4Q8GA

Structure of the saccharomyces cerevisiae pan2 pseudoubiquitin-hydrolase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
403
structure length
344
Chain Sequence
b'TSDIQTYTSINKYEVPPAYSRLPLTFDFTPFNNTEYSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDTTLLTDLGYLFDMMERSHGKICSSSNFQASLKSLTSIKRNMPQKFNRFLLSQLIKEEAQTVNHNITLNQCFGLETEIRTECSCDHYDTTVKLLPSLSISGINQNILPYIEYAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLDTEFSNIRSSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNNNETRLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEELRKPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PAB-dependent poly(A)-specific ribonuclease subunit PAN2
publication title The structure of the Pan2-Pan3 core complex reveals cross-talk between deadenylase and pseudokinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 98
structure length 344
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4q8gA00
1U9XA 1AU2A 3OVXA 4YYUA 1NL6A 1ITOA 1EWOA 2FQ9A 2P86A 6PADA 2WBFX 1THEA 3CH2X 4CDEB 3GCBA 2NQGA 4N4ZA 1EF7A 4DMXA 2DC8A 2FO5A 2CB5A 1CJLA 3KKUA 2BDZA 1KFUL 3H7DA 2PREA 2Y5BA 3ZUAA 5CHTA 1CV8A 4Q8HA 2FYEA 2ARYA 8PCHA 1MEMA 1BQIA 3HHAA 2HHNA 2NQDB 3KWZA 1STFE 3K9MA 4AXMA 3MHSA 2PNSA 1F2BA 2AS8A 1U9WA 2DJGB 2FRQA 2ATOA 2XU3A 2AYNA 5PADA 2XU4A 2P0RA 4PP1A 1DEUA 2HD5A 5CHVA 2R9NA 1KFXL 4WA6A 1PADA 2DCAA 2E02A 3C9EA 4FIPA 3KFQA 1PPDA 4X6IA 1KHPA 1XKGA 2DCCA 1DF0A 2NQAA 1IWDA 1QDQA 1MIRA 3K8UA 4W5CA 4YV8A 3S3RA 3BWKA 1CPJA 4HWYA 4CDFB 1EWLA 3IEJA 1MEGA 2VHSA 4FJCA 4CDCB 3O1GA 1CB5A 1O0EA 4X6JA 1MHWA 3I06A 3CH3X 1PIPA 1NQCA 3RVVA 2OULA 1ATKA 5EGWA 3BC3A 4YYQA 1M6DA 1TU6A 3QT4A 2HH5A 3KX1A 4QRGA 1POPA 3OVZA 1PBHA 2XU5A 1PXVA 4AXLA 1FH0A 4CZWA 4MZOA 3HHIA 3KW9A 3M99A 3WXFA 1EWMA 2VHFA 3F75A 2AUXA 5A24A 4G54A 2DCDA 4I07A 1EWPA 3RVWA 1U5IA 2E03A 1QOLA 1U9QX 1MS6A 3H8CA 3QJ3A 4QRVA 4OEMA 1SP4B 2FRAA 1QXPA 1AYWA 3AI8A 3N4CA 1YK8A 1TL9A 3OISA 1VSNA 3P5WA 2XU1A 3D6SA 9PAPA 1F2AA 2AUZA 3I3TA 4Q8GA 1Q6KA 1K3BB 2C0YA 4PP2E 4YYSA 3O0UA 3HD3A 4YYRA 1PPNA 4YYWA 2B1NA 2DC9A 2DZZA 1BP4A 4YYVA 2GHUA 3F5VA 2HXZA 3U8EA 2IPPB 3OF8A 3N3GA 2R9CA 1ZCMA 2OP3A 2R9OA 1CQDA 3PNRA 1GLOA 2NQIA 2FUDA 1TLOA 3S3QA 2G7YA 1KXRA 3IV2A 3WXEA 1AECA 2O6XA 2FT2A 4BSQA 1QMYA 4XUIA 3B79A 5F02A 4PADA 3IHPA 3PDFA 5EF4A 3H8BA 3MHHA 1Y08A 1GCBA 3LXSA 2YJ8A 1KHQA 1S4VA 4W4UA 1YT7A 1PCIA 3USVA 4BS5A 4KLBA 7PCKA 2F1GA 1Y4HA 1YALA 1F2CA 4I05A 3WXGA 2AVWA 2E00A 4N8WA 2E01A 4P6GA 1GECE 1AU0A 3ERVA 1ZIVA 1ICFA 2JQFR 2JQGR 3CBJA 1PE6A 3TNXA 3IMAA 3PBHA 