4FJCA

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
472
structure length
447
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 126
structure length 447
sequence length 472
chains with identical sequence E
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fjcA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fjcA02
2C2LA 4GNDA 1MDWA 1PPDA 4LLBA 1SP4B 4BPVA 2YU4A 1F62A 2FYEA 3ZVZB 2YSJA 4P5OB 3M63A 3SOXA 3LQJA 4W5CA 2L5UA 1IWDA 1BY8A 3U5NA 1CPJA 4QRGA 1KFXL 1VJVA 2K17A 2NQDB 2ECIA 2DZYA 2LQ6A 4PTBA 2Y5BA 3HD3A 4N4FA 1JQPA 4AVXA 2C2VS 2KGIA 1LDJB 1WEQA 1X9YA 2Y43A 1E4UA 2YHNA 4QF3A 4FO9A 2AUZA 3WXEA 3IMAA 3N3GA 2P86A 3HCSA 1KXRA 3IUTA 1XKGA 3O7AA 1EWLA 5LKUA 2KIZA 5EF4A 5KH3A 4LK9A 2DCBA 1VFYA 5B77A 2LRIC 2F42A 2VPDA 4R8PK 3LRQA 4QRVA 1WGMA 2VP7A 4YV8A 3BWKA 1EWOA 3H8CA 4I7BA 1DVPA 1X4IA 4NN2A 4YABA 2OULA 8PCHA 1GLOA 2P0RA 2RI7A 1CSBB 1X4JA 3N9NA 4N8WA 4WZ0A 4LJNA 2MA6A 2QICA 5CHTA 3SOUA 4Q8GA 5FEYA 1U9VA 4IC2A 2ZETC 2G8JA 2F1GA 3D6SA 2F7DA 2LXHC 3DF0A 2H0DB 1FP0A 2CKLB 5JH3A 2YW8A 2CKLA 2JRJA 4YVAA 3N9QA 4C9ZA 5TRBA 3K9MA 5B75A 1Z2QA 2ECNA 2FRAA 2Y6EA 3RPGC 3HCTA 2G8EA 2AU1A 2JMDA 1U9WA 1Y4HA 2C0YA 5J3XA 4ZDTA 2XU4A 2G43A 2F6JA 1QDQA 3ZPV1 5B79A 2VJFB 1ICFA 3PNRA 2YREA 5AITA 4R2YA 3K24A 3ZUAA 2RSDA 5H1UA 2VJEB 3MHHA 3BPFA 4P6EA 4RY2A 4YATA 3IOQA 2M6MA 3PW3A 4B86C 2MD8C 2QJ0A 2NAAA 3O33A 2OP3A 4PADA 1M6DA 3LQIA 3PUQA 2EGPA 2ECVA 1PIPA 1EF7A 5G04B 3KWZA 1WENA 4WA6A 3DQVR 4YYSA 1NL6A 3F75A 2JQGR 4YYWA 2ACTA 1PE6A 3EB5A 2KR4A 4A4BA 1CTEA 1WE9A 2VJFA 6PADA 5FERA 4YC9A 1ZBDB 1U6GB 2AIMA 4A4CA 2GFOA 4FK5A 4CCGX 3H89A 2IPPB 1NB5A 3U5PA 4LADB 2ARYA 5FB1A 3KQIA 4F52B 1YK7A 5G0FA 4BSQA 3PBHA 2R9OA 1MEMA 2FUUA 1WEOA 1WESA 2E03A 4AXMA 2FUDA 4QRXA 1STFE 4PI3A 2E01A 1AIMA 2FUIA 4WZ2A 4BBQA 2CB5A 4OEMA 4YYQA 2FO5A 4YYUA 5CVNB 5CVOB 2KWKA 3BC3A 1YALA 2LGKA 1U9XA 3BOWA 1BGOA 2NQAA 2DJFB 2YT5A 2YYRA 2YJ2A 2R9FA 3P5WA 3U8EA 4PP2E 4OELA 4W5BA 2E6SA 5JA7A 1Q6KA 2H7JA 1K2FA 3L1ZB 2VPEA 2G45A 4P6GA 5PADA 1ME4A 3ZPVE 2DC9A 4X6IA 2MNYA 3NG2A 5C13A 4AYCB 3C5KA 3AI8A 3GCBA 3QZVA 3KX1A 1JM7B 4GNGA 1MS6A 1V87A 3ZVYA 3C9EA 3K8UA 2LXPC 3QT4A 1MEGA 3P5XA 