4Q8GA

Structure of the saccharomyces cerevisiae pan2 pseudoubiquitin-hydrolase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
403
structure length
344
Chain Sequence
TSDIQTYTSINKYEVPPAYSRLPLTFDFTPFNNTEYSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDTTLLTDLGYLFDMMERSHGKICSSSNFQASLKSLTSIKRNMPQKFNRFLLSQLIKEEAQTVNHNITLNQCFGLETEIRTECSCDHYDTTVKLLPSLSISGINQNILPYIEYAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLDTEFSNIRSSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNNNETRLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEELRKPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PAB-dependent poly(A)-specific ribonuclease subunit PAN2
publication title The structure of the Pan2-Pan3 core complex reveals cross-talk between deadenylase and pseudokinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 98
structure length 344
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4q8gA00
2R9NA 2P86A 5CHTA 2JQFR 3N4CA 4RY2A 1TL9A 1CPJA 3LFYA 5K16A 3MTNA 4Q8HA 1DEUA 1CB5A 1BP4A 1GECE 3KFQA 1BQIA 1JQPA 4KLBA 2G6DA 4YYVA 1AU2A 3HD3A 4P6EA 5J94A 3I06A 2ATOA 1PXVA 8PCHA 2G8EA 4W5CA 2AU1A 4DMXA 1NPZA 3CBKA 4N4ZA 1CS8A 1Q6KA 3TNXA 5CVNB 1TLOA 3KWZA 4G54A 5JA7A 4PI3A 4CDEB 3C9EA 2DJFB 1M6DA 3NHEA 3HHIA 4YYQA 1PE6A 3E1ZB 3OF8A 4YYWA 2DC7A 2FYEA 4AXMA 2DJGB 4PP2E 1GCBA 2DCAA 3BWKA 2B1NA 2E02A 1EF7A 3P5WA 4BPVA 3O1GA 1O0EA 3B79A 2PREA 3OVXA 3CH2X 3BOWA 5CVMA 3D6SA 1NQCA 2AYNA 6PADA 1F2AA 4I05A 2FUDA 1YK8A 1MIRA 2PADA 3PNRA 2P0RA 2DC8A 4QBBA 1F29A 4PP1A 3WXEA 4CDFB 3F75A 1EWMA 3IUTA 4W5BA 1U9XA 1QMYA 3QSDA 1MHWA 2DZYA 2R9OA 1F2BA 4MZSA 3ZUAA 4I07A 4N8WA 1CQDA 1BY8A 4QRGA 3RVVA 2PBHA 4CDDB 3MHSA 4QH6A 1YK7A 2Y5BA 3P5XA 3H6SA 4YV8A 2YJ9A 4AXLA 3IEJA 1MDWA 1SP4B 1NLJA 4FK5A 2E03A 4PADA 4X6HA 3PDFA 5EGWA 2Y6EA 1ZCMA 2C0YA 2PNSA 3V6EA 1GLOA 4MZOA 1NL6A 2XU4A 3IMAA 1AU0A 5EF4A 1ZIVA 3RVXA 3WXGA 2G8JA 2AVWA 2FRQA 4OEMA 2DZZA 1U9WA 3F5VA 1PPNA 2NQIA 1EWOA 3IOQA 2P7UA 1AU3A 2BDLA 5CVOB 4XUIA 2F1GA 3QJ3A 1TU6A 2B1MA 3HWNA 1PADA 3I3TA 2XU3A 2YJ8A 3KKUA 1PBHA 3MORA 1PCIA 3S3RA 1U5IA 2R6NA 1NB5A 1U9VA 4HWYA 3RVWA 2DC9A 1F2CA 4WA6A 2AIMA 2GFOA 2OP3A 2OZ2A 2AS8A 3GCBA 1CJLA 4BSQA 4YVAA 3AI8A 3K9MA 4Q8GA 3N3KA 2OULA 4QRXA 1QDQA 3H8CA 4BS5A 1XKGA 2G7YA 1EWLA 3K24A 2AUZA 2XU1A 2FO5A 3QT4A 1U9QX 1VJVA 2H7JA 1VSNA 3LXSA 3OISA 4ZUXU 3IHPA 3CH3X 1SNKA 2DCDA 2YJ2A 2CB5A 3H89A 1AYVA 1POPA 1KHQA 3V6CA 1YT7A 5PADA 1CSBB 4FIPA 4FJCA 2R9MA 3WXFA 2FQ9A 2ACTA 2AUXA 1ITOA 1EWPA 4K7CA 4YYSA 1KFXL 2HXZA 1Y08A 5A24A 3OF9A 1MEGA 