4Q8GA

Structure of the saccharomyces cerevisiae pan2 pseudoubiquitin-hydrolase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
403
structure length
344
Chain Sequence
TSDIQTYTSINKYEVPPAYSRLPLTFDFTPFNNTEYSGLDPDVDNHYTNAIIQLYRFIPEMFNFVVGCLKDTTLLTDLGYLFDMMERSHGKICSSSNFQASLKSLTSIKRNMPQKFNRFLLSQLIKEEAQTVNHNITLNQCFGLETEIRTECSCDHYDTTVKLLPSLSISGINQNILPYIEYAMKNVTQKNSICPTCGKTETITQECTVKNLPSVLSLELSLLDTEFSNIRSSKNWLTSEFYGSIIKNKAVLRSTASELKGTSHIFKYELNGYVAKITDNNNETRLVTYVKKYNPKENCFKWLMFNDYLVVEITEEEALKMTYPWKTPEIIIYCDAEELRKPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PAB-dependent poly(A)-specific ribonuclease subunit PAN2
publication title The structure of the Pan2-Pan3 core complex reveals cross-talk between deadenylase and pseudokinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 98
structure length 344
sequence length 403
chains with identical sequence B
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2014-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4q8gA00
3RVWA 2PREA 3BPMA 3M99A 5CVNB 4X6JA 2DC7A 3P5UA 1SP4B 1PADA 1EWLA 2ATOA 3CH2X 4P6EA 4QRGA 2YJ8A 1ITOA 4G54A 1PPPA 2DZYA 3S3QA 3N3GA 2G6DA 4HWYA 2Y6EA 5EGWA 3KSEA 3K8UA 4K7CA 3IOQA 4FK5A 1PBHA 1KHQA 1MEMA 4N4ZA 3HHAA 2OZ2A 3RVXA 4YYVA 1TU6A 2XU1A 1PCIA 1AU2A 2XU4A 1ME4A 4ZUXU 4YVAA 2DZZA 4XUIA 2VHFA 4CDCB 2FTDA 2C0YA 4BS6A 1PPNA 1YK8A 1U9QX 3V6EA 4QBBA 4X6HA 4RY2A 3P5WA 4YYWA 3KFQA 1CSBB 1MS6A 2PADA 2FRAA 3ERVA 3K9MA 4YYSA 3U8EA 1ICFA 3LFYA 5CHTA 2YJ9A 4DMXA 3H89A 1U9XA 3DF0A 2XU3A 2AYNA 1GECE 1MEGA 3KX1A 1VJVA 2NQAA 1TLOA 3KWZA 5JH3A 2R9MA 2P7UA 1ATKA 5FPWA 2AYOA 3PW3A 2DCAA 2R9CA 2PNSA 1KFUL 2R9FA 4Q8HA 2P0RA 1F29A 2B1MA 3KW9A 1U9VA 6PADA 4X6IA 2GHUA 3QSDA 2IPPB 3WXFA 4DMYA 1NQCA 1S4VA 3H8CA 2AIMA 2HH5A 3OVXA 3IV2A 2AUXA 3IHPA 5K16A 2HHNA 2P86A 4CDEB 1ZCMA 1HUCB 2E01A 1O0EA 3O0UA 3C9EA 1TL9A 1NLJA 1THEA 2YJBA 3USVA 3I06A 1GCBA 2B1NA 2CIOA 1EWMA 3IUTA 3OF8A 2YJ2A 3N4CA 1F2BA 1ZIVA 1AECA 3LXSA 1EWPA 2BDLA 5JA7A 5J94A 1U5IA 1PPDA 3GCBA 3QJ3A 2DC8A 1GLOA 1SNKA 2R6NA 1MDWA 1AU0A 4N79A 2AU1A 4CDFB 2FQ9A 3KWBX 1PPOA 1PE6A 2E02A 4PP1A 4MZOA 3F5VA 1AU3A 2AS8A 2JQFR 4W5BA 4BPVA 2ACTA 1BQIA 4BSQA 3K24A 1YVBA 3S3RA 1KHPA 2HD5A 2AVWA 1JQPA 1YT7A 2FYEA 3H7DA 1EF7A 3PNRA 3BWKA 2FT2A 3N3KA 2PBHA 2YJCA 1QXPA 4I07A 1MHWA 1CTEA 4WA6A 1GMYA 3D6SA 3BPFA 3V6CA 3OF9A 3AI8A 4QRVA 4W5CA 2E00A 1NB3A 8PCHA 1A6RA 3CBKA 1DEUA 2GFOA 1CQDA 4YYQA 1AIMA 4I04A 3WXEA 4XR7A 2F7DA 4PADA 3P5VA 4P6GA 3H6SA 2DJGB 3MHHA 5CVOB 1NB5A 4FJCA 1AYWA 3BOWA 2FRQA 1K3BB 1QDQA 3MORA 4KLBA 