4AUQB 3TNXA 2FRQA 2FTDA 2DC8A 2KE1A 4B7YC 1QOLA 1HUCB 2L75A 5EYAF 4UP5A 5C11A 4TKPB 2YQLA 4I7DA 4MZOA 1AU3A 4MSXA 2DX8A 3VK6A 4YBMA 2YHOA 2E02A 3S3QA 1Z60A 1NLJA 1WILA 3P5UA 1NPZA 5FPWA 3GL6A 2AYNA 2CSYA 1VYXA 1CVZA 2JMJA 4V3KC 3ASLA 2KWNA 1WEWA 2K4DA 3RPGB 2MT5A 4PPEA 5B76A 3BPMA 2YJBA 4A0CD 2DZZA 4UI9B 5G05B 3QSDA 2LGLA 1N87A 1TU6A 3HHIA 4QBBA 2F6NA 2E00A 4YBTA 2JMIA 5B8DA 3H7DA 1CS8A 2HD5A 1WFKA 1ZIVA 1BORA 1QXPA 4R7EA 2R6NA 3B79A 1WEMA 1Y08A 1VSNA 2ATOA 2BDLA 3IHPA 2M1RA 4UP0A 2FSAA 1Z6UA 1AU4A 3PDFA 2AYOA 2KFTA 2YUCA 1CB5A 4BS5A 1JOCA 3SOWA 2YJCA 3KNVA 2DC7A 1VD4A 1MM2A 3O37A 1SNKA 2HXZA 3I2DA 2E6RA 1ATKA 4I07A 4MZSA 2HDPA 2MIQA 2XEUA 1PPNA 5B78A 5DINA 2PNXA 2ECTA 1YK8A 2GHUA 1GMYA 4LKAA 3KKUA 1TL9A 4X6JA 2KWJA 5F02A 1X4UA 1YVBA 2ECWA 3BCNA 2NQGA 2B1MA 2HH5A 4AXLA 1THEA 2AUXA 2XU5A 4CDEB 2D8SA 5FB0A 1MHWA 2PADA 3CBKA 2M85A 2DCCA 2Y1NA 4YYVA 1ZCMA 2AN6A 2MNZA 2UZGA 1F29A 2R9NA 2L43A 5CVMA 4S3OB 3KV6A 3T7LA 1FH0A 4L7XA 4QF2A 2CIOA 4BHWA 2I50A 2YURA 2FQ9A 2OXQC 3HTKC 2PBHA 3CH2X 4X6HA 3RVWA 2KWOA 1G25A 2YJ9A 2Y1MA 3LQHA 3WXFA 2DC6A 3O36A 1POPA 3L11A 1TLOA 3KFQA 4N4ZA 4CA1A 4I04A 3U5MA 3ERVA 1KHPA 2PNSA 2AS8A 1U5IA 2KREA 5H1VA 3OISA 5EGWA 2VPBA 5TBNA 4CZWA 4V3LC 7PCKA 4PP1A 5CHVA 1O0EA 1PADA 4XI1A 3HCUA 1DF0A 4WZ3B 1CJLA 3P5VA 1WEUA 2IDAA 3OF9A 2YQMA 1JM7A 2G6DA 4BQVA 3H8BA 5KH7A 3RTRB 1GCBA 4DMYA 4Q8HA 3KV5A 5TABA 4QH6A 5K16A 3PURA 1DEUA 4XUIA 4G54A 4GB0A 1LDKC 2L0BA 4DMXA 2CSZA 2KYUA 2PREA 3MTNA 3HHAA 3I06A 5AIUA 4BS6A 1PCIA 2G6QA 1NQCA 2R9MA 3U5OA 3N4CA 4N79A 3O0UA 2LGVA 4W4UA 1F2AA 3SHBA 2VJEA 2R9CA 2DCAA 2LDRA 2VHSA 1AYUA 1AU0A 3HWNA 1S4VA 4ZQLA 1KHQA 3NHEA 2HHNA 5LKTA 3M62A 4Q6FA 2IBIA 1AYWA 2HYED 2XB1A 1HYIA 2JQFR 2XU3A 3RVXA 2KU3A 4YYRA 2ECGA 2YSMA 2PUYA 1EWPA 3H6SA 3GV4A 3N9PA 3T6RA 3ZTGA 4CDFB 2LN0A 3USVA 3FL2A 4AYCA 1U9QX 4K7CA 3KSEA 5A24A 2K16A 3O35A 4L58A 1XWHA 3M99A 2OZ2A 1RMDA 3V6CA 2ECJA 2BDZA 3RVVA 3OVXA 3MORA 4I7CA 1WEPA 2DCDA 1WEVA 2MUMA 3MHSA 4A49A 2O6XA 2XU1A 5H9MA 4HWYA 4CDDB 3CH3X 2KGGA 4YBSA 3V6EA 1IYMA 1F2BA 1A6RA 4O64A 1CQDA 1F2CA 4S3OC 4YADA 9PAPA 5D1KB 3F5VA 3WXGA 4CDCB 3O70A 2EA6A 1YT7A 2DJGB 4FIPA 1HYJA 