4MSXA 2XU5A 2CIOA 3K8UA 1AIMA 2YJCA 1PPOA 3KW9A 4XR7A 1THEA 2DCBA 1HUCB 3BPFA 2R9FA 1GMYA 2HHNA 3KX1A 3N3GA 3O0UA 1BGOA 4I04A 1NB3A 1MEMA 3DF0A 1MS6A 4CDCB 1Y4HA 1YVBA 2VHFA 4CZWA 3BPMA 1IWDA 1DF0A 1AU4A 2HD5A 2O6XA 1CVZA 2E00A 1FH0A 5CHVA 4X6IA 3OVZA 3U8EA 2HH5A 2R9CA 3BCNA 4X6JA 3H7DA 4P6GA 1KHPA 1PPDA 3H8BA 2FT2A 2WBFX 5F02A 3KWBX 1AYUA 2FTDA 3PBHA 4QRVA 3S3QA 1QOLA 1KXRA 7PCKA 3P5VA 2VHSA 2GHUA 3KSEA 2YJBA 5FPWA 2F7DA 1CV8A 1QXPA 2JQGR 2IBIA 1ME4A 3HHAA 4W4UA 4YYRA 4DMYA 3BC3A 3CBJA 1AECA 2NQDB 3USVA 1ICFA 1ME3A 2DCCA 1STFE 9PAPA 1YALA 1S4VA 1PIPA 1X9YA 3P5UA 3MHHA 1CTEA 2E01A 3PW3A 2NQGA 3IV2A 5JH3A 1KFUL 2ARYA 2FRAA 4N79A 1PPPA 2BDZA 1A6RA 4OELA 1AYWA 1ATKA 2NQAA 1K3BB 2AYOA 4YYUA 4BS6A 2IPPB 2DC6A 3ERVA 4BQVA 3M99A
chains in the Genus database with same CATH superfamily
2R9NA 2P86A 5CHTA 2JQFR 3N4CA 4RF0A 4RY2A 1TL9A 4BOUA 1CPJA 3LFYA 5K16A 3MTNA 2J7QC 4Q8HA 3PHUA 1DEUA 1CB5A 1BP4A 1GECE 3KFQA 5E6JA 2Z84A 1BQIA 1JQPA 4KLBA 2G6DA 2BTWA 4YYVA 1AU2A 3HD3A 4P6EA 5J94A 5EZQA 2UZJA 3I06A 3BY4A 2ATOA 1PXVA 8PCHA 2G8EA 4W5CA 2AU1A 4DMXA 1NPZA 3IFUA 3CBKA 4N4ZA 4A5UA 1CS8A 1Q6KA 4BOSA 3TNXA 5CVNB 1TLOA 3KWZA 4G54A 5JA7A 4PI3A 4CDEB 3BBAA 3C9EA 2DJFB 1M6DA 3NHEA 3HHIA 4YYQA 1PE6A 3E1ZB 3OF8A 4YYWA 2DC7A 2FYEA 4AXMA 1YZBA 2DJGB 4PP2E 1GCBA 2DCAA 3BWKA 3OQCA 2B1NA 2E02A 1EF7A 3P5WA 4BPVA 3O1GA 1O0EA 3B79A 2PREA 3OVXA 3CH2X 3BOWA 5CVMA 3D6SA 1NQCA 2AYNA 6PADA 1F2AA 4I05A 4BOPA 3BB7A 2FUDA 1YK8A 1MIRA 2PADA 3PNRA 2P0RA 2DC8A 4QBBA 1F29A 4PP1A 3WXEA 4CDFB 3F75A 1EWMA 3IUTA 4M0WA 4W5BA 1U9XA 1QMYA 3QSDA 3MTVA 1MHWA 2DZYA 2R9OA 1F2BA 4MZSA 3ZUAA 4I07A 4N8WA 1CQDA 4HXDB 1BY8A 4QRGA 3RVVA 2PBHA 4CDDB 3MHSA 4QH6A 3E9SA 4XZXA 1YK7A 2Y5BA 3P5XA 3H6SA 4YV8A 1DKIA 2YJ9A 4AXLA 3IEJA 1MDWA 1SP4B 1NLJA 4FK5A 2E03A 1UKFA 4PADA 4X6HA 3PDFA 5EGWA 3W31A 2Y6EA 1ZCMA 2C0YA 2PNSA 3V6EA 1GLOA 4MZOA 1NL6A 2XU4A 4R3DA 3IMAA 1AU0A 5EF4A 1ZIVA 3RVXA 3WXGA 4PT5A 2G8JA 2AVWA 2FRQA 4OEMA 4D8IA 2DZZA 3TMPA 1U9WA 3F5VA 3B21A 1PPNA 2NQIA 4MM3B 1EWOA 3IOQA 2P7UA 1AU3A 2BDLA 5CVOB 3TRKA 3MP2A 4XUIA 2F1GA 3QJ3A 1TU6A 2B1MA 3HWNA 1PADA 3I3TA 2XU3A 2YJ8A 3KKUA 1PBHA 3MORA 1PCIA 4WURA 3S3RA 1U5IA 2R6NA 1NB5A 1U9VA 4HWYA 3RVWA 2DC9A 2BU3A 1F2CA 4WA6A 4D8EA 2AIMA 4REZA 2GFOA 2OP3A 2OZ2A 4MI7A 2AS8A 3GCBA 1CJLA 4BSQA 4YVAA 3AI8A 3O65A 3K9MA 4Q8GA 3N3KA 2OULA 4QRXA 3PRPA 4D8BA 3C0RA 1QDQA 3H8CA 4BS5A 1XKGA 2G7YA 1EWLA 3K24A 2AUZA 4ZTBA 2XU1A 2FO5A 3QT4A 1U9QX 1VJVA 2H7JA 4BOQA 1VSNA 3LXSA 5JZEA 3OISA 4ZUXU 3IHPA 3CH3X 1SNKA 2DCDA 2YJ2A 3ZNHA 2CB5A 