5J94A 2Y6EA 2YJ2A 4BPVA 4I04A 2P7UA 3RVXA 2G6DA 1ME4A 1YK7A 1MDWA 1CSBB 1NLJA 1X9YA 2G8EA 1NB5A 2AYOA 1BGOA 5CVNB 4ZUXU 3KSEA 1PPPA 1NPZA 3CBKA 1HUCB 1BY8A 2PADA 3PW3A 1AU3A 4N79A 2B1MA 1PPOA 3BPMA 4QH6A 1A6RA 1YVBA 3V6CA 1U9VA 3H89A 3KWBX 4QBBA 4PI3A 2H7JA 3K24A 2DC7A 3MORA 5K16A 4MSXA 1CTEA 2YJ9A 2DZYA 5CVMA 1NB3A 3P5VA 3QSDA 2FTDA 3N3KA 3P5UA 2GFOA 3V6EA 3H6SA 3NHEA 2R9FA 2ACTA 4FK5A 4P6EA 3IOQA 5CVOB 4W5BA 1F29A 3BOWA 3E1ZB 2DJFB 3DF0A 4BQVA 2F7DA 4BS6A 1ME3A 2R6NA 2OZ2A 1VJVA 2R9MA 4DMYA 2CIOA 1AYUA 3BCNA 4CDDB 5JA7A 1CVZA 4YVAA 2AU1A 1GMYA 3LFYA 4QRXA 1CS8A 3MTNA 4OELA 2DC6A 2YJBA 3P5XA 4K7CA 4MZSA 2DCBA 4RY2A 2AIMA 2G8JA 1AU4A 4X6HA 1JQPA 1AYVA 3HWNA 2YJCA 2PBHA 5JH3A 1AIMA 3IUTA 1SNKA 5FPWA 4XR7A 2IBIA 3BPFA 2BDLA 3OF9A
chains in the Genus database with same CATH superfamily
1U9XA 1AU2A 3OVXA 4YYUA 1NL6A 1ITOA 4RF1A 1EWOA 2FQ9A 2P86A 6PADA 2WBFX 1THEA 3CH2X 4CDEB 3GCBA 2NQGA 4N4ZA 1EF7A 4DMXA 4OW0A 2DC8A 2FO5A 2CB5A 1CJLA 3KKUA 2BDZA 1KFUL 4HXDB 3H7DA 2PREA 2Y5BA 3ZUAA 5CHTA 1CV8A 5KO3A 4Q8HA 2FYEA 2ARYA 8PCHA 1MEMA 1BQIA 3HHAA 3TMPA 2HHNA 2NQDB 3KWZA 4D8BA 1STFE 4ZTBA 3K9MA 3PRPA 4AXMA 3MHSA 2PNSA 1F2BA 2AS8A 1U9WA 2DJGB 5EZQA 2FRQA 2ATOA 4WURA 2XU3A 2AYNA 5PADA 3MP2A 3W30A 2XU4A 2P0RA 4PP1A 1DEUA 2HD5A 5CHVA 2R9NA 1KFXL 3MTVA 4WA6A 1PADA 2DCAA 2E02A 3C9EA 4FIPA 3OQCA 4RKXA 3KFQA 1PPDA 4X6IA 1KHPA 1XKGA 2DCCA 1DF0A 2NQAA 4BOUA 1IWDA 1QDQA 1MIRA 3K8UA 4W5CA 4YV8A 2J7QC 3S3RA 3BWKA 1CPJA 4HWYA 4IP3A 4CDFB 3PHUA 1DKIA 1EWLA 3IEJA 1MEGA 2VHSA 4FJCA 4CDCB 3O1GA 1CB5A 1O0EA 4X6JA 1MHWA 3I06A 3CH3X 3O65A 1PIPA 1NQCA 3RVVA 2OULA 1ATKA 5EGWA 3W31A 2BTWB 3BC3A 4YYQA 1M6DA 1TU6A 3QT4A 2HH5A 3KX1A 4QRGA 1POPA 3OVZA 4A5UA 1PBHA 2XU5A 1PXVA 4AXLA 2DOSA 3PHXA 1FH0A 4CZWA 4MZOA 3HHIA 5EZSA 3KW9A 3M99A 3WXFA 4RF0A 1EWMA 2VHFA 3F75A 2AUXA 4BOQA 5A24A 4G54A 4P16A 2DCDA 4I07A 1EWPA 3RVWA 1U5IA 2E03A 1QOLA 1U9QX 2AGAA 1MS6A 3E9SA 3H8CA 3QJ3A 4QRVA 3B21A 4OEMA 1SP4B 2FRAA 1QXPA 1AYWA 3AI8A 3N4CA 1YK8A 1TL9A 3OISA 1VSNA 3P5WA 2XU1A 3D6SA 3BY4A 9PAPA 1F2AA 2AUZA 3I3TA 3MJ5A 4Q8GA 1Q6KA 1UKFA 1K3BB 4PT5A 2C0YA 4PP2E 4YYSA 3O0UA 3HD3A 4YYRA 1PPNA 4IUMA 4YYWA 2B1NA 2DC9A 2DZZA 1BP4A 4YYVA 2GHUA 3F5VA 2HXZA 3U8EA 2IPPB 3OF8A 2JRIA 3N3GA 4GUAA 2R9CA 1ZCMA 3PSEA 2OP3A 2R9OA 1CQDA 3C0RA 3PNRA 1GLOA 2NQIA 2FUDA 3ZNHA 1TLOA 3S3QA 2G7YA 1KXRA 3IV2A 3WXEA 1AECA 2O6XA 2FT2A 4BSQA 1QMYA 4XUIA 3B79A 5F02A 2BU3A 3PT2A 4PADA 3IHPA 3PDFA 5EF4A 3H8BA 3MHHA 4R3DA 1Y08A 1GCBA 3LXSA 2YJ8A 1KHQA 1S4VA 4W4UA 1YT7A 1PCIA 3USVA 4D8EA 4BS5A 