1PPOA 5LCWB 3OF8A 2B1NA 5I3LA 1MM3A 5TDWA 3I3TA 2AVWA 2VNFA 5D1MB 4FJCA 5DKAA 4GNFA 4AP4A 5TDRA 2K1JA 2G7YA 1WEEA 4KLBA 1AYVA 3N9LA 5LKXA 1PPPA 4MVTA 3N9OA 5JG6A 3LFYA 3S3RA 3C6WA 2QIZA 3DPLR 4GNEA 2YJ8A 2P7UA 5J94A 2L80A 1K3BB 1GECE 1CV8A 2VHFA 2BAYA 1KFUL 2FT2A 3LXSA 2VPGA 5LKZA 3E1ZB 3O1GA 4IC3A 1ME3A 1MIRA 3PHDA 5H1TA 2MA5A 3QJ3A 2M3HA 1EWMA 1WIMA 4ZUXU 5D1LB 1PXVA 3V43A 2WBFX 4N3WA 3CBJA 1AU2A 2CT2A 1NB3A 1FBVA 1BP4A 3L1XA 3N3KA 1AECA 4YAXA 1ITOA 1PBHA 2LV9A 3ZYQA 3IV2A 3OVZA 2NQIA 1CHCA 3O34A 3ZNIA 4X3GA 2H0DA 1T1HA 2MD7B 3N9MA 3KWBX 1QMYA 1BQIA 4I05A 2EODA 3KW9A 5KH9A 2LGGA 3EB6A 4XR7A 3IEJA
chains in the Genus database with same CATH superfamily
2C2LA 4GNDA 1MDWA 1PPDA 4LLBA 1SP4B 4BPVA 2YU4A 1F62A 2FYEA 3ZVZB 2YSJA 4P5OB 3M63A 3SOXA 4OVZB 3LQJA 4OGEA 2UZJA 4W5CA 2L5UA 1IWDA 1BY8A 2DJAA 3U5NA 1CPJA 4QRGA 2P57A 1KFXL 1VJVA 2K17A 2NQDB 2ECIA 2DZYA 2LQ6A 4PTBA 2Y5BA 3HD3A 4BOZA 4N4FA 1JQPA 4AVXA 2C2VS 2KGIA 3E2DA 1LDJB 1WEQA 3LVQE 1X9YA 2Y43A 1E4UA 2YHNA 4QF3A 4FO9A 2AUZA 3WXEA 3IMAA 3N3GA 2P86A 3HCSA 1KXRA 3IUTA 1XKGA 3O7AA 1EWLA 4IUMA 5LKUA 2KIZA 5EF4A 5KH3A 4LK9A 4GUAA 2YVRA 1VFYA 5B77A 2DCBA 2LRIC 2EGMA 2F42A 2VPDA 4R8PK 3DWDA 3LRQA 4QRVA 1WGMA 2VP7A 4YV8A 3BWKA 1EWOA 3IFUA 3H8CA 4I7BA 1DVPA 1X4IA 4NN2A 4YABA 3PT2A 4BOQA 2OULA 8PCHA 1GLOA 2P0RA 2RI7A 1CSBB 3H7HA 1X4JA 3N9NA 4N8WA 4WZ0A 4LJNA 2MA6A 2QICA 5CHTA 3SOUA 4Q8GA 5FEYA 1U9VA 4IC2A 2ZETC 2BTWA 2F1GA 2G8JA 3D6SA 2F7DA 2LXHC 3DF0A 2H0DB 1FP0A 2RR4A 2CKLB 5JH3A 2YW8A 5SVYA 2CKLA 2JRJA 2Z84A 4YVAA 3N9QA 3FJUB 3LVRE 5TRBA 2L7PA 4C9ZA 3K9MA 5B75A 1Z2QA 3RNVA 2ECNA 2FRAA 2Y6EA 3RPGC 3HCTA 2G8EA 2AU1A 2JMDA 1U9WA 1Y4HA 2C0YA 5J3XA 4ZDTA 2XU4A 2G43A 2F6JA 1QDQA 3ZPV1 1DKIA 5B79A 2VJFB 1ICFA 3PNRA 2YREA 5AITA 4R2YA 4RKXA 3K24A 3ZUAA 2RSDA 4H9DA 5H1UA 2VJEB 3MHHA 3BPFA 4P6EA 4RY2A 4YATA 3IOQA 2M6MA 5SVXA 3PW3A 4B86C 2MD8C 2QJ0A 2NAAA 3O33A 2OP3A 4PADA 1M6DA 4RNAA 3LQIA 4OVZA 3PUQA 2EGPA 4XR7A 2CRRA 2ECVA 1PIPA 1EF7A 5G04B 3KWZA 3PHUA 1WENA 4WA6A 3DQVR 4YYSA 1NL6A 3F75A 2JQGR 4YYWA 4RF0A 4Z0OA 2ACTA 1PE6A 3EB5A 2KR4A 4A4BA 2BU3A 1CTEA 1WE9A 2VJFA 6PADA 5FERA 4D8EA 4YC9A 1ZBDB 1U6GB 