2R9NA 1CVZA 1CB5A 1IWDA 2AUZA 4MZSA 2VHSA 3TNXA 4BS5A 1QMYA 2R9OA 2ARYA 3HWNA 4YYRA 1F2CA 4AXMA 1X9YA 4AXLA 3F75A 4YYUA 3IEJA 1KFXL 1CV8A 4OEMA 1FH0A 3BC3A 2OP3A 1YK7A 4N8WA 1CJLA 3ZUAA 5CHVA 3MTNA 2FO5A 1VSNA 4FIPA 3H8BA 5CVMA 3OISA 1PXVA 1AU4A 1CS8A 1CPJA 1STFE 3I3TA 1AYVA 2G7YA 1KXRA 2HXZA 2NQDB 1POPA 9PAPA 5A24A 4CDDB 2IBIA 3KKUA 4YV8A 2F1GA 1NL6A 1U9WA 4Q8GA 5PADA 1BGOA 2O6XA 2XU5A 1Q6KA 2FUDA 3CBJA 3MHSA 3NHEA 4MSXA 3PDFA 1PIPA 3RVVA 1BY8A 4QRXA 1Y4HA 2DJFB 3E1ZB 1AYUA 1DF0A 2DC6A 3HHIA 3BCNA 3PBHA 1YALA 4I05A 3WXGA 7PCKA 1F2AA 2G8EA 3QT4A 2OULA 2Y5BA 1Y08A 1ME3A 1NPZA 1MIRA 3P5XA 2WBFX 2DCCA 1XKGA 3IMAA 2DC9A 1QOLA 3B79A 2CB5A 4W4UA 3O1GA 4OELA 4QH6A 2E03A 2H7JA 2G8JA 2JQGR 2NQIA 3OVZA 4BQVA 2BDZA 1M6DA 5EF4A 2DCBA 2DCDA 4PP2E 4PI3A 3CH3X 4CZWA 1EWOA 2NQGA 5F02A 1BP4A 3HD3A
chains in the Genus database with same CATH superfamily
3RVWA 2PREA 3BPMA 3ZNHA 3M99A 5CVNB 4X6JA 2DC7A 3P5UA 4RF1A 5EZSA 1SP4B 1PADA 1EWLA 2ATOA 2Z84A 4D8IA 3CH2X 4P6EA 3BY4A 4QRGA 2YJ8A 1ITOA 4G54A 1PPPA 2DZYA 3S3QA 3N3GA 2G6DA 4HWYA 2Y6EA 5EGWA 3KSEA 3TRKA 3K8UA 3BB7A 4FK5A 3IOQA 4K7CA 5E6JA 1PBHA 1KHQA 1MEMA 4N4ZA 3HHAA 2OZ2A 3RVXA 4YYVA 1TU6A 2XU1A 4RF0A 1PCIA 5JZEA 1AU2A 2XU4A 1ME4A 4BOUA 4ZUXU 4YVAA 2DZZA 4XUIA 2VHFA 4CDCB 2FTDA 2J7QC 2C0YA 4BS6A 4REZA 1PPNA 1YK8A 1U9QX 3OQCA 3V6EA 4QBBA 4X6HA 4RY2A 3P5WA 4YYWA 3KFQA 1CSBB 1MS6A 2PADA 2FRAA 3ERVA 3K9MA 4YYSA 3U8EA 1ICFA 3LFYA 5CHTA 2YJ9A 4DMXA 3H89A 2FE8A 1U9XA 3DF0A 2JRIA 2XU3A 2AYNA 1GECE 1MEGA 3KX1A 3B21A 1VJVA 2NQAA 4IP3A 1TLOA 3KWZA 5JH3A 2R9MA 2P7UA 1ATKA 5FPWA 2AYOA 3PW3A 4BOZA 2DCAA 2R9CA 2PNSA 1KFUL 2R9FA 4Q8HA 2P0RA 1F29A 2B1MA 2DOSA 3KW9A 1U9VA 6PADA 4X6IA 2GHUA 3QSDA 2IPPB 3RNVA 3WXFA 4DMYA 1NQCA 1S4VA 3PSEA 3H8CA 2AIMA 2HH5A 4R3DA 3W31A 3OVXA 3IV2A 2AUXA 3IHPA 5K16A 2HHNA 3PRPA 2P86A 4CDEB 1ZCMA 1HUCB 2E01A 1O0EA 3O0UA 5KO3A 4D8EA 3C9EA 1TL9A 1NLJA 1THEA 2YJBA 3USVA 3I06A 1GCBA 3MTVA 2B1NA 1DKIA 2CIOA 1EWMA 3IUTA 3OF8A 2YJ2A 3N4CA 1F2BA 1ZIVA 1AECA 3LXSA 1EWPA 2BDLA 4XZXA 5JA7A 5J94A 1U5IA 1PPDA 4OW0A 3GCBA 3QJ3A 2DC8A 1GLOA 1SNKA 2R6NA 4ZTBA 1MDWA 1AU0A 4N79A 3E9SA 2AU1A 4CDFB 3PHXA 2FQ9A 3KWBX 1PPOA 1PE6A 2E02A 3O65A 4PP1A 4BOQA 4MZOA 3F5VA 1AU3A 2AS8A 2JQFR 2AGAA 3IFUA 4W5BA 4BPVA 2ACTA 1BQIA 4BSQA 3K24A 1YVBA 3S3RA 1KHPA 2HD5A 2AVWA 1JQPA 1YT7A 2FYEA 4M0WA 3H7DA 1EF7A 3PNRA 3BWKA 2FT2A 3C0RA 3N3KA 4D8BA 2PBHA 2YJCA 1QXPA 4BOPA 4I07A 1MHWA 1CTEA 4WA6A 1GMYA 3D6SA 3BPFA 3V6CA 3OF9A 3AI8A 4QRVA 3TMPA 4W5CA 4OVZB 2E00A 4IUMA 1NB3A 3W30A 8PCHA 4HXDB 1A6RA 3CBKA 