4KLBA 7PCKA 2F1GA 1Y4HA 1YALA 1F2CA 4I05A 3WXGA 2AVWA 2E00A 4N8WA 2E01A 4P6GA 1GECE 1AU0A 3ERVA 1ZIVA 1ICFA 2JQFR 1YZBA 2JQGR 3CBJA 1PE6A 3TNXA 4M0WA 4XZXA 3IMAA 3PBHA 5J94A 2Y6EA 2YJ2A 4BPVA 4I04A 2P7UA 3RVXA 2G6DA 5E6JA 1ME4A 1YK7A 1MDWA 4MM3B 1CSBB 1NLJA 1X9YA 3TRKA 2G8EA 1NB5A 2AYOA 1BGOA 5CVNB 3PRMA 3PHWA 4ZUXU 3KSEA 1PPPA 1NPZA 5JZEA 3CBKA 1HUCB 1BY8A 2PADA 3PW3A 4MI7A 1AU3A 4N79A 3BB7A 2B1MA 1PPOA 3BPMA 4QH6A 1A6RA 1YVBA 3V6CA 3IFUA 1U9VA 2Z84A 3H89A 3KWBX 4QBBA 4PI3A 2H7JA 3K24A 2DC7A 3MORA 5K16A 4MSXA 1CTEA 3BBAA 4D8IA 2YJ9A 2DZYA 5CVMA 1NB3A 3P5VA 3QSDA 2FTDA 3N3KA 3P5UA 2GFOA 3V6EA 3H6SA 3NHEA 2R9FA 2ACTA 2BTWA 3RNVA 4BOSA 4FK5A 4OVZA 4P6EA 4BOPA 3IOQA 5CVOB 4W5BA 1F29A 3BOWA 1PVJA 3E1ZB 2DJFB 3DF0A 4BQVA 2F7DA 4BS6A 1ME3A 2R6NA 2OZ2A 1VJVA 2R9MA 4DMYA 2CIOA 2UZJA 1AYUA 2J7QA 4BOZA 3BCNA 4CDDB 2FE8A 5JA7A 1CVZA 4YVAA 2AU1A 1GMYA 3LFYA 4QRXA 1CS8A 3MTNA 4OELA 4RNAA 2DC6A 2YJBA 3P5XA 4K7CA 4MZSA 2DCBA 4RY2A 2AIMA 2G8JA 1AU4A 4X6HA 1JQPA 1AYVA 3HWNA 2YJCA 2PBHA 4REZA 5JH3A 2HWKA 1AIMA 3IUTA 1SNKA 5FPWA 4XR7A 2IBIA 4OVZB 3BPFA 2BDLA 2JTCA 3OF9A
chains in the Genus database with same CATH topology
1U9XA 1AU2A 3OVXA 4YYUA 1NL6A 1ITOA 1EWOA 2FQ9A 2P86A 6PADA 2WBFX 1THEA 3CH2X 4CDEB 3GCBA 2NQGA 4GUZA 4N4ZA 1EF7A 4DMXA 2DC8A 2VFBA 2FO5A 2CB5A 1CJLA 3KKUA 2BDZA 1KFUL 3H7DA 2PREA 2Y5BA 3ZUAA 5CHTA 1CV8A 4Q8HA 2FYEA 2ARYA 8PCHA 1MEMA 1BQIA 3HHAA 2HHNA 2NQDB 3KWZA 1STFE 3K9MA 4AXMA 3MHSA 2PNSA 1F2BA 2AS8A 1U9WA 2DJGB 2FRQA 2ATOA 2XU3A 2AYNA 5PADA 2XU4A 2P0RA 4PP1A 1DEUA 2HD5A 5CHVA 2R9NA 1KFXL 4WA6A 1PADA 2DCAA 2E02A 3C9EA 4FIPA 3KFQA 2VFCA 1PPDA 4X6IA 1KHPA 1XKGA 2DCCA 1DF0A 4BGFA 2NQAA 1IWDA 1QDQA 1MIRA 3K8UA 4W5CA 4YV8A 3S3RA 3BWKA 1CPJA 4HWYA 4CDFB 1EWLA 3IEJA 1MEGA 1W6FA 2VHSA 3D9WA 4FJCA 4CDCB 3O1GA 1CB5A 1O0EA 4X6JA 1MHWA 1E2TA 3I06A 3CH3X 1PIPA 1NQCA 3RVVA 2OULA 1ATKA 5EGWA 3BC3A 4YYQA 1M6DA 1TU6A 3QT4A 2HH5A 3KX1A 4QRGA 1POPA 3OVZA 1PBHA 2XU5A 1PXVA 1GX3A 4AXLA 1FH0A 4CZWA 4MZOA 3HHIA 3KW9A 3M99A 1W5RA 3WXFA 1EWMA 2VHFA 3F75A 2AUXA 5A24A 4G54A 4C5PA 2DCDA 4I07A 1EWPA 3RVWA 1U5IA 2E03A 1QOLA 1U9QX 1MS6A 3H8CA 3QJ3A 4QRVA 4OEMA 1SP4B 2FRAA 1QXPA 1AYWA 3AI8A 3N4CA 1YK8A 1TL9A 3OISA 1VSNA 3P5WA 2XU1A 3D6SA 9PAPA 1F2AA 2AUZA 3I3TA 4Q8GA 1Q6KA 1K3BB 2C0YA 4PP2E 4YYSA 3O0UA 3HD3A 4YYRA 1PPNA 4YYWA 2B1NA 2DC9A 2DZZA 1BP4A 4YYVA 2GHUA 3F5VA 2HXZA 3U8EA 2IPPB 3OF8A 3N3GA 2R9CA 1ZCMA 2OP3A 2R9OA 1CQDA 3PNRA 1GLOA 2NQIA 2FUDA 4B55A 1TLOA 3S3QA 2G7YA 1KXRA 3IV2A 3WXEA 1AECA 2O6XA 2FT2A 4BSQA 1QMYA 4XUIA 3B79A 