2AIMA 4A4CA 2GFOA 4FK5A 4CCGX 3H89A 2IPPB 1NB5A 3U5PA 4LADB 2ARYA 5FB1A 3KQIA 4OW0A 4F52B 4REZA 1YK7A 5G0FA 4BSQA 3PBHA 2R9OA 4O62A 1MEMA 2FUUA 1WEOA 1WESA 2E03A 4AXMA 2M13A 2FUDA 4QRXA 1STFE 4PI3A 2E01A 3SUBA 3MP2A 1AIMA 2CRWA 2FUIA 4WZ2A 4BBQA 2CB5A 4OEMA 2FO5A 4YYQA 5CVNB 4YYUA 5CVOB 3C0RA 2KWKA 3BC3A 1YALA 2LGKA 1U9XA 3BOWA 1BGOA 2NQAA 2IQJA 2DJFB 2YT5A 2YYRA 2YJ2A 2R9FA 3P5WA 3U8EA 4PP2E 4OELA 4W5BA 2E6SA 2XOCA 1Q6KA 3MJ5A 2H7JA 5JA7A 1K2FA 3L1ZB 3W30A 2VPEA 2G45A 4P6GA 5PADA 1ME4A 3ZPVE 2DC9A 4X6IA 2MNYA 3NG2A 5C13A 3DDTA 4AYCB 3C5KA 3AI8A 4IP3A 3BPMA 3GCBA 3QZVA 3KX1A 1JM7B 4GNGA 1MS6A 4PT5A 3JUEA 1V87A 3ZVYA 3C9EA 3K8UA 2LXPC 4D8IA 3QT4A 1MEGA 3BBAA 3P5XA 4AUQB 3TNXA 2FRQA 2FTDA 2DC8A 2KE1A 4B7YC 1QOLA 1HUCB 2L75A 5EYAF 4UP5A 2JM3A 5C11A 4TKPB 2YQLA 4I7DA 2HWKA 4MZOA 1AU3A 4MSXA 3PHXA 2DX8A 3VK6A 4YBMA 2AGAA 2YHOA 2E02A 3S3QA 1Z60A 1NLJA 1WILA 3P5UA 1NPZA 5FPWA 3GL6A 5JZEA 1YZBA 2CSYA 2AYNA 1VYXA 1CVZA 2JMJA 4V3KC 3ASLA 2KWNA 1WEWA 2K4DA 4PPEA 2MT5A 3RPGB 2XOYA 5B76A 2YJBA 4A0CD 2DZZA 4UI9B 5G05B 3QSDA 2LGLA 1N87A 1TU6A 3Q1DA 3HHIA 4QBBA 2F6NA 2E00A 4YBTA 2JMIA 5B8DA 3H7DA 3LJUX 4F1PA 1CS8A 3E9SA 2HD5A 1WFKA 1ZIVA 1BORA 2BTWB 1QXPA 4R7EA 2R6NA 3B79A 1WEMA 1Y08A 2DOSA 1VSNA 2ATOA 2BDLA 3IHPA 2M1RA 4UP0A 2FSAA 1Z6UA 1AU4A 3PDFA 2AYOA 2J7QA 2KFTA 2YUCA 1CB5A 4HXDB 1JOCA 3SOWA 2YJCA 3KNVA 5SVIA 4BS5A 2DC7A 1VD4A 1MM2A 3O37A 1SNKA 2HXZA 3I2DA 2E6RA 1ATKA 4I07A 4XZXA 4MZSA 2HDPA 2MIQA 2XEUA 1PPNA 5B78A 5DINA 2PNXA 3MTVA 2ECTA 1YK8A 2GHUA 2XOZA 1GMYA 4LKAA 3KKUA 1TL9A 4MI7A 2KWJA 4X6JA 5F02A 1X4UA 1YVBA 2ECWA 2D8UA 1DCQA 3BCNA 2NQGA 2B1MA 2HH5A 4AXLA 1THEA 2AUXA 2XU5A 2CSVA 1UKFA 2FD4A 4CDEB 5EZQA 2D8SA 5FB0A 3PLWA 1MHWA 2PADA 3CBKA 2M85A 2DCCA 2Y1NA 4YYVA 1ZCMA 2AN6A 2MNZA 3ZNHA 2UZGA 2MKEA 1F29A 2L43A 2R9NA 5CVMA 2KKXA 4S3OB 3KV6A 3T7LA 1FH0A 4L7XA 4QF2A 2CIOA 4BHWA 2I50A 2YURA 2FQ9A 2OXQC 3HTKC 2PBHA 3CH2X 4X6HA 3RVWA 2KWOA 1G25A 2FFWA 2YJ9A 2JRIA 2Y1MA 3LQHA 3TMPA 3WXFA 2DC6A 3O36A 5K3QA 1POPA 3PHWA 3L11A 1TLOA 3KFQA 3MDBC 4N4ZA 4CA1A 4I04A 3U5MA 3ERVA 1KHPA 3O65A 2PNSA 2AS8A 1U5IA 2KREA 5H1VA 3OISA 5EGWA 2KKYA 2VPBA 5TBNA 4CZWA 4V3LC 