE A;  3MHH A;  4KLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...