5F02A 4PADA 3IHPA 3PDFA 5EF4A 3H8BA 3MHHA 1Y08A 1GCBA 3LXSA 2YJ8A 1KHQA 1S4VA 4W4UA 1YT7A 1PCIA 3USVA 4BS5A 4KLBA 7PCKA 2F1GA 1Y4HA 1YALA 1F2CA 4I05A 3WXGA 2AVWA 2E00A 4N8WA 2E01A 4P6GA 1W4TA 1GECE 1AU0A 3ERVA 1ZIVA 1ICFA 2JQFR 2JQGR 3CBJA 1PE6A 3TNXA 2BSZA 3IMAA 3PBHA 5J94A 2Y6EA 2YJ2A 4BPVA 4I04A 2P7UA 3RVXA 2G6DA 1ME4A 1YK7A 1MDWA 1CSBB 1NLJA 1X9YA 2G8EA 1NB5A 2AYOA 4NV7A 1BGOA 5CVNB 4ZUXU 3KSEA 1PPPA 1NPZA 3CBKA 1HUCB 1BY8A 2PADA 3PW3A 1AU3A 4N79A 2B1MA 1PPOA 3BPMA 4QH6A 1A6RA 1YVBA 3V6CA 1U9VA 3H89A 3KWBX 4QBBA 4PI3A 2H7JA 3K24A 2DC7A 3MORA 5K16A 4MSXA 1CTEA 2YJ9A 2DZYA 5CVMA 1NB3A 3P5VA 3QSDA 2FTDA 3N3KA 3P5UA 2GFOA 3V6EA 3H6SA 3NHEA 2R9FA 2ACTA 4FK5A 4P6EA 3IOQA 5CVOB 4W5BA 1F29A 3BOWA 3E1ZB 2DJFB 3DF0A 4BQVA 2F7DA 3LTWA 4BS6A 1ME3A 2R6NA 2OZ2A 1VJVA 2R9MA 4DMYA 2CIOA 4NV8A 1AYUA 3BCNA 4CDDB 5JA7A 1CVZA 4YVAA 2AU1A 1GMYA 3LFYA 4QRXA 1CS8A 3MTNA 4OELA 2DC6A 2YJBA 3P5XA 4K7CA 4MZSA 2DCBA 4RY2A 2AIMA 2G8JA 1AU4A 4X6HA 1JQPA 1AYVA 3HWNA 2YJCA 2PBHA 5JH3A 1AIMA 3IUTA 1SNKA 5FPWA 4XR7A 2IBIA 3BPFA 2BDLA 3OF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9X A;  1AU2 A;  3OVX A;  4YYU A;  1NL6 A;  1ITO A;  1EWO A;  2FQ9 A;  2P86 A;  6PAD A;  2WBF X;  1THE A;  3CH2 X;  4CDE B;  3GCB A;  2NQG A;  4N4Z A;  1EF7 A;  4DMX A;  2DC8 A;  2FO5 A;  2CB5 A;  1CJL A;  3KKU A;  2BDZ A;  1KFU L;  3H7D A;  2PRE A;  2Y5B A;  3ZUA A;  5CHT A;  1CV8 A;  4Q8H A;  2FYE A;  2ARY A;  8PCH A;  1MEM A;  1BQI A;  3HHA A;  2HHN A;  2NQD B;  3KWZ A;  1STF E;  3K9M A;  4AXM A;  3MHS A;  2PNS A;  1F2B A;  2AS8 A;  1U9W A;  2DJG B;  2FRQ A;  2ATO A;  2XU3 A;  2AYN A;  5PAD A;  2XU4 A;  2P0R A;  4PP1 A;  1DEU A;  2HD5 A;  5CHV A;  2R9N A;  1KFX L;  4WA6 A;  1PAD A;  2DCA A;  2E02 A;  3C9E A;  4FIP A;  3KFQ A;  1PPD A;  4X6I A;  1KHP A;  1XKG A;  2DCC A;  1DF0 A;  2NQA A;  1IWD A;  1QDQ A;  1MIR A;  3K8U A;  4W5C A;  4YV8 A;  3S3R A;  3BWK A;  1CPJ A;  4HWY A;  4CDF B;  1EWL A;  3IEJ A;  1MEG A;  2VHS A;  4FJC A;  4CDC B;  3O1G A;  1CB5 A;  1O0E A;  4X6J A;  1MHW A;  3I06 A;  3CH3 X;  1PIP A;  1NQC A;  3RVV A;  2OUL A;  1ATK A;  5EGW A;  3BC3 A;  4YYQ A;  1M6D A;  1TU6 A;  3QT4 A;  2HH5 A;  3KX1 A;  4QRG A;  1POP A;  3OVZ A;  1PBH A;  2XU5 A;  1PXV A;  4AXL A;  1FH0 A;  4CZW A;  4MZO A;  3HHI A;  3KW9 A;  3M99 A;  3WXF A;  1EWM A;  2VHF A;  3F75 A;  2AUX A;  5A24 A;  4G54 A;  2DCD A;  4I07 A;  1EWP A;  3RVW A;  1U5I A;  2E03 A;  1QOL A;  1U9Q X;  1MS6 A;  3H8C A;  3QJ3 A;  4QRV A;  4OEM A;  1SP4 B;  2FRA A;  1QXP A;  1AYW A;  3AI8 