1DEUA 2GFOA 1CQDA 3MP2A 4YYQA 2BTWB 1AIMA 1PVJA 4I04A 3WXEA 4XR7A 2F7DA 4GUAA 4PADA 1YZBA 3P5VA 4P6GA 3MJ5A 3H6SA 2DJGB 4MI7A 3MHHA 5CVOB 4P16A 1NB5A 4FJCA 3PRMA 1AYWA 3BOWA 4OVZA 2FRQA 1K3BB 1QDQA 2UZJA 3MORA 4KLBA 2R9NA 1CVZA 1CB5A 1IWDA 2AUZA 2BTWA 4MZSA 2VHSA 3TNXA 4BS5A 1QMYA 2R9OA 2ARYA 3HWNA 4YYRA 1F2CA 4AXMA 1X9YA 3PHWA 4AXLA 3F75A 4YYUA 3IEJA 1KFXL 1CV8A 4OEMA 1FH0A 3BC3A 2OP3A 1YK7A 4N8WA 1CJLA 3ZUAA 5CHVA 3MTNA 2FO5A 1VSNA 4FIPA 3H8BA 5CVMA 3OISA 1PXVA 1AU4A 1CS8A 1CPJA 2J7QA 5EZQA 1STFE 3PT2A 3I3TA 1AYVA 2G7YA 4PT5A 1KXRA 2HXZA 2NQDB 1POPA 9PAPA 5A24A 4CDDB 2IBIA 3KKUA 4YV8A 2F1GA 4MM3B 1NL6A 1U9WA 4Q8GA 5PADA 1BGOA 3PHUA 2O6XA 4RKXA 2BU3A 2XU5A 1Q6KA 2FUDA 3CBJA 4WURA 3MHSA 3NHEA 4MSXA 3PDFA 1PIPA 3RVVA 1BY8A 4QRXA 1Y4HA 2DJFB 4A5UA 3E1ZB 1AYUA 1DF0A 2DC6A 3HHIA 3BCNA 3PBHA 1YALA 4I05A 3WXGA 7PCKA 1F2AA 2G8EA 3QT4A 2OULA 1UKFA 2Y5BA 3BBAA 1Y08A 1ME3A 1NPZA 4BOSA 1MIRA 3P5XA 2WBFX 2JTCA 2DCCA 1XKGA 3IMAA 2HWKA 2DC9A 1QOLA 3B79A 2CB5A 4W4UA 3O1GA 4OELA 4QH6A 2E03A 2H7JA 2G8JA 2JQGR 2NQIA 3OVZA 4BQVA 4RNAA 2BDZA 1M6DA 5EF4A 2DCBA 2DCDA 4PP2E 4PI3A 3CH3X 4CZWA 1EWOA 2NQGA 5F02A 1BP4A 3HD3A
chains in the Genus database with same CATH topology
3RVWA 2PREA 3BPMA 1W5RA 3M99A 5CVNB 4X6JA 2DC7A 3P5UA 4NV8A 1SP4B 1PADA 1EWLA 2ATOA 3CH2X 4P6EA 4QRGA 2YJ8A 1ITOA 4G54A 1PPPA 2DZYA 3S3QA 3N3GA 2G6DA 4HWYA 2Y6EA 5EGWA 3KSEA 3K8UA 4K7CA 3IOQA 4FK5A 1PBHA 1KHQA 1MEMA 4N4ZA 3HHAA 2OZ2A 3RVXA 4YYVA 1TU6A 2XU1A 1PCIA 1AU2A 2XU4A 1ME4A 4ZUXU 4YVAA 2DZZA 4XUIA 2VHFA 4CDCB 2FTDA 3D9WA 2C0YA 4BS6A 1PPNA 1E2TA 1YK8A 1U9QX 3V6EA 4QBBA 4X6HA 4RY2A 3P5WA 4YYWA 3KFQA 1CSBB 1MS6A 2PADA 2FRAA 3ERVA 3K9MA 4YYSA 3U8EA 1ICFA 3LFYA 5CHTA 2YJ9A 4DMXA 3H89A 1U9XA 3DF0A 2XU3A 2AYNA 1GECE 1MEGA 3KX1A 3LTWA 1VJVA 2NQAA 1TLOA 3KWZA 5JH3A 2R9MA 2P7UA 1ATKA 5FPWA 2AYOA 3PW3A 2DCAA 2R9CA 2PNSA 1KFUL 2R9FA 4Q8HA 2P0RA 1F29A 2B1MA 3KW9A 1U9VA 6PADA 4X6IA 2GHUA 3QSDA 2IPPB 3WXFA 4DMYA 1NQCA 1S4VA 3H8CA 2AIMA 2HH5A 3OVXA 3IV2A 2AUXA 3IHPA 5K16A 2HHNA 2VFBA 2P86A 4CDEB 1ZCMA 1HUCB 2E01A 1O0EA 3O0UA 3C9EA 1TL9A 1NLJA 1THEA 2YJBA 3USVA 3I06A 1GCBA 2B1NA 2CIOA 1EWMA 3IUTA 3OF8A 2YJ2A 3N4CA 1F2BA 1ZIVA 1AECA 3LXSA 1EWPA 2BDLA 5JA7A 5J94A 1U5IA 1PPDA 3GCBA 3QJ3A 2DC8A 1GLOA 1SNKA 4C5PA 2R6NA 1MDWA 1AU0A 4N79A 2AU1A 4CDFB 2FQ9A 3KWBX 1PPOA 1PE6A 2E02A 4PP1A 4MZOA 3F5VA 1AU3A 2AS8A 2JQFR 4W5BA 1W6FA 4BPVA 2ACTA 1BQIA 4B55A 4BSQA 3K24A 1YVBA 3S3RA 1KHPA 2HD5A 2AVWA 1JQPA 1YT7A 2FYEA 3H7DA 1EF7A 1W4TA 3PNRA 3BWKA 2FT2A 3N3KA 2PBHA 2YJCA 1QXPA 4I07A 1MHWA 