5EZSA 3H89A 1AYVA 1POPA 1KHQA 3V6CA 1YT7A 5PADA 1CSBB 2AGAA 4FIPA 4FJCA 2R9MA 3WXFA 2FQ9A 2ACTA 2JTCA 2AUXA 1ITOA 1EWPA 4K7CA 4YYSA 1KFXL 2HXZA 1Y08A 5A24A 3OF9A 1PVJA 1MEGA 4MSXA 2XU5A 2CIOA 3K8UA 1AIMA 2YJCA 1PPOA 3KW9A 4XR7A 2BTWB 4RF1A 1THEA 2DCBA 1HUCB 3PSEA 3BPFA 2R9FA 1GMYA 2HHNA 3KX1A 4OW0A 3N3GA 3O0UA 1BGOA 4I04A 1NB3A 1MEMA 3DF0A 1MS6A 4CDCB 4BOZA 1Y4HA 1YVBA 2VHFA 2FE8A 4CZWA 3BPMA 1IWDA 1DF0A 3RNVA 1AU4A 2HD5A 2O6XA 1CVZA 2E00A 3PHWA 1FH0A 5CHVA 2HWKA 4X6IA 3OVZA 4IUMA 3U8EA 2HH5A 2R9CA 3BCNA 4X6JA 3H7DA 3PHXA 4P6GA 1KHPA 2DOSA 1PPDA 3H8BA 2FT2A 2WBFX 5F02A 3MJ5A 3KWBX 1AYUA 4OVZB 2JRIA 2FTDA 3PBHA 4QRVA 3S3QA 1QOLA 1KXRA 7PCKA 3P5VA 2VHSA 2GHUA 3KSEA 2YJBA 4RKXA 5FPWA 2F7DA 1CV8A 1QXPA 4GUAA 2JQGR 4OVZA 2IBIA 1ME4A 3W30A 3HHAA 2J7QA 5KO3A 4W4UA 3PRMA 4YYRA 4DMYA 3BC3A 3PT2A 3CBJA 1AECA 2NQDB 3USVA 1ICFA 1ME3A 2DCCA 1STFE 9PAPA 1YALA 1S4VA 1PIPA 1X9YA 4RNAA 3P5UA 3MHHA 1CTEA 2E01A 3PW3A 2NQGA 3IV2A 4IP3A 5JH3A 1KFUL 2ARYA 2FRAA 4N79A 1PPPA 2BDZA 1A6RA 4OELA 1AYWA 1ATKA 2NQAA 4P16A 1K3BB 2AYOA 4YYUA 4BS6A 2IPPB 2DC6A 3ERVA 4BQVA 3M99A
chains in the Genus database with same CATH topology
2R9NA 2P86A 5CHTA 2JQFR 3N4CA 4RY2A 1TL9A 1CPJA 1GX3A 3LFYA 5K16A 3MTNA 4GUZA 4Q8HA 1DEUA 1CB5A 1BP4A 1GECE 3KFQA 1BQIA 1JQPA 2VFBA 2G6DA 4KLBA 4YYVA 1AU2A 3HD3A 4P6EA 5J94A 3I06A 2ATOA 1PXVA 8PCHA 2G8EA 4W5CA 2AU1A 4DMXA 1NPZA 3CBKA 4N4ZA 1CS8A 1Q6KA 3TNXA 5CVNB 1TLOA 3KWZA 4G54A 5JA7A 4PI3A 4CDEB 3C9EA 2DJFB 1M6DA 3NHEA 3HHIA 4YYQA 1PE6A 3E1ZB 3OF8A 4YYWA 2DC7A 2FYEA 4AXMA 2DJGB 4PP2E 1GCBA 2DCAA 3BWKA 2B1NA 1W5RA 2E02A 1EF7A 3P5WA 4BPVA 3O1GA 1O0EA 3B79A 2PREA 3OVXA 3CH2X 3BOWA 5CVMA 3D6SA 1NQCA 2AYNA 6PADA 1F2AA 4I05A 2FUDA 1YK8A 2VFCA 1MIRA 2PADA 3PNRA 2P0RA 2DC8A 4QBBA 1F29A 4PP1A 3WXEA 4NV8A 4CDFB 3F75A 1EWMA 4BGFA 3IUTA 4W5BA 1U9XA 1QMYA 3QSDA 1MHWA 2DZYA 1W4TA 2R9OA 1F2BA 4MZSA 3ZUAA 4I07A 4N8WA 1CQDA 1BY8A 4QRGA 3RVVA 2PBHA 4CDDB 3MHSA 4QH6A 1YK7A 2Y5BA 3P5XA 3H6SA 4YV8A 2YJ9A 4AXLA 3IEJA 1MDWA 1SP4B 1NLJA 4FK5A 2E03A 4PADA 4X6HA 4B55A 3PDFA 5EGWA 2Y6EA 1ZCMA 2C0YA 2PNSA 3V6EA 1GLOA 4MZOA 1NL6A 2XU4A 3IMAA 1AU0A 5EF4A 1ZIVA 3RVXA 3WXGA 2G8JA 2AVWA 2FRQA 4OEMA 2DZZA 1U9WA 3F5VA 1PPNA 2NQIA 4C5PA 1EWOA 3IOQA 2P7UA 1AU3A 2BDLA 5CVOB 4XUIA 2F1GA 3QJ3A 1TU6A 2B1MA 3HWNA 1PADA 3I3TA 2XU3A 2YJ8A 3KKUA 1PBHA 3MORA 1PCIA 3S3RA 1U5IA 2R6NA 1NB5A 1U9VA 4HWYA 3RVWA 2DC9A 1F2CA 4WA6A 2AIMA 2GFOA 2OP3A 2OZ2A 2AS8A 3GCBA 1CJLA 4BSQA 4YVAA 3AI8A 3K9MA 4Q8GA 3N3KA 2OULA 4QRXA 1QDQA 3H8CA 4BS5A 1XKGA 2G7YA 1EWLA 