A;  3N4C A;  1YK8 A;  1TL9 A;  3OIS A;  1VSN A;  3P5W A;  2XU1 A;  3D6S A;  9PAP A;  1F2A A;  2AUZ A;  3I3T A;  4Q8G A;  1Q6K A;  1K3B B;  2C0Y A;  4PP2 E;  4YYS A;  3O0U A;  3HD3 A;  4YYR A;  1PPN A;  4YYW A;  2B1N A;  2DC9 A;  2DZZ A;  1BP4 A;  4YYV A;  2GHU A;  3F5V A;  2HXZ A;  3U8E A;  2IPP B;  3OF8 A;  3N3G A;  2R9C A;  1ZCM A;  2OP3 A;  2R9O A;  1CQD A;  3PNR A;  1GLO A;  2NQI A;  2FUD A;  1TLO A;  3S3Q A;  2G7Y A;  1KXR A;  3IV2 A;  3WXE A;  1AEC A;  2O6X A;  2FT2 A;  4BSQ A;  1QMY A;  4XUI A;  3B79 A;  5F02 A;  4PAD A;  3IHP A;  3PDF A;  5EF4 A;  3H8B A;  3MHH A;  1Y08 A;  1GCB A;  3LXS A;  2YJ8 A;  1KHQ A;  1S4V A;  4W4U A;  1YT7 A;  1PCI A;  3USV A;  4BS5 A;  4KLB A;  7PCK A;  2F1G A;  1Y4H A;  1YAL A;  1F2C A;  4I05 A;  3WXG A;  2AVW A;  2E00 A;  4N8W A;  2E01 A;  4P6G A;  1GEC E;  1AU0 A;  3ERV A;  1ZIV A;  1ICF A;  2JQF R;  2JQG R;  3CBJ A;  1PE6 A;  3TNX A;  3IMA A;  3PBH A;  5J94 A;  2Y6E A;  2YJ2 A;  4BPV A;  4I04 A;  2P7U A;  3RVX A;  2G6D A;  1ME4 A;  1YK7 A;  1MDW A;  1CSB B;  1NLJ A;  1X9Y A;  2G8E A;  1NB5 A;  2AYO A;  1BGO A;  5CVN B;  4ZUX U;  3KSE A;  1PPP A;  1NPZ A;  3CBK A;  1HUC B;  1BY8 A;  2PAD A;  3PW3 A;  1AU3 A;  4N79 A;  2B1M A;  1PPO A;  3BPM A;  4QH6 A;  1A6R A;  1YVB A;  3V6C A;  1U9V A;  3H89 A;  3KWB X;  4QBB A;  4PI3 A;  2H7J A;  3K24 A;  2DC7 A;  3MOR A;  5K16 A;  4MSX A;  1CTE A;  2YJ9 A;  2DZY A;  5CVM A;  1NB3 A;  3P5V A;  3QSD A;  2FTD A;  3N3K A;  3P5U A;  2GFO A;  3V6E A;  3H6S A;  3NHE A;  2R9F A;  2ACT A;  4FK5 A;  4P6E A;  3IOQ A;  5CVO B;  4W5B A;  1F29 A;  3BOW A;  3E1Z B;  2DJF B;  3DF0 A;  4BQV A;  2F7D A;  4BS6 A;  1ME3 A;  2R6N A;  2OZ2 A;  1VJV A;  2R9M A;  4DMY A;  2CIO A;  1AYU A;  3BCN A;  4CDD B;  5JA7 A;  1CVZ A;  4YVA A;  2AU1 A;  1GMY A;  3LFY A;  4QRX A;  1CS8 A;  3MTN A;  4OEL A;  2DC6 A;  2YJB A;  3P5X A;  4K7C A;  4MZS A;  2DCB A;  4RY2 A;  2AIM A;  2G8J A;  1AU4 A;  4X6H A;  1JQP A;  1AYV A;  3HWN A;  2YJC A;  2PBH A;  5JH3 A;  1AIM A;  3IUT A;  1SNK A;  5FPW A;  4XR7 A;  2IBI A;  3BPF A;  2BDL A;  3OF9 A; 
#chains in the Genus database with same CATH topology
 1U9X A;  1AU2 A;  3OVX A;  4YYU A;  1NL6 A;  1ITO A;  4RF1 A;  1EWO A;  2FQ9 A;  2P86 A;  6PAD A;  2WBF X;  1THE A;  3CH2 X;  4CDE B;  3GCB A;  2NQG A;  4N4Z A;  1EF7 A;  4DMX A;  4OW0 A;  2DC8 A;  2FO5 A;  2CB5 A;  1CJL A;  3KKU A;  2BDZ A;  1KFU L;  4HXD B;  3H7D A;  2PRE A;  2Y5B A;  3ZUA A;  5CHT A;  1CV8 A;  5KO3 A;  4Q8H A;  2FYE A;  2ARY A;  8PCH A;  1MEM A;  1BQI A;  