1CTEA 4WA6A 1GMYA 3D6SA 3BPFA 3V6CA 3OF9A 3AI8A 4QRVA 4W5CA 2E00A 1NB3A 8PCHA 1A6RA 3CBKA 1DEUA 2GFOA 1CQDA 4YYQA 1AIMA 4I04A 3WXEA 4XR7A 2F7DA 4PADA 3P5VA 4P6GA 3H6SA 2DJGB 3MHHA 4NV7A 5CVOB 2VFCA 1NB5A 4FJCA 1AYWA 3BOWA 4BGFA 2FRQA 1K3BB 1QDQA 3MORA 4KLBA 2R9NA 1CVZA 1CB5A 1IWDA 2AUZA 4MZSA 2VHSA 3TNXA 4BS5A 1QMYA 2R9OA 2ARYA 3HWNA 4YYRA 1F2CA 4AXMA 1X9YA 4AXLA 3F75A 4YYUA 3IEJA 1KFXL 1CV8A 4OEMA 1FH0A 3BC3A 2OP3A 1YK7A 4N8WA 1CJLA 3ZUAA 5CHVA 3MTNA 2FO5A 1VSNA 4FIPA 3H8BA 5CVMA 3OISA 1PXVA 1AU4A 1CS8A 1CPJA 1STFE 3I3TA 1AYVA 2G7YA 1GX3A 1KXRA 2HXZA 2NQDB 1POPA 9PAPA 5A24A 4CDDB 2IBIA 3KKUA 4YV8A 2F1GA 1NL6A 1U9WA 4Q8GA 5PADA 1BGOA 2O6XA 2XU5A 1Q6KA 2BSZA 2FUDA 3CBJA 3MHSA 3NHEA 4MSXA 3PDFA 1PIPA 3RVVA 1BY8A 4QRXA 1Y4HA 2DJFB 3E1ZB 1AYUA 1DF0A 2DC6A 3HHIA 3BCNA 3PBHA 1YALA 4I05A 3WXGA 7PCKA 1F2AA 2G8EA 3QT4A 4GUZA 2OULA 2Y5BA 1Y08A 1ME3A 1NPZA 1MIRA 3P5XA 2WBFX 2DCCA 1XKGA 3IMAA 2DC9A 1QOLA 3B79A 2CB5A 4W4UA 3O1GA 4OELA 4QH6A 2E03A 2H7JA 2G8JA 2JQGR 2NQIA 3OVZA 4BQVA 2BDZA 1M6DA 5EF4A 2DCBA 2DCDA 4PP2E 4PI3A 3CH3X 4CZWA 1EWOA 2NQGA 5F02A 1BP4A 3HD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVW A;  2PRE A;  3BPM A;  3M99 A;  5CVN B;  4X6J A;  2DC7 A;  3P5U A;  1SP4 B;  1PAD A;  1EWL A;  2ATO A;  3CH2 X;  4P6E A;  4QRG A;  2YJ8 A;  1ITO A;  4G54 A;  1PPP A;  2DZY A;  3S3Q A;  3N3G A;  2G6D A;  4HWY A;  2Y6E A;  5EGW A;  3KSE A;  3K8U A;  4K7C A;  3IOQ A;  4FK5 A;  1PBH A;  1KHQ A;  1MEM A;  4N4Z A;  3HHA A;  2OZ2 A;  3RVX A;  4YYV A;  1TU6 A;  2XU1 A;  1PCI A;  1AU2 A;  2XU4 A;  1ME4 A;  4ZUX U;  4YVA A;  2DZZ A;  4XUI A;  2VHF A;  4CDC B;  2FTD A;  2C0Y A;  4BS6 A;  1PPN A;  1YK8 A;  1U9Q X;  3V6E A;  4QBB A;  4X6H A;  4RY2 A;  3P5W A;  4YYW A;  3KFQ A;  1CSB B;  1MS6 A;  2PAD A;  2FRA A;  3ERV A;  3K9M A;  4YYS A;  3U8E A;  1ICF A;  3LFY A;  5CHT A;  2YJ9 A;  4DMX A;  3H89 A;  1U9X A;  3DF0 A;  2XU3 A;  2AYN A;  1GEC E;  1MEG A;  3KX1 A;  1VJV A;  2NQA A;  1TLO A;  3KWZ A;  5JH3 A;  2R9M A;  2P7U A;  1ATK A;  5FPW A;  2AYO A;  3PW3 A;  2DCA A;  2R9C A;  2PNS A;  1KFU L;  2R9F A;  4Q8H A;  2P0R A;  1F29 A;  2B1M A;  3KW9 A;  1U9V A;  6PAD A;  4X6I A;  2GHU A;  3QSD A;  2IPP B;  3WXF A;  4DMY A;  1NQC A;  1S4V A;  3H8C A;  2AIM A;  2HH5 A;  3OVX A;  3IV2 A;  2AUX A;  3IHP A;  5K16 A;  2HHN A;  2P86 A;  4CDE B;  1ZCM A;  1HUC B;  2E01 A;  1O0E A;  3O0U A;  3C9E A;  1TL9 A;  1NLJ A;  1THE A;  2YJB A;  3USV A;  3I06 A;  1GCB A;  2B1N A;  2CIO A;  1EWM A;  3IUT A;  3OF8 A;  2YJ2 A;  3N4C A;  1F2B A;  1ZIV