3K24A 2AUZA 2XU1A 2FO5A 3QT4A 1U9QX 1VJVA 2H7JA 1VSNA 3LXSA 3OISA 4ZUXU 3IHPA 3CH3X 1SNKA 2DCDA 2YJ2A 2CB5A 3H89A 1AYVA 1POPA 1KHQA 3V6CA 1E2TA 1YT7A 5PADA 1W6FA 1CSBB 4FIPA 4FJCA 2R9MA 3WXFA 2FQ9A 2ACTA 2AUXA 1ITOA 1EWPA 4K7CA 4YYSA 1KFXL 2HXZA 1Y08A 5A24A 3OF9A 1MEGA 4MSXA 2XU5A 2CIOA 3K8UA 1AIMA 2YJCA 1PPOA 3KW9A 4XR7A 1THEA 2DCBA 1HUCB 3BPFA 2R9FA 1GMYA 2HHNA 3KX1A 3N3GA 3O0UA 1BGOA 4I04A 1NB3A 1MEMA 3DF0A 1MS6A 4CDCB 1Y4HA 1YVBA 2VHFA 4CZWA 3BPMA 1IWDA 1DF0A 1AU4A 2HD5A 2O6XA 1CVZA 2E00A 1FH0A 5CHVA 4X6IA 3OVZA 2BSZA 3U8EA 2HH5A 2R9CA 3BCNA 4NV7A 4X6JA 3H7DA 4P6GA 1KHPA 1PPDA 3H8BA 2FT2A 2WBFX 5F02A 3D9WA 3KWBX 1AYUA 2FTDA 3PBHA 4QRVA 3S3QA 1QOLA 1KXRA 7PCKA 3P5VA 2VHSA 2GHUA 3KSEA 2YJBA 5FPWA 2F7DA 1CV8A 1QXPA 2JQGR 2IBIA 1ME4A 3HHAA 4W4UA 4YYRA 4DMYA 3BC3A 3CBJA 1AECA 2NQDB 3USVA 1ICFA 3LTWA 1ME3A 2DCCA 1STFE 9PAPA 1YALA 1S4VA 1PIPA 1X9YA 3P5UA 3MHHA 1CTEA 2E01A 3PW3A 2NQGA 3IV2A 5JH3A 1KFUL 2ARYA 2FRAA 4N79A 1PPPA 2BDZA 1A6RA 4OELA 1AYWA 1ATKA 2NQAA 1K3BB 2AYOA 4YYUA 4BS6A 2IPPB 2DC6A 3ERVA 4BQVA 3M99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9N A;  2P86 A;  5CHT A;  2JQF R;  3N4C A;  4RY2 A;  1TL9 A;  1CPJ A;  3LFY A;  5K16 A;  3MTN A;  4Q8H A;  1DEU A;  1CB5 A;  1BP4 A;  1GEC E;  3KFQ A;  1BQI A;  1JQP A;  4KLB A;  2G6D A;  4YYV A;  1AU2 A;  3HD3 A;  4P6E A;  5J94 A;  3I06 A;  2ATO A;  1PXV A;  8PCH A;  2G8E A;  4W5C A;  2AU1 A;  4DMX A;  1NPZ A;  3CBK A;  4N4Z A;  1CS8 A;  1Q6K A;  3TNX A;  5CVN B;  1TLO A;  3KWZ A;  4G54 A;  5JA7 A;  4PI3 A;  4CDE B;  3C9E A;  2DJF B;  1M6D A;  3NHE A;  3HHI A;  4YYQ A;  1PE6 A;  3E1Z B;  3OF8 A;  4YYW A;  2DC7 A;  2FYE A;  4AXM A;  2DJG B;  4PP2 E;  1GCB A;  2DCA A;  3BWK A;  2B1N A;  2E02 A;  1EF7 A;  3P5W A;  4BPV A;  3O1G A;  1O0E A;  3B79 A;  2PRE A;  3OVX A;  3CH2 X;  3BOW A;  5CVM A;  3D6S A;  1NQC A;  2AYN A;  6PAD A;  1F2A A;  4I05 A;  2FUD A;  1YK8 A;  1MIR A;  2PAD A;  3PNR A;  2P0R A;  2DC8 A;  4QBB A;  1F29 A;  4PP1 A;  3WXE A;  4CDF B;  3F75 A;  1EWM A;  3IUT A;  4W5B A;  1U9X A;  1QMY A;  3QSD A;  1MHW A;  2DZY A;  2R9O A;  1F2B A;  4MZS A;  3ZUA A;  4I07 A;  4N8W A;  1CQD A;  1BY8 A;  4QRG A;  3RVV A;  2PBH A;  4CDD B;  3MHS A;  4QH6 A;  1YK7 A;  2Y5B A;  3P5X A;  3H6S A;  4YV8 A;  2YJ9 A;  4AXL A;  3IEJ A;  1MDW A;  1SP4 B;  1NLJ A;  4FK5 A;  2E03 A;  4PAD A;  4X6H A;  3PDF A;  5EGW A;  2Y6E A;  1ZCM A;  2C0Y A;  2PNS A;  3V6E A;  1GLO A;  4MZO A;  1NL6 A;  2XU4 A;  3IMA A;  1AU0 A;  5EF4 A;  1ZIV A;  3RVX A;  3WXG A;  2G8J A;  2AVW