7PCKA 4PP1A 5CHVA 1O0EA 1PADA 4XI1A 3HCUA 1DF0A 4A5UA 4WZ3B 4Z0RA 1CJLA 4BOSA 3P5VA 1WEUA 4R3DA 2IDAA 3OF9A 2YQMA 1JM7A 2G6DA 4OGCA 3H8BA 4BQVA 5KH7A 3RTRB 1GCBA 4DMYA 4Q8HA 3KV5A 5TABA 4QH6A 5K16A 3PURA 1DEUA 4MM3B 4XUIA 4G54A 4GB0A 1LDKC 2L0BA 3W31A 4BOPA 4DMXA 2CSZA 2KYUA 2PREA 3MTNA 3HHAA 3I06A 5AIUA 3LDYA 4BS6A 3FM8C 1PCIA 2G6QA 1NQCA 2R9MA 4M0WA 3U5OA 3N4CA 4N79A 3O0UA 2LGVA 4W4UA 1F2AA 1PVJA 3SHBA 2VJEA 2R9CA 2DCAA 2EXUA 3PSEA 2LDRA 2VHSA 1AYUA 1AU0A 3HWNA 1S4VA 4ZQLA 1KHQA 3NHEA 2HHNA 5LKTA 5E6JA 3M62A 4Q6FA 2IBIA 1AYWA 2HYED 2XB1A 1HYIA 2JQFR 2XU3A 3RVXA 2KU3A 4YYRA 2ECGA 2YSMA 2PUYA 1EWPA 3H6SA 3GV4A 3N9PA 3T6RA 3ZTGA 4CDFB 2LN0A 3USVA 3FL2A 1MBMA 4AYCA 1U9QX 4K7CA 3KSEA 5A24A 2K16A 3FAOA 3O35A 3T9KA 4L58A 1XWHA 3M99A 3M7KA 2OZ2A 1RMDA 3PRPA 3V6CA 2ECJA 2BDZA 3RVVA 3OVXA 3MORA 2OWAA 4I7CA 1WEPA 2DCDA 1WEVA 2MUMA 3MHSA 4A49A 2O6XA 2XU1A 2J7QC 5H9MA 4HWYA 4CDDB 3CH3X 2KGGA 4YBSA 3V6EA 4D8BA 3OQCA 3TRKA 1IYMA 1F2BA 1A6RA 4O64A 2XP0A 1CQDA 1F2CA 4S3OC 4YADA 9PAPA 5D1KB 3F5VA 3WXGA 4CDCB 2FE8A 2CONA 2EA6A 3O70A 1YT7A 2DJGB 4FIPA 3O47A 1HYJA 1PPOA 5LCWB 3OF8A 2B1NA 5I3LA 1MM3A 5TDWA 3I3TA 2AVWA 2VNFA 4P16A 5D1MB 4FJCA 5DKAA 4GNFA 4AP4A 5TDRA 2K1JA 2G7YA 1WEEA 4KLBA 1AYVA 3N9LA 5LKXA 1PPPA 4MVTA 3N9OA 5JG6A 3LFYA 3S3RA 5KO3A 3C6WA 2QIZA 5EZSA 4QQ4A 3DPLR 4GNEA 2YJ8A 3FANA 2P7UA 5J94A 2L80A 2LAUA 1GECE 1K3BB 1CV8A 2VHFA 2BAYA 2B0OE 1KFUL 3FEHA 2FT2A 3LXSA 2VPGA 5LKZA 2DSMA 2JTCA 3E1ZB 3O1GA 4IC3A 1ME3A 1MIRA 3PHDA 5H1TA 3BB7A 5SVIB 2MA5A 2E61A 3QJ3A 2M3HA 1EWMA 3KDEC 1WIMA 4ZUXU 5D1LB 1PXVA 3V43A 2WBFX 4N3WA 3CBJA 1AU2A 3PRMA 2CT2A 1NB3A 1FBVA 1BP4A 3L1XA 3N3KA 1AECA 4YAXA 1ITOA 1PBHA 2LV9A 3ZYQA 3BY4A 3IV2A 3OVZA 2NQIA 1CHCA 3O34A 3ZNIA 4X3GA 2H0DA 1T1HA 3B21A 4ZTBA 2MD7B 3N9MA 3KWBX 1QMYA 4WURA 1BQIA 4I05A 2EODA 3KW9A 5KH9A 4BOUA 2LGGA 2JUNA 3EB6A 4RF1A 3IEJA
chains in the Genus database with same CATH topology