A;  1AEC A;  3LXS A;  1EWP A;  2BDL A;  5JA7 A;  5J94 A;  1U5I A;  1PPD A;  3GCB A;  3QJ3 A;  2DC8 A;  1GLO A;  1SNK A;  2R6N A;  1MDW A;  1AU0 A;  4N79 A;  2AU1 A;  4CDF B;  2FQ9 A;  3KWB X;  1PPO A;  1PE6 A;  2E02 A;  4PP1 A;  4MZO A;  3F5V A;  1AU3 A;  2AS8 A;  2JQF R;  4W5B A;  4BPV A;  2ACT A;  1BQI A;  4BSQ A;  3K24 A;  1YVB A;  3S3R A;  1KHP A;  2HD5 A;  2AVW A;  1JQP A;  1YT7 A;  2FYE A;  3H7D A;  1EF7 A;  3PNR A;  3BWK A;  2FT2 A;  3N3K A;  2PBH A;  2YJC A;  1QXP A;  4I07 A;  1MHW A;  1CTE A;  4WA6 A;  1GMY A;  3D6S A;  3BPF A;  3V6C A;  3OF9 A;  3AI8 A;  4QRV A;  4W5C A;  2E00 A;  1NB3 A;  8PCH A;  1A6R A;  3CBK A;  1DEU A;  2GFO A;  1CQD A;  4YYQ A;  1AIM A;  4I04 A;  3WXE A;  4XR7 A;  2F7D A;  4PAD A;  3P5V A;  4P6G A;  3H6S A;  2DJG B;  3MHH A;  5CVO B;  1NB5 A;  4FJC A;  1AYW A;  3BOW A;  2FRQ A;  1K3B B;  1QDQ A;  3MOR A;  4KLB A;  2R9N A;  1CVZ A;  1CB5 A;  1IWD A;  2AUZ A;  4MZS A;  2VHS A;  3TNX A;  4BS5 A;  1QMY A;  2R9O A;  2ARY A;  3HWN A;  4YYR A;  1F2C A;  4AXM A;  1X9Y A;  4AXL A;  3F75 A;  4YYU A;  3IEJ A;  1KFX L;  1CV8 A;  4OEM A;  1FH0 A;  3BC3 A;  2OP3 A;  1YK7 A;  4N8W A;  1CJL A;  3ZUA A;  5CHV A;  3MTN A;  2FO5 A;  1VSN A;  4FIP A;  3H8B A;  5CVM A;  3OIS A;  1PXV A;  1AU4 A;  1CS8 A;  1CPJ A;  1STF E;  3I3T A;  1AYV A;  2G7Y A;  1KXR A;  2HXZ A;  2NQD B;  1POP A;  9PAP A;  5A24 A;  4CDD B;  2IBI A;  3KKU A;  4YV8 A;  2F1G A;  1NL6 A;  1U9W A;  4Q8G A;  5PAD A;  1BGO A;  2O6X A;  2XU5 A;  1Q6K A;  2FUD A;  3CBJ A;  3MHS A;  3NHE A;  4MSX A;  3PDF A;  1PIP A;  3RVV A;  1BY8 A;  4QRX A;  1Y4H A;  2DJF B;  3E1Z B;  1AYU A;  1DF0 A;  2DC6 A;  3HHI A;  3BCN A;  3PBH A;  1YAL A;  4I05 A;  3WXG A;  7PCK A;  1F2A A;  2G8E A;  3QT4 A;  2OUL A;  2Y5B A;  1Y08 A;  1ME3 A;  1NPZ A;  1MIR A;  3P5X A;  2WBF X;  2DCC A;  1XKG A;  3IMA A;  2DC9 A;  1QOL A;  3B79 A;  2CB5 A;  4W4U A;  3O1G A;  4OEL A;  4QH6 A;  2E03 A;  2H7J A;  2G8J A;  2JQG R;  2NQI A;  3OVZ A;  4BQV A;  2BDZ A;  1M6D A;  5EF4 A;  2DCB A;  2DCD A;  4PP2 E;  4PI3 A;  3CH3 X;  4CZW A;  1EWO A;  2NQG A;  5F02 A;  1BP4 A;  3HD3 A; 
#chains in the Genus database with same CATH topology