A;  2FRQ A;  4OEM A;  2DZZ A;  1U9W A;  3F5V A;  1PPN A;  2NQI A;  1EWO A;  3IOQ A;  2P7U A;  1AU3 A;  2BDL A;  5CVO B;  4XUI A;  2F1G A;  3QJ3 A;  1TU6 A;  2B1M A;  3HWN A;  1PAD A;  3I3T A;  2XU3 A;  2YJ8 A;  3KKU A;  1PBH A;  3MOR A;  1PCI A;  3S3R A;  1U5I A;  2R6N A;  1NB5 A;  1U9V A;  4HWY A;  3RVW A;  2DC9 A;  1F2C A;  4WA6 A;  2AIM A;  2GFO A;  2OP3 A;  2OZ2 A;  2AS8 A;  3GCB A;  1CJL A;  4BSQ A;  4YVA A;  3AI8 A;  3K9M A;  4Q8G A;  3N3K A;  2OUL A;  4QRX A;  1QDQ A;  3H8C A;  4BS5 A;  1XKG A;  2G7Y A;  1EWL A;  3K24 A;  2AUZ A;  2XU1 A;  2FO5 A;  3QT4 A;  1U9Q X;  1VJV A;  2H7J A;  1VSN A;  3LXS A;  3OIS A;  4ZUX U;  3IHP A;  3CH3 X;  1SNK A;  2DCD A;  2YJ2 A;  2CB5 A;  3H89 A;  1AYV A;  1POP A;  1KHQ A;  3V6C A;  1YT7 A;  5PAD A;  1CSB B;  4FIP A;  4FJC A;  2R9M A;  3WXF A;  2FQ9 A;  2ACT A;  2AUX A;  1ITO A;  1EWP A;  4K7C A;  4YYS A;  1KFX L;  2HXZ A;  1Y08 A;  5A24 A;  3OF9 A;  1MEG A;  4MSX A;  2XU5 A;  2CIO A;  3K8U A;  1AIM A;  2YJC A;  1PPO A;  3KW9 A;  4XR7 A;  1THE A;  2DCB A;  1HUC B;  3BPF A;  2R9F A;  1GMY A;  2HHN A;  3KX1 A;  3N3G A;  3O0U A;  1BGO A;  4I04 A;  1NB3 A;  1MEM A;  3DF0 A;  1MS6 A;  4CDC B;  1Y4H A;  1YVB A;  2VHF A;  4CZW A;  3BPM A;  1IWD A;  1DF0 A;  1AU4 A;  2HD5 A;  2O6X A;  1CVZ A;  2E00 A;  1FH0 A;  5CHV A;  4X6I A;  3OVZ A;  3U8E A;  2HH5 A;  2R9C A;  3BCN A;  4X6J A;  3H7D A;  4P6G A;  1KHP A;  1PPD A;  3H8B A;  2FT2 A;  2WBF X;  5F02 A;  3KWB X;  1AYU A;  2FTD A;  3PBH A;  4QRV A;  3S3Q A;  1QOL A;  1KXR A;  7PCK A;  3P5V A;  2VHS A;  2GHU A;  3KSE A;  2YJB A;  5FPW A;  2F7D A;  1CV8 A;  1QXP A;  2JQG R;  2IBI A;  1ME4 A;  3HHA A;  4W4U A;  4YYR A;  4DMY A;  3BC3 A;  3CBJ A;  1AEC A;  2NQD B;  3USV A;  1ICF A;  1ME3 A;  2DCC A;  1STF E;  9PAP A;  1YAL A;  1S4V A;  1PIP A;  1X9Y A;  3P5U A;  3MHH A;  1CTE A;  2E01 A;  3PW3 A;  2NQG A;  3IV2 A;  5JH3 A;  1KFU L;  2ARY A;  2FRA A;  4N79 A;  1PPP A;  2BDZ A;  1A6R A;  4OEL A;  1AYW A;  1ATK A;  2NQA A;  1K3B B;  2AYO A;  4YYU A;  4BS6 A;  2IPP B;  2DC6 A;  3ERV A;  4BQV A;  3M99 A; 
#chains in the Genus database with same CATH topology
 2R9N A;  2P86 A;  5CHT A;  2JQF R;  3N4C A;  4RF0 A;  4RY2 A;  1TL9 A;  4BOU A;  1CPJ A;  3LFY A;  5K16 A;  3MTN A;  2J7Q C;  4Q8H A;  3PHU A;  1DEU A;  1CB5 A;  1BP4 A;  1GEC E;  3KFQ A;  5E6J A;  2Z84 A;  1BQI A;  1JQP A;  4KLB A;  2G6D A;  2BTW A;  4YYV A;  1AU2 A;  3HD3 A;  4P6E A;  5J94 A;  5EZQ A;  2UZJ A;  3I06 A;  3BY4 A;  2ATO A;  1PXV A;  8PCH A;  2G8E A;  4W5C A;  