2C2LA 4GNDA 1MDWA 1PPDA 4LLBA 1SP4B 4BPVA 2YU4A 1F62A 2FYEA 3ZVZB 2YSJA 4P5OB 3M63A 3SOXA 3LQJA 4W5CA 2L5UA 1IWDA 1BY8A 3U5NA 1CPJA 4QRGA 1KFXL 1VJVA 2K17A 2NQDB 2ECIA 2DZYA 2LQ6A 4PTBA 2Y5BA 3HD3A 4N4FA 1JQPA 4AVXA 2C2VS 2KGIA 1LDJB 1WEQA 1X9YA 2Y43A 1E4UA 2YHNA 4QF3A 4FO9A 2AUZA 3WXEA 3IMAA 3N3GA 2P86A 3HCSA 1KXRA 3IUTA 1XKGA 3O7AA 1EWLA 5LKUA 2KIZA 5EF4A 5KH3A 4LK9A 2DCBA 1VFYA 5B77A 2LRIC 2F42A 2VPDA 4R8PK 3LRQA 4QRVA 1WGMA 2VP7A 4YV8A 3BWKA 1EWOA 3H8CA 4I7BA 1DVPA 1X4IA 4NN2A 4YABA 2OULA 8PCHA 1GLOA 2P0RA 2RI7A 1CSBB 4B55A 1X4JA 3N9NA 4N8WA 4WZ0A 4LJNA 2MA6A 2QICA 5CHTA 3SOUA 4Q8GA 5FEYA 1U9VA 1E2TA 4IC2A 2ZETC 2G8JA 2F1GA 3D6SA 2F7DA 2LXHC 3DF0A 2H0DB 1FP0A 2CKLB 5JH3A 2YW8A 2CKLA 2JRJA 4YVAA 3N9QA 1GX3A 4C9ZA 5TRBA 4C5PA 3K9MA 5B75A 1Z2QA 2ECNA 2FRAA 2Y6EA 3RPGC 3HCTA 2G8EA 2AU1A 2JMDA 1U9WA 1Y4HA 2C0YA 5J3XA 4ZDTA 2XU4A 2G43A 2F6JA 1QDQA 3ZPV1 5B79A 2VJFB 1ICFA 3PNRA 2YREA 5AITA 4R2YA 3K24A 3ZUAA 2RSDA 5H1UA 2VJEB 3MHHA 3BPFA 4P6EA 4RY2A 4YATA 3IOQA 2M6MA 3PW3A 4B86C 2MD8C 2QJ0A 2NAAA 3O33A 2OP3A 4PADA 1M6DA 3LQIA 3PUQA 2EGPA 2ECVA 1PIPA 1EF7A 5G04B 3KWZA 1WENA 4WA6A 3DQVR 4NV8A 4YYSA 1NL6A 3F75A 2JQGR 4YYWA 2ACTA 1PE6A 3EB5A 2KR4A 4A4BA 1CTEA 1WE9A 2VJFA 6PADA 5FERA 4YC9A 1ZBDB 1U6GB 2AIMA 4A4CA 2GFOA 4FK5A 4CCGX 3H89A 2IPPB 1NB5A 3U5PA 4LADB 2ARYA 5FB1A 3KQIA 4F52B 1YK7A 5G0FA 4BSQA 3PBHA 2R9OA 1MEMA 2FUUA 1WEOA 1WESA 2E03A 4AXMA 2FUDA 4QRXA 1STFE 4PI3A 2E01A 1AIMA 2FUIA 4WZ2A 4BBQA 1W4TA 2CB5A 4OEMA 2FO5A 4YYQA 5CVNB 4YYUA 5CVOB 2KWKA 3BC3A 1YALA 4NV7A 2LGKA 1U9XA 3BOWA 1BGOA 2NQAA 2DJFB 2YT5A 2YYRA 2YJ2A 2R9FA 3P5WA 3U8EA 4PP2E 4OELA 4W5BA 2E6SA 5JA7A 1Q6KA 2H7JA 1K2FA 3L1ZB 2VPEA 2G45A 4P6GA 5PADA 1ME4A 3ZPVE 2DC9A 4X6IA 2MNYA 3NG2A 5C13A 4AYCB 3C5KA 3AI8A 3GCBA 3QZVA 3KX1A 1JM7B 4GNGA 1MS6A 1V87A 3ZVYA 3C9EA 3K8UA 2LXPC 3QT4A 1MEGA 3P5XA 4AUQB 3TNXA 2FRQA 2FTDA 2DC8A 2KE1A 4B7YC 1QOLA 1HUCB 2L75A 5EYAF 4UP5A 5C11A 4TKPB 2YQLA 4I7DA 4MZOA 1AU3A 4MSXA 2DX8A 3VK6A 4YBMA 2YHOA 2E02A 3S3QA 1Z60A 1NLJA 1WILA 3P5UA 1NPZA 5FPWA 3GL6A 4BGFA 2AYNA 2CSYA 1VYXA 1CVZA 2JMJA 4GUZA 4V3KC 3ASLA 2KWNA 1WEWA 2K4DA 3RPGB 2MT5A 4PPEA 5B76A 3BPMA 2YJBA 4A0CD 2DZZA 4UI9B 5G05B 3QSDA 2LGLA 1N87A 1TU6A 3HHIA 4QBBA 2F6NA 2E00A 4YBTA 2JMIA 5B8DA 3H7DA 1CS8A 2HD5A 1WFKA 1ZIVA 1BORA 1QXPA 4R7EA 2R6NA 3B79A 1WEMA 1Y08A 1VSNA 2ATOA 2BDLA 3IHPA 2M1RA 4UP0A 2FSAA 1Z6UA 1AU4A 