 3RVW A;  2PRE A;  3BPM A;  3ZNH A;  3M99 A;  5CVN B;  4X6J A;  2DC7 A;  3P5U A;  4RF1 A;  5EZS A;  1SP4 B;  1PAD A;  1EWL A;  2ATO A;  2Z84 A;  4D8I A;  3CH2 X;  4P6E A;  3BY4 A;  4QRG A;  2YJ8 A;  1ITO A;  4G54 A;  1PPP A;  2DZY A;  3S3Q A;  3N3G A;  2G6D A;  4HWY A;  2Y6E A;  5EGW A;  3KSE A;  3TRK A;  3K8U A;  3BB7 A;  4FK5 A;  3IOQ A;  4K7C A;  5E6J A;  1PBH A;  1KHQ A;  1MEM A;  4N4Z A;  3HHA A;  2OZ2 A;  3RVX A;  4YYV A;  1TU6 A;  2XU1 A;  4RF0 A;  1PCI A;  5JZE A;  1AU2 A;  2XU4 A;  1ME4 A;  4BOU A;  4ZUX U;  4YVA A;  2DZZ A;  4XUI A;  2VHF A;  4CDC B;  2FTD A;  2J7Q C;  2C0Y A;  4BS6 A;  4REZ A;  1PPN A;  1YK8 A;  1U9Q X;  3OQC A;  3V6E A;  4QBB A;  4X6H A;  4RY2 A;  3P5W A;  4YYW A;  3KFQ A;  1CSB B;  1MS6 A;  2PAD A;  2FRA A;  3ERV A;  3K9M A;  4YYS A;  3U8E A;  1ICF A;  3LFY A;  5CHT A;  2YJ9 A;  4DMX A;  3H89 A;  2FE8 A;  1U9X A;  3DF0 A;  2JRI A;  2XU3 A;  2AYN A;  1GEC E;  1MEG A;  3KX1 A;  3B21 A;  1VJV A;  2NQA A;  4IP3 A;  1TLO A;  3KWZ A;  5JH3 A;  2R9M A;  2P7U A;  1ATK A;  5FPW A;  2AYO A;  3PW3 A;  4BOZ A;  2DCA A;  2R9C A;  2PNS A;  1KFU L;  2R9F A;  4Q8H A;  2P0R A;  1F29 A;  2B1M A;  2DOS A;  3KW9 A;  1U9V A;  6PAD A;  4X6I A;  2GHU A;  3QSD A;  2IPP B;  3RNV A;  3WXF A;  4DMY A;  1NQC A;  1S4V A;  3PSE A;  3H8C A;  2AIM A;  2HH5 A;  4R3D A;  3W31 A;  3OVX A;  3IV2 A;  2AUX A;  3IHP A;  5K16 A;  2HHN A;  3PRP A;  2P86 A;  4CDE B;  1ZCM A;  1HUC B;  2E01 A;  1O0E A;  3O0U A;  5KO3 A;  4D8E A;  3C9E A;  1TL9 A;  1NLJ A;  1THE A;  2YJB A;  3USV A;  3I06 A;  1GCB A;  3MTV A;  2B1N A;  1DKI A;  2CIO A;  1EWM A;  3IUT A;  3OF8 A;  2YJ2 A;  3N4C A;  1F2B A;  1ZIV A;  1AEC A;  3LXS A;  1EWP A;  2BDL A;  4XZX A;  5JA7 A;  5J94 A;  1U5I A;  1PPD A;  4OW0 A;  3GCB A;  3QJ3 A;  2DC8 A;  1GLO A;  1SNK A;  2R6N A;  4ZTB A;  1MDW A;  1AU0 A;  4N79 A;  3E9S A;  2AU1 A;  4CDF B;  3PHX A;  2FQ9 A;  3KWB X;  1PPO A;  1PE6 A;  2E02 A;  3O65 A;  4PP1 A;  4BOQ A;  4MZO A;  3F5V A;  1AU3 A;  2AS8 A;  2JQF R;  2AGA A;  3IFU A;  4W5B A;  4BPV A;  2ACT A;  1BQI A;  4BSQ A;  3K24 A;  1YVB A;  3S3R A;  1KHP A;  2HD5 A;  2AVW A;  1JQP A;  1YT7 A;  2FYE A;  4M0W A;  3H7D A;  1EF7 A;  3PNR A;  3BWK A;  2FT2 A;  3C0R A;  3N3K A;  4D8B A;  2PBH A;  2YJC A;  1QXP A;  4BOP A;  4I07 A;  1MHW A;  1CTE A;  4WA6 A;  1GMY A;  3D6S A;  3BPF A;  3V6C A;  3OF9 A;  3AI8 A;  4QRV A;  3TMP A;  4W5C A;  4OVZ B;  2E00 A;  4IUM A;  1NB3 A;  3W30 A;  8PCH A;  4HXD B;  1A6R A;  3CBK A;  1DEU A;  2GFO A;  1CQD A;  3MP2 A;  4YYQ A;  2BTW B;  1AIM A;  1PVJ A;  4I04 A;  3WXE A;  4XR7 A;  2F7D A;  4GUA A;  4PAD A;  1YZB A;  3P5V A;  4P6G A;  3MJ5 A;  3H6S A;  2DJG B;  4MI7 A;  3MHH A;  5CVO B;  4P16 A;  1NB5 A;  4FJC A;  3PRM A;  1AYW A;  3BOW A;  4OVZ A;  2FRQ A;  1K3B B;  1QDQ A;  2UZJ A;  3MOR A;  4KLB A;  2R9N A;  1CVZ A;  1CB5 A;  1IWD A;  2AUZ A;  2BTW A;  4MZS A;  2VHS A;  3TNX