2AU1 A;  4DMX A;  1NPZ A;  3IFU A;  3CBK A;  4N4Z A;  4A5U A;  1CS8 A;  1Q6K A;  4BOS A;  3TNX A;  5CVN B;  1TLO A;  3KWZ A;  4G54 A;  5JA7 A;  4PI3 A;  4CDE B;  3BBA A;  3C9E A;  2DJF B;  1M6D A;  3NHE A;  3HHI A;  4YYQ A;  1PE6 A;  3E1Z B;  3OF8 A;  4YYW A;  2DC7 A;  2FYE A;  4AXM A;  1YZB A;  2DJG B;  4PP2 E;  1GCB A;  2DCA A;  3BWK A;  3OQC A;  2B1N A;  2E02 A;  1EF7 A;  3P5W A;  4BPV A;  3O1G A;  1O0E A;  3B79 A;  2PRE A;  3OVX A;  3CH2 X;  3BOW A;  5CVM A;  3D6S A;  1NQC A;  2AYN A;  6PAD A;  1F2A A;  4I05 A;  4BOP A;  3BB7 A;  2FUD A;  1YK8 A;  1MIR A;  2PAD A;  3PNR A;  2P0R A;  2DC8 A;  4QBB A;  1F29 A;  4PP1 A;  3WXE A;  4CDF B;  3F75 A;  1EWM A;  3IUT A;  4M0W A;  4W5B A;  1U9X A;  1QMY A;  3QSD A;  3MTV A;  1MHW A;  2DZY A;  2R9O A;  1F2B A;  4MZS A;  3ZUA A;  4I07 A;  4N8W A;  1CQD A;  4HXD B;  1BY8 A;  4QRG A;  3RVV A;  2PBH A;  4CDD B;  3MHS A;  4QH6 A;  3E9S A;  4XZX A;  1YK7 A;  2Y5B A;  3P5X A;  3H6S A;  4YV8 A;  1DKI A;  2YJ9 A;  4AXL A;  3IEJ A;  1MDW A;  1SP4 B;  1NLJ A;  4FK5 A;  2E03 A;  1UKF A;  4PAD A;  4X6H A;  3PDF A;  5EGW A;  3W31 A;  2Y6E A;  1ZCM A;  2C0Y A;  2PNS A;  3V6E A;  1GLO A;  4MZO A;  1NL6 A;  2XU4 A;  4R3D A;  3IMA A;  1AU0 A;  5EF4 A;  1ZIV A;  3RVX A;  3WXG A;  4PT5 A;  2G8J A;  2AVW A;  2FRQ A;  4OEM A;  4D8I A;  2DZZ A;  3TMP A;  1U9W A;  3F5V A;  3B21 A;  1PPN A;  2NQI A;  4MM3 B;  1EWO A;  3IOQ A;  2P7U A;  1AU3 A;  2BDL A;  5CVO B;  3TRK A;  3MP2 A;  4XUI A;  2F1G A;  3QJ3 A;  1TU6 A;  2B1M A;  3HWN A;  1PAD A;  3I3T A;  2XU3 A;  2YJ8 A;  3KKU A;  1PBH A;  3MOR A;  1PCI A;  4WUR A;  3S3R A;  1U5I A;  2R6N A;  1NB5 A;  1U9V A;  4HWY A;  3RVW A;  2DC9 A;  2BU3 A;  1F2C A;  4WA6 A;  4D8E A;  2AIM A;  4REZ A;  2GFO A;  2OP3 A;  2OZ2 A;  4MI7 A;  2AS8 A;  3GCB A;  1CJL A;  4BSQ A;  4YVA A;  3AI8 A;  3O65 A;  3K9M A;  4Q8G A;  3N3K A;  2OUL A;  4QRX A;  3PRP A;  4D8B A;  3C0R A;  1QDQ A;  3H8C A;  4BS5 A;  1XKG A;  2G7Y A;  1EWL A;  3K24 A;  2AUZ A;  4ZTB A;  2XU1 A;  2FO5 A;  3QT4 A;  1U9Q X;  1VJV A;  2H7J A;  4BOQ A;  1VSN A;  3LXS A;  5JZE A;  3OIS A;  4ZUX U;  3IHP A;  3CH3 X;  1SNK A;  2DCD A;  2YJ2 A;  3ZNH A;  2CB5 A;  5EZS A;  3H89 A;  1AYV A;  1POP A;  1KHQ A;  3V6C A;  1YT7 A;  5PAD A;  1CSB B;  2AGA A;  4FIP A;  4FJC A;  2R9M A;  3WXF A;  2FQ9 A;  2ACT A;  2JTC A;  2AUX A;  1ITO A;  1EWP A;  4K7C A;  4YYS A;  1KFX L;  2HXZ A;  1Y08 A;  5A24 A;  3OF9 A;  1PVJ A;  1MEG A;  4MSX A;  2XU5 A;  2CIO A;  3K8U A;  1AIM A;  2YJC A;  1PPO A;  3KW9 A;  4XR7 