3PDFA 2AYOA 2KFTA 2YUCA 1CB5A 4BS5A 1JOCA 3SOWA 1W6FA 3KNVA 2YJCA 2DC7A 1VD4A 1MM2A 3O37A 1SNKA 2HXZA 3I2DA 2E6RA 1ATKA 4I07A 4MZSA 2HDPA 2MIQA 2XEUA 1PPNA 5B78A 5DINA 2PNXA 2ECTA 1YK8A 2GHUA 1GMYA 4LKAA 3KKUA 1TL9A 4X6JA 2KWJA 5F02A 1X4UA 1YVBA 2ECWA 3BCNA 2NQGA 2B1MA 2HH5A 4AXLA 1THEA 2AUXA 2XU5A 4CDEB 2D8SA 5FB0A 1MHWA 2PADA 3CBKA 2M85A 2DCCA 2Y1NA 4YYVA 1ZCMA 2AN6A 2MNZA 2UZGA 1F29A 2R9NA 2L43A 5CVMA 4S3OB 3KV6A 3T7LA 1FH0A 4L7XA 4QF2A 2CIOA 4BHWA 2I50A 2YURA 2FQ9A 2OXQC 3HTKC 2PBHA 3CH2X 4X6HA 3RVWA 2KWOA 1G25A 2YJ9A 2VFBA 2Y1MA 3LQHA 3WXFA 2DC6A 3O36A 1POPA 3LTWA 3L11A 2BSZA 1TLOA 3KFQA 4N4ZA 4CA1A 4I04A 3U5MA 3ERVA 1KHPA 2PNSA 2AS8A 1U5IA 2KREA 5H1VA 3OISA 5EGWA 2VPBA 5TBNA 4CZWA 4V3LC 7PCKA 4PP1A 5CHVA 1O0EA 1PADA 4XI1A 3HCUA 1DF0A 4WZ3B 1CJLA 3P5VA 1WEUA 2IDAA 3OF9A 2YQMA 1JM7A 2G6DA 4BQVA 3H8BA 5KH7A 3RTRB 1GCBA 4DMYA 4Q8HA 3KV5A 5TABA 4QH6A 5K16A 3PURA 1DEUA 4XUIA 4G54A 4GB0A 1LDKC 2L0BA 4DMXA 2CSZA 2KYUA 2PREA 3MTNA 3HHAA 3I06A 5AIUA 4BS6A 1PCIA 2G6QA 1NQCA 2R9MA 3U5OA 3N4CA 4N79A 3O0UA 2LGVA 4W4UA 1F2AA 3SHBA 2VJEA 2R9CA 2DCAA 2LDRA 2VHSA 1AYUA 1AU0A 3HWNA 1S4VA 4ZQLA 1KHQA 3NHEA 2HHNA 5LKTA 3M62A 4Q6FA 2IBIA 1AYWA 2HYED 2XB1A 1HYIA 2JQFR 2XU3A 3RVXA 2KU3A 4YYRA 2ECGA 2YSMA 2PUYA 1EWPA 3H6SA 3GV4A 3N9PA 3T6RA 3ZTGA 4CDFB 2LN0A 3D9WA 3USVA 3FL2A 4AYCA 1U9QX 4K7CA 3KSEA 5A24A 2K16A 3O35A 4L58A 1XWHA 3M99A 2OZ2A 1RMDA 3V6CA 2ECJA 2BDZA 3RVVA 3OVXA 3MORA 4I7CA 1WEPA 2DCDA 1WEVA 2MUMA 3MHSA 4A49A 2O6XA 2XU1A 5H9MA 4HWYA 4CDDB 3CH3X 2KGGA 4YBSA 3V6EA 1IYMA 1F2BA 1A6RA 4O64A 1CQDA 1F2CA 4S3OC 4YADA 9PAPA 5D1KB 3F5VA 3WXGA 4CDCB 3O70A 2EA6A 1YT7A 2DJGB 4FIPA 1HYJA 1PPOA 5LCWB 3OF8A 2B1NA 5I3LA 1MM3A 5TDWA 3I3TA 2AVWA 2VNFA 5D1MB 4FJCA 5DKAA 4GNFA 4AP4A 5TDRA 2K1JA 2G7YA 1WEEA 4KLBA 1AYVA 3N9LA 5LKXA 1PPPA 4MVTA 3N9OA 5JG6A 3LFYA 3S3RA 3C6WA 2QIZA 3DPLR 4GNEA 2YJ8A 2P7UA 5J94A 2L80A 1K3BB 1GECE 1CV8A 2VHFA 2BAYA 1KFUL 2FT2A 3LXSA 2VPGA 5LKZA 3E1ZB 3O1GA 4IC3A 1ME3A 1MIRA 3PHDA 5H1TA 2VFCA 2MA5A 3QJ3A 2M3HA 1EWMA 1WIMA 4ZUXU 5D1LB 1PXVA 3V43A 2WBFX 4N3WA 3CBJA 1AU2A 2CT2A 1NB3A 1FBVA 1BP4A 3L1XA 3N3KA 1AECA 4YAXA 1ITOA 1PBHA 2LV9A 