A;  4BS5 A;  1QMY A;  2R9O A;  2ARY A;  3HWN A;  4YYR A;  1F2C A;  4AXM A;  1X9Y A;  3PHW A;  4AXL A;  3F75 A;  4YYU A;  3IEJ A;  1KFX L;  1CV8 A;  4OEM A;  1FH0 A;  3BC3 A;  2OP3 A;  1YK7 A;  4N8W A;  1CJL A;  3ZUA A;  5CHV A;  3MTN A;  2FO5 A;  1VSN A;  4FIP A;  3H8B A;  5CVM A;  3OIS A;  1PXV A;  1AU4 A;  1CS8 A;  1CPJ A;  2J7Q A;  5EZQ A;  1STF E;  3PT2 A;  3I3T A;  1AYV A;  2G7Y A;  4PT5 A;  1KXR A;  2HXZ A;  2NQD B;  1POP A;  9PAP A;  5A24 A;  4CDD B;  2IBI A;  3KKU A;  4YV8 A;  2F1G A;  4MM3 B;  1NL6 A;  1U9W A;  4Q8G A;  5PAD A;  1BGO A;  3PHU A;  2O6X A;  4RKX A;  2BU3 A;  2XU5 A;  1Q6K A;  2FUD A;  3CBJ A;  4WUR A;  3MHS A;  3NHE A;  4MSX A;  3PDF A;  1PIP A;  3RVV A;  1BY8 A;  4QRX A;  1Y4H A;  2DJF B;  4A5U A;  3E1Z B;  1AYU A;  1DF0 A;  2DC6 A;  3HHI A;  3BCN A;  3PBH A;  1YAL A;  4I05 A;  3WXG A;  7PCK A;  1F2A A;  2G8E A;  3QT4 A;  2OUL A;  1UKF A;  2Y5B A;  3BBA A;  1Y08 A;  1ME3 A;  1NPZ A;  4BOS A;  1MIR A;  3P5X A;  2WBF X;  2JTC A;  2DCC A;  1XKG A;  3IMA A;  2HWK A;  2DC9 A;  1QOL A;  3B79 A;  2CB5 A;  4W4U A;  3O1G A;  4OEL A;  4QH6 A;  2E03 A;  2H7J A;  2G8J A;  2JQG R;  2NQI A;  3OVZ A;  4BQV A;  4RNA A;  2BDZ A;  1M6D A;  5EF4 A;  2DCB A;  2DCD A;  4PP2 E;  4PI3 A;  3CH3 X;  4CZW A;  1EWO A;  2NQG A;  5F02 A;  1BP4 A;  3HD3 A; 
#chains in the Genus database with same CATH homology
 3RVW A;  2PRE A;  3BPM A;  1W5R A;  3M99 A;  5CVN B;  4X6J A;  2DC7 A;  3P5U A;  4NV8 A;  1SP4 B;  1PAD A;  1EWL A;  2ATO A;  3CH2 X;  4P6E A;  4QRG A;  2YJ8 A;  1ITO A;  4G54 A;  1PPP A;  2DZY A;  3S3Q A;  3N3G A;  2G6D A;  4HWY A;  2Y6E A;  5EGW A;  3KSE A;  3K8U A;  4K7C A;  3IOQ A;  4FK5 A;  1PBH A;  1KHQ A;  1MEM A;  4N4Z A;  3HHA A;  2OZ2 A;  3RVX A;  4YYV A;  1TU6 A;  2XU1 A;  1PCI A;  1AU2 A;  2XU4 A;  1ME4 A;  4ZUX U;  4YVA A;  2DZZ A;  4XUI A;  2VHF A;  4CDC B;  2FTD A;  3D9W A;  2C0Y A;  4BS6 A;  1PPN A;  1E2T A;  1YK8 A;  1U9Q X;  3V6E A;  4QBB A;  4X6H A;  4RY2 A;  3P5W A;  4YYW A;  3KFQ A;  1CSB B;  1MS6 A;  2PAD A;  2FRA A;  3ERV A;  3K9M A;  4YYS A;  3U8E A;  1ICF A;  3LFY A;  5CHT A;  2YJ9 A;  4DMX A;  3H89 A;  1U9X A;  3DF0 A;  2XU3 A;  2AYN A;  1GEC E;  1MEG A;  3KX1 A;  3LTW A;  1VJV A;  2NQA A;  1TLO A;  3KWZ A;  5JH3 A;  2R9M A;  2P7U A;  1ATK A;  5FPW A;  2AYO A;  3PW3 A;  2DCA A;  2R9C A;  2PNS A;  1KFU L;  2R9F A;  4Q8H A;  2P0R A;  1F29 A;  2B1M A;  3KW9 A;  1U9V A;  6PAD A;  4X6I A;  2GHU A;  3QSD A;  2IPP B;  3WXF A;  4DMY A;  1NQC A;  1S4V A;  3H8C A;  2AIM A;  2HH5 A;  3OVX A;  