3HHA A;  3TMP A;  2HHN A;  2NQD B;  3KWZ A;  4D8B A;  1STF E;  4ZTB A;  3K9M A;  3PRP A;  4AXM A;  3MHS A;  2PNS A;  1F2B A;  2AS8 A;  1U9W A;  2DJG B;  5EZQ A;  2FRQ A;  2ATO A;  4WUR A;  2XU3 A;  2AYN A;  5PAD A;  3MP2 A;  3W30 A;  2XU4 A;  2P0R A;  4PP1 A;  1DEU A;  2HD5 A;  5CHV A;  2R9N A;  1KFX L;  3MTV A;  4WA6 A;  1PAD A;  2DCA A;  2E02 A;  3C9E A;  4FIP A;  3OQC A;  4RKX A;  3KFQ A;  1PPD A;  4X6I A;  1KHP A;  1XKG A;  2DCC A;  1DF0 A;  2NQA A;  4BOU A;  1IWD A;  1QDQ A;  1MIR A;  3K8U A;  4W5C A;  4YV8 A;  2J7Q C;  3S3R A;  3BWK A;  1CPJ A;  4HWY A;  4IP3 A;  4CDF B;  3PHU A;  1DKI A;  1EWL A;  3IEJ A;  1MEG A;  2VHS A;  4FJC A;  4CDC B;  3O1G A;  1CB5 A;  1O0E A;  4X6J A;  1MHW A;  3I06 A;  3CH3 X;  3O65 A;  1PIP A;  1NQC A;  3RVV A;  2OUL A;  1ATK A;  5EGW A;  3W31 A;  2BTW B;  3BC3 A;  4YYQ A;  1M6D A;  1TU6 A;  3QT4 A;  2HH5 A;  3KX1 A;  4QRG A;  1POP A;  3OVZ A;  4A5U A;  1PBH A;  2XU5 A;  1PXV A;  4AXL A;  2DOS A;  3PHX A;  1FH0 A;  4CZW A;  4MZO A;  3HHI A;  5EZS A;  3KW9 A;  3M99 A;  3WXF A;  4RF0 A;  1EWM A;  2VHF A;  3F75 A;  2AUX A;  4BOQ A;  5A24 A;  4G54 A;  4P16 A;  2DCD A;  4I07 A;  1EWP A;  3RVW A;  1U5I A;  2E03 A;  1QOL A;  1U9Q X;  2AGA A;  1MS6 A;  3E9S A;  3H8C A;  3QJ3 A;  4QRV A;  3B21 A;  4OEM A;  1SP4 B;  2FRA A;  1QXP A;  1AYW A;  3AI8 A;  3N4C A;  1YK8 A;  1TL9 A;  3OIS A;  1VSN A;  3P5W A;  2XU1 A;  3D6S A;  3BY4 A;  9PAP A;  1F2A A;  2AUZ A;  3I3T A;  3MJ5 A;  4Q8G A;  1Q6K A;  1UKF A;  1K3B B;  4PT5 A;  2C0Y A;  4PP2 E;  4YYS A;  3O0U A;  3HD3 A;  4YYR A;  1PPN A;  4IUM A;  4YYW A;  2B1N A;  2DC9 A;  2DZZ A;  1BP4 A;  4YYV A;  2GHU A;  3F5V A;  2HXZ A;  3U8E A;  2IPP B;  3OF8 A;  2JRI A;  3N3G A;  4GUA A;  2R9C A;  1ZCM A;  3PSE A;  2OP3 A;  2R9O A;  1CQD A;  3C0R A;  3PNR A;  1GLO A;  2NQI A;  2FUD A;  3ZNH A;  1TLO A;  3S3Q A;  2G7Y A;  1KXR A;  3IV2 A;  3WXE A;  1AEC A;  2O6X A;  2FT2 A;  4BSQ A;  1QMY A;  4XUI A;  3B79 A;  5F02 A;  2BU3 A;  3PT2 A;  4PAD A;  3IHP A;  3PDF A;  5EF4 A;  3H8B A;  3MHH A;  4R3D A;  1Y08 A;  1GCB A;  3LXS A;  2YJ8 A;  1KHQ A;  1S4V A;  4W4U A;  1YT7 A;  1PCI A;  3USV A;  4D8E A;  4BS5 A;  4KLB A;  7PCK A;  2F1G A;  1Y4H A;  1YAL A;  1F2C A;  4I05 A;  3WXG A;  2AVW A;  2E00 A;  4N8W A;  2E01 A;  4P6G A;  1GEC E;  1AU0 A;  3ERV A;  1ZIV A;  1ICF A;  2JQF R;  1YZB A;  2JQG R;  3CBJ A;  1PE6 A;  3TNX A;  4M0W A;  4XZX A;  3IMA A;  3PBH A;  5J94 A;  2Y6E A;  2YJ2 A;  4BPV A;  4I04 A;  2P7U A;  3RVX A;  2G6D A;  5E6J A;  1ME4 A;  1YK7 