A;  2BTW B;  4RF1 A;  1THE A;  2DCB A;  1HUC B;  3PSE A;  3BPF A;  2R9F A;  1GMY A;  2HHN A;  3KX1 A;  4OW0 A;  3N3G A;  3O0U A;  1BGO A;  4I04 A;  1NB3 A;  1MEM A;  3DF0 A;  1MS6 A;  4CDC B;  4BOZ A;  1Y4H A;  1YVB A;  2VHF A;  2FE8 A;  4CZW A;  3BPM A;  1IWD A;  1DF0 A;  3RNV A;  1AU4 A;  2HD5 A;  2O6X A;  1CVZ A;  2E00 A;  3PHW A;  1FH0 A;  5CHV A;  2HWK A;  4X6I A;  3OVZ A;  4IUM A;  3U8E A;  2HH5 A;  2R9C A;  3BCN A;  4X6J A;  3H7D A;  3PHX A;  4P6G A;  1KHP A;  2DOS A;  1PPD A;  3H8B A;  2FT2 A;  2WBF X;  5F02 A;  3MJ5 A;  3KWB X;  1AYU A;  4OVZ B;  2JRI A;  2FTD A;  3PBH A;  4QRV A;  3S3Q A;  1QOL A;  1KXR A;  7PCK A;  3P5V A;  2VHS A;  2GHU A;  3KSE A;  2YJB A;  4RKX A;  5FPW A;  2F7D A;  1CV8 A;  1QXP A;  4GUA A;  2JQG R;  4OVZ A;  2IBI A;  1ME4 A;  3W30 A;  3HHA A;  2J7Q A;  5KO3 A;  4W4U A;  3PRM A;  4YYR A;  4DMY A;  3BC3 A;  3PT2 A;  3CBJ A;  1AEC A;  2NQD B;  3USV A;  1ICF A;  1ME3 A;  2DCC A;  1STF E;  9PAP A;  1YAL A;  1S4V A;  1PIP A;  1X9Y A;  4RNA A;  3P5U A;  3MHH A;  1CTE A;  2E01 A;  3PW3 A;  2NQG A;  3IV2 A;  4IP3 A;  5JH3 A;  1KFU L;  2ARY A;  2FRA A;  4N79 A;  1PPP A;  2BDZ A;  1A6R A;  4OEL A;  1AYW A;  1ATK A;  2NQA A;  4P16 A;  1K3B B;  2AYO A;  4YYU A;  4BS6 A;  2IPP B;  2DC6 A;  3ERV A;  4BQV A;  3M99 A; 
#chains in the Genus database with same CATH homology
 2R9N A;  2P86 A;  5CHT A;  2JQF R;  3N4C A;  4RY2 A;  1TL9 A;  1CPJ A;  1GX3 A;  3LFY A;  5K16 A;  3MTN A;  4GUZ A;  4Q8H A;  1DEU A;  1CB5 A;  1BP4 A;  1GEC E;  3KFQ A;  1BQI A;  1JQP A;  2VFB A;  2G6D A;  4KLB A;  4YYV A;  1AU2 A;  3HD3 A;  4P6E A;  5J94 A;  3I06 A;  2ATO A;  1PXV A;  8PCH A;  2G8E A;  4W5C A;  2AU1 A;  4DMX A;  1NPZ A;  3CBK A;  4N4Z A;  1CS8 A;  1Q6K A;  3TNX A;  5CVN B;  1TLO A;  3KWZ A;  4G54 A;  5JA7 A;  4PI3 A;  4CDE B;  3C9E A;  2DJF B;  1M6D A;  3NHE A;  3HHI A;  4YYQ A;  1PE6 A;  3E1Z B;  3OF8 A;  4YYW A;  2DC7 A;  2FYE A;  4AXM A;  2DJG B;  4PP2 E;  1GCB A;  2DCA A;  3BWK A;  2B1N A;  1W5R A;  2E02 A;  1EF7 A;  3P5W A;  4BPV A;  3O1G A;  1O0E A;  3B79 A;  2PRE A;  3OVX A;  3CH2 X;  3BOW A;  5CVM A;  3D6S A;  1NQC A;  2AYN A;  6PAD A;  1F2A A;  4I05 A;  2FUD A;  1YK8 A;  2VFC A;  1MIR A;  2PAD A;  3PNR A;  2P0R A;  2DC8 A;  4QBB A;  1F29 A;  4PP1 A;  3WXE A;  4NV8 A;  4CDF B;  3F75 A;  1EWM A;  4BGF A;  3IUT A;  4W5B A;  1U9X A;  1QMY A;  3QSD A;  1MHW A;  2DZY A;  1W4T A;  2R9O A;  1F2B A;  4MZS A;  3ZUA A;  4I07 A;  4N8W A;  1CQD A;  1BY8 A;  4QRG A;  3RVV A;  2PBH A;  4CDD B;  3MHS A;  