3IV2 A;  2AUX A;  3IHP A;  5K16 A;  2HHN A;  2VFB A;  2P86 A;  4CDE B;  1ZCM A;  1HUC B;  2E01 A;  1O0E A;  3O0U A;  3C9E A;  1TL9 A;  1NLJ A;  1THE A;  2YJB A;  3USV A;  3I06 A;  1GCB A;  2B1N A;  2CIO A;  1EWM A;  3IUT A;  3OF8 A;  2YJ2 A;  3N4C A;  1F2B A;  1ZIV A;  1AEC A;  3LXS A;  1EWP A;  2BDL A;  5JA7 A;  5J94 A;  1U5I A;  1PPD A;  3GCB A;  3QJ3 A;  2DC8 A;  1GLO A;  1SNK A;  4C5P A;  2R6N A;  1MDW A;  1AU0 A;  4N79 A;  2AU1 A;  4CDF B;  2FQ9 A;  3KWB X;  1PPO A;  1PE6 A;  2E02 A;  4PP1 A;  4MZO A;  3F5V A;  1AU3 A;  2AS8 A;  2JQF R;  4W5B A;  1W6F A;  4BPV A;  2ACT A;  1BQI A;  4B55 A;  4BSQ A;  3K24 A;  1YVB A;  3S3R A;  1KHP A;  2HD5 A;  2AVW A;  1JQP A;  1YT7 A;  2FYE A;  3H7D A;  1EF7 A;  1W4T A;  3PNR A;  3BWK A;  2FT2 A;  3N3K A;  2PBH A;  2YJC A;  1QXP A;  4I07 A;  1MHW A;  1CTE A;  4WA6 A;  1GMY A;  3D6S A;  3BPF A;  3V6C A;  3OF9 A;  3AI8 A;  4QRV A;  4W5C A;  2E00 A;  1NB3 A;  8PCH A;  1A6R A;  3CBK A;  1DEU A;  2GFO A;  1CQD A;  4YYQ A;  1AIM A;  4I04 A;  3WXE A;  4XR7 A;  2F7D A;  4PAD A;  3P5V A;  4P6G A;  3H6S A;  2DJG B;  3MHH A;  4NV7 A;  5CVO B;  2VFC A;  1NB5 A;  4FJC A;  1AYW A;  3BOW A;  4BGF A;  2FRQ A;  1K3B B;  1QDQ A;  3MOR A;  4KLB A;  2R9N A;  1CVZ A;  1CB5 A;  1IWD A;  2AUZ A;  4MZS A;  2VHS A;  3TNX A;  4BS5 A;  1QMY A;  2R9O A;  2ARY A;  3HWN A;  4YYR A;  1F2C A;  4AXM A;  1X9Y A;  4AXL A;  3F75 A;  4YYU A;  3IEJ A;  1KFX L;  1CV8 A;  4OEM A;  1FH0 A;  3BC3 A;  2OP3 A;  1YK7 A;  4N8W A;  1CJL A;  3ZUA A;  5CHV A;  3MTN A;  2FO5 A;  1VSN A;  4FIP A;  3H8B A;  5CVM A;  3OIS A;  1PXV A;  1AU4 A;  1CS8 A;  1CPJ A;  1STF E;  3I3T A;  1AYV A;  2G7Y A;  1GX3 A;  1KXR A;  2HXZ A;  2NQD B;  1POP A;  9PAP A;  5A24 A;  4CDD B;  2IBI A;  3KKU A;  4YV8 A;  2F1G A;  1NL6 A;  1U9W A;  4Q8G A;  5PAD A;  1BGO A;  2O6X A;  2XU5 A;  1Q6K A;  2BSZ A;  2FUD A;  3CBJ A;  3MHS A;  3NHE A;  4MSX A;  3PDF A;  1PIP A;  3RVV A;  1BY8 A;  4QRX A;  1Y4H A;  2DJF B;  3E1Z B;  1AYU A;  1DF0 A;  2DC6 A;  3HHI A;  3BCN A;  3PBH A;  1YAL A;  4I05 A;  3WXG A;  7PCK A;  1F2A A;  2G8E A;  3QT4 A;  4GUZ A;  2OUL A;  2Y5B A;  1Y08 A;  1ME3 A;  1NPZ A;  1MIR A;  3P5X A;  2WBF X;  2DCC A;  1XKG A;  3IMA A;  2DC9 A;  1QOL A;  3B79 A;  2CB5 A;  4W4U A;  3O1G A;  4OEL A;  4QH6 A;  2E03 A;  2H7J A;  2G8J A;  2JQG R;  2NQI A;  3OVZ A;  4BQV A;  2BDZ A;  1M6D A;  5EF4 A;  2DCB A;  2DCD A;  4PP2 E;  4PI3 A;  3CH3 X;  4CZW A;  1EWO A;  2NQG A;  5F02 A;  1BP4 A;  3HD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...