A;  1MDW A;  4MM3 B;  1CSB B;  1NLJ A;  1X9Y A;  3TRK A;  2G8E A;  1NB5 A;  2AYO A;  1BGO A;  5CVN B;  3PRM A;  3PHW A;  4ZUX U;  3KSE A;  1PPP A;  1NPZ A;  5JZE A;  3CBK A;  1HUC B;  1BY8 A;  2PAD A;  3PW3 A;  4MI7 A;  1AU3 A;  4N79 A;  3BB7 A;  2B1M A;  1PPO A;  3BPM A;  4QH6 A;  1A6R A;  1YVB A;  3V6C A;  3IFU A;  1U9V A;  2Z84 A;  3H89 A;  3KWB X;  4QBB A;  4PI3 A;  2H7J A;  3K24 A;  2DC7 A;  3MOR A;  5K16 A;  4MSX A;  1CTE A;  3BBA A;  4D8I A;  2YJ9 A;  2DZY A;  5CVM A;  1NB3 A;  3P5V A;  3QSD A;  2FTD A;  3N3K A;  3P5U A;  2GFO A;  3V6E A;  3H6S A;  3NHE A;  2R9F A;  2ACT A;  2BTW A;  3RNV A;  4BOS A;  4FK5 A;  4OVZ A;  4P6E A;  4BOP A;  3IOQ A;  5CVO B;  4W5B A;  1F29 A;  3BOW A;  1PVJ A;  3E1Z B;  2DJF B;  3DF0 A;  4BQV A;  2F7D A;  4BS6 A;  1ME3 A;  2R6N A;  2OZ2 A;  1VJV A;  2R9M A;  4DMY A;  2CIO A;  2UZJ A;  1AYU A;  2J7Q A;  4BOZ A;  3BCN A;  4CDD B;  2FE8 A;  5JA7 A;  1CVZ A;  4YVA A;  2AU1 A;  1GMY A;  3LFY A;  4QRX A;  1CS8 A;  3MTN A;  4OEL A;  4RNA A;  2DC6 A;  2YJB A;  3P5X A;  4K7C A;  4MZS A;  2DCB A;  4RY2 A;  2AIM A;  2G8J A;  1AU4 A;  4X6H A;  1JQP A;  1AYV A;  3HWN A;  2YJC A;  2PBH A;  4REZ A;  5JH3 A;  2HWK A;  1AIM A;  3IUT A;  1SNK A;  5FPW A;  4XR7 A;  2IBI A;  4OVZ B;  3BPF A;  2BDL A;  2JTC A;  3OF9 A; 
#chains in the Genus database with same CATH homology
 1U9X A;  1AU2 A;  3OVX A;  4YYU A;  1NL6 A;  1ITO A;  1EWO A;  2FQ9 A;  2P86 A;  6PAD A;  2WBF X;  1THE A;  3CH2 X;  4CDE B;  3GCB A;  2NQG A;  4GUZ A;  4N4Z A;  1EF7 A;  4DMX A;  2DC8 A;  2VFB A;  2FO5 A;  2CB5 A;  1CJL A;  3KKU A;  2BDZ A;  1KFU L;  3H7D A;  2PRE A;  2Y5B A;  3ZUA A;  5CHT A;  1CV8 A;  4Q8H A;  2FYE A;  2ARY A;  8PCH A;  1MEM A;  1BQI A;  3HHA A;  2HHN A;  2NQD B;  3KWZ A;  1STF E;  3K9M A;  4AXM A;  3MHS A;  2PNS A;  1F2B A;  2AS8 A;  1U9W A;  2DJG B;  2FRQ A;  2ATO A;  2XU3 A;  2AYN A;  5PAD A;  2XU4 A;  2P0R A;  4PP1 A;  1DEU A;  2HD5 A;  5CHV A;  2R9N A;  1KFX L;  4WA6 A;  1PAD A;  2DCA A;  2E02 A;  3C9E A;  4FIP A;  3KFQ A;  2VFC A;  1PPD A;  4X6I A;  1KHP A;  1XKG A;  2DCC A;  1DF0 A;  4BGF A;  2NQA A;  1IWD A;  1QDQ A;  1MIR A;  3K8U A;  4W5C A;  4YV8 A;  3S3R A;  3BWK A;  1CPJ A;  4HWY A;  4CDF B;  1EWL A;  3IEJ A;  1MEG A;  1W6F A;  2VHS A;  3D9W A;  4FJC A;  4CDC B;  3O1G A;  1CB5 A;  1O0E A;  4X6J A;  1MHW A;  1E2T A;  3I06 A;  3CH3 X;  1PIP A;  1NQC A;  3RVV A;  2OUL A;  1ATK A;  5EGW A;  3BC3 A;  4YYQ A;  1M6D A;  1TU6 A;  3QT4 A;  2HH5 A;  3KX1 A;  4QRG A;  1POP A;  3OVZ A;  1PBH A;  