4QH6 A;  1YK7 A;  2Y5B A;  3P5X A;  3H6S A;  4YV8 A;  2YJ9 A;  4AXL A;  3IEJ A;  1MDW A;  1SP4 B;  1NLJ A;  4FK5 A;  2E03 A;  4PAD A;  4X6H A;  4B55 A;  3PDF A;  5EGW A;  2Y6E A;  1ZCM A;  2C0Y A;  2PNS A;  3V6E A;  1GLO A;  4MZO A;  1NL6 A;  2XU4 A;  3IMA A;  1AU0 A;  5EF4 A;  1ZIV A;  3RVX A;  3WXG A;  2G8J A;  2AVW A;  2FRQ A;  4OEM A;  2DZZ A;  1U9W A;  3F5V A;  1PPN A;  2NQI A;  4C5P A;  1EWO A;  3IOQ A;  2P7U A;  1AU3 A;  2BDL A;  5CVO B;  4XUI A;  2F1G A;  3QJ3 A;  1TU6 A;  2B1M A;  3HWN A;  1PAD A;  3I3T A;  2XU3 A;  2YJ8 A;  3KKU A;  1PBH A;  3MOR A;  1PCI A;  3S3R A;  1U5I A;  2R6N A;  1NB5 A;  1U9V A;  4HWY A;  3RVW A;  2DC9 A;  1F2C A;  4WA6 A;  2AIM A;  2GFO A;  2OP3 A;  2OZ2 A;  2AS8 A;  3GCB A;  1CJL A;  4BSQ A;  4YVA A;  3AI8 A;  3K9M A;  4Q8G A;  3N3K A;  2OUL A;  4QRX A;  1QDQ A;  3H8C A;  4BS5 A;  1XKG A;  2G7Y A;  1EWL A;  3K24 A;  2AUZ A;  2XU1 A;  2FO5 A;  3QT4 A;  1U9Q X;  1VJV A;  2H7J A;  1VSN A;  3LXS A;  3OIS A;  4ZUX U;  3IHP A;  3CH3 X;  1SNK A;  2DCD A;  2YJ2 A;  2CB5 A;  3H89 A;  1AYV A;  1POP A;  1KHQ A;  3V6C A;  1E2T A;  1YT7 A;  5PAD A;  1W6F A;  1CSB B;  4FIP A;  4FJC A;  2R9M A;  3WXF A;  2FQ9 A;  2ACT A;  2AUX A;  1ITO A;  1EWP A;  4K7C A;  4YYS A;  1KFX L;  2HXZ A;  1Y08 A;  5A24 A;  3OF9 A;  1MEG A;  4MSX A;  2XU5 A;  2CIO A;  3K8U A;  1AIM A;  2YJC A;  1PPO A;  3KW9 A;  4XR7 A;  1THE A;  2DCB A;  1HUC B;  3BPF A;  2R9F A;  1GMY A;  2HHN A;  3KX1 A;  3N3G A;  3O0U A;  1BGO A;  4I04 A;  1NB3 A;  1MEM A;  3DF0 A;  1MS6 A;  4CDC B;  1Y4H A;  1YVB A;  2VHF A;  4CZW A;  3BPM A;  1IWD A;  1DF0 A;  1AU4 A;  2HD5 A;  2O6X A;  1CVZ A;  2E00 A;  1FH0 A;  5CHV A;  4X6I A;  3OVZ A;  2BSZ A;  3U8E A;  2HH5 A;  2R9C A;  3BCN A;  4NV7 A;  4X6J A;  3H7D A;  4P6G A;  1KHP A;  1PPD A;  3H8B A;  2FT2 A;  2WBF X;  5F02 A;  3D9W A;  3KWB X;  1AYU A;  2FTD A;  3PBH A;  4QRV A;  3S3Q A;  1QOL A;  1KXR A;  7PCK A;  3P5V A;  2VHS A;  2GHU A;  3KSE A;  2YJB A;  5FPW A;  2F7D A;  1CV8 A;  1QXP A;  2JQG R;  2IBI A;  1ME4 A;  3HHA A;  4W4U A;  4YYR A;  4DMY A;  3BC3 A;  3CBJ A;  1AEC A;  2NQD B;  3USV A;  1ICF A;  3LTW A;  1ME3 A;  2DCC A;  1STF E;  9PAP A;  1YAL A;  1S4V A;  1PIP A;  1X9Y A;  3P5U A;  3MHH A;  1CTE A;  2E01 A;  3PW3 A;  2NQG A;  3IV2 A;  5JH3 A;  1KFU L;  2ARY A;  2FRA A;  4N79 A;  1PPP A;  2BDZ A;  1A6R A;  4OEL A;  1AYW A;  1ATK A;  2NQA A;  1K3B B;  2AYO A;  4YYU A;  4BS6 A;  2IPP B;  2DC6 A;  3ERV A;  4BQV A;  3M99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...