2XU5 A;  1PXV A;  1GX3 A;  4AXL A;  1FH0 A;  4CZW A;  4MZO A;  3HHI A;  3KW9 A;  3M99 A;  1W5R A;  3WXF A;  1EWM A;  2VHF A;  3F75 A;  2AUX A;  5A24 A;  4G54 A;  4C5P A;  2DCD A;  4I07 A;  1EWP A;  3RVW A;  1U5I A;  2E03 A;  1QOL A;  1U9Q X;  1MS6 A;  3H8C A;  3QJ3 A;  4QRV A;  4OEM A;  1SP4 B;  2FRA A;  1QXP A;  1AYW A;  3AI8 A;  3N4C A;  1YK8 A;  1TL9 A;  3OIS A;  1VSN A;  3P5W A;  2XU1 A;  3D6S A;  9PAP A;  1F2A A;  2AUZ A;  3I3T A;  4Q8G A;  1Q6K A;  1K3B B;  2C0Y A;  4PP2 E;  4YYS A;  3O0U A;  3HD3 A;  4YYR A;  1PPN A;  4YYW A;  2B1N A;  2DC9 A;  2DZZ A;  1BP4 A;  4YYV A;  2GHU A;  3F5V A;  2HXZ A;  3U8E A;  2IPP B;  3OF8 A;  3N3G A;  2R9C A;  1ZCM A;  2OP3 A;  2R9O A;  1CQD A;  3PNR A;  1GLO A;  2NQI A;  2FUD A;  4B55 A;  1TLO A;  3S3Q A;  2G7Y A;  1KXR A;  3IV2 A;  3WXE A;  1AEC A;  2O6X A;  2FT2 A;  4BSQ A;  1QMY A;  4XUI A;  3B79 A;  5F02 A;  4PAD A;  3IHP A;  3PDF A;  5EF4 A;  3H8B A;  3MHH A;  1Y08 A;  1GCB A;  3LXS A;  2YJ8 A;  1KHQ A;  1S4V A;  4W4U A;  1YT7 A;  1PCI A;  3USV A;  4BS5 A;  4KLB A;  7PCK A;  2F1G A;  1Y4H A;  1YAL A;  1F2C A;  4I05 A;  3WXG A;  2AVW A;  2E00 A;  4N8W A;  2E01 A;  4P6G A;  1W4T A;  1GEC E;  1AU0 A;  3ERV A;  1ZIV A;  1ICF A;  2JQF R;  2JQG R;  3CBJ A;  1PE6 A;  3TNX A;  2BSZ A;  3IMA A;  3PBH A;  5J94 A;  2Y6E A;  2YJ2 A;  4BPV A;  4I04 A;  2P7U A;  3RVX A;  2G6D A;  1ME4 A;  1YK7 A;  1MDW A;  1CSB B;  1NLJ A;  1X9Y A;  2G8E A;  1NB5 A;  2AYO A;  4NV7 A;  1BGO A;  5CVN B;  4ZUX U;  3KSE A;  1PPP A;  1NPZ A;  3CBK A;  1HUC B;  1BY8 A;  2PAD A;  3PW3 A;  1AU3 A;  4N79 A;  2B1M A;  1PPO A;  3BPM A;  4QH6 A;  1A6R A;  1YVB A;  3V6C A;  1U9V A;  3H89 A;  3KWB X;  4QBB A;  4PI3 A;  2H7J A;  3K24 A;  2DC7 A;  3MOR A;  5K16 A;  4MSX A;  1CTE A;  2YJ9 A;  2DZY A;  5CVM A;  1NB3 A;  3P5V A;  3QSD A;  2FTD A;  3N3K A;  3P5U A;  2GFO A;  3V6E A;  3H6S A;  3NHE A;  2R9F A;  2ACT A;  4FK5 A;  4P6E A;  3IOQ A;  5CVO B;  4W5B A;  1F29 A;  3BOW A;  3E1Z B;  2DJF B;  3DF0 A;  4BQV A;  2F7D A;  3LTW A;  4BS6 A;  1ME3 A;  2R6N A;  2OZ2 A;  1VJV A;  2R9M A;  4DMY A;  2CIO A;  4NV8 A;  1AYU A;  3BCN A;  4CDD B;  5JA7 A;  1CVZ A;  4YVA A;  2AU1 A;  1GMY A;  3LFY A;  4QRX A;  1CS8 A;  3MTN A;  4OEL A;  2DC6 A;  2YJB A;  3P5X A;  4K7C A;  4MZS A;  2DCB A;  4RY2 A;  2AIM A;  2G8J A;  1AU4 A;  4X6H A;  1JQP A;  1AYV A;  3HWN A;  2YJC A;  2PBH A;  5JH3 A;  1AIM A;  3IUT A;  1SNK A;  5FPW A;  4XR7 A;  2IBI A;  3BPF A;  2BDL A;  3OF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...