1W5RA 3ZYQA 3IV2A 3OVZA 2NQIA 1CHCA 3O34A 3ZNIA 4X3GA 2H0DA 1T1HA 2MD7B 3N9MA 3KWBX 1QMYA 1BQIA 4I05A 2EODA 3KW9A 5KH9A 2LGGA 3EB6A 4XR7A 3IEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  4GND A;  1MDW A;  1PPD A;  4LLB A;  1SP4 B;  4BPV A;  2YU4 A;  1F62 A;  2FYE A;  3ZVZ B;  2YSJ A;  4P5O B;  3M63 A;  3SOX A;  3LQJ A;  4W5C A;  2L5U A;  1IWD A;  1BY8 A;  3U5N A;  1CPJ A;  4QRG A;  1KFX L;  1VJV A;  2K17 A;  2NQD B;  2ECI A;  2DZY A;  2LQ6 A;  4PTB A;  2Y5B A;  3HD3 A;  4N4F A;  1JQP A;  4AVX A;  2C2V S;  2KGI A;  1LDJ B;  1WEQ A;  1X9Y A;  2Y43 A;  1E4U A;  2YHN A;  4QF3 A;  4FO9 A;  2AUZ A;  3WXE A;  3IMA A;  3N3G A;  2P86 A;  3HCS A;  1KXR A;  3IUT A;  1XKG A;  3O7A A;  1EWL A;  5LKU A;  2KIZ A;  5EF4 A;  5KH3 A;  4LK9 A;  2DCB A;  1VFY A;  5B77 A;  2LRI C;  2F42 A;  2VPD A;  4R8P K;  3LRQ A;  4QRV A;  1WGM A;  2VP7 A;  4YV8 A;  3BWK A;  1EWO A;  3H8C A;  4I7B A;  1DVP A;  1X4I A;  4NN2 A;  4YAB A;  2OUL A;  8PCH A;  1GLO A;  2P0R A;  2RI7 A;  1CSB B;  1X4J A;  3N9N A;  4N8W A;  4WZ0 A;  4LJN A;  2MA6 A;  2QIC A;  5CHT A;  3SOU A;  4Q8G A;  5FEY A;  1U9V A;  4IC2 A;  2ZET C;  2G8J A;  2F1G A;  3D6S A;  2F7D A;  2LXH C;  3DF0 A;  2H0D B;  1FP0 A;  2CKL B;  5JH3 A;  2YW8 A;  2CKL A;  2JRJ A;  4YVA A;  3N9Q A;  4C9Z A;  5TRB A;  3K9M A;  5B75 A;  1Z2Q A;  2ECN A;  2FRA A;  2Y6E A;  3RPG C;  3HCT A;  2G8E A;  2AU1 A;  2JMD A;  1U9W A;  1Y4H A;  2C0Y A;  5J3X A;  4ZDT A;  2XU4 A;  2G43 A;  2F6J A;  1QDQ A;  3ZPV 1;  5B79 A;  2VJF B;  1ICF A;  3PNR A;  2YRE A;  5AIT A;  4R2Y A;  3K24 A;  3ZUA A;  2RSD A;  5H1U A;  2VJE B;  3MHH A;  3BPF A;  4P6E A;  4RY2 A;  4YAT A;  3IOQ A;  2M6M A;  3PW3 A;  4B86 C;  2MD8 C;  2QJ0 A;  2NAA A;  3O33 A;  2OP3 A;  4PAD A;  1M6D A;  3LQI A;  3PUQ A;  2EGP A;  2ECV A;  1PIP A;  1EF7 A;  5G04 B;  3KWZ A;  1WEN A;  4WA6 A;  3DQV R;  4YYS A;  1NL6 A;  3F75 A;  2JQG R;  4YYW A;  2ACT A;  1PE6 A;  3EB5 A;  2KR4 A;  4A4B A;  1CTE A;  1WE9 A;  2VJF A;  6PAD A;  5FER A;  4YC9 A;  1ZBD B;  1U6G B;  2AIM A;  4A4C A;  2GFO A;  4FK5 A;  4CCG X;  3H89 A;  2IPP B;  1NB5 A;  3U5P A;  4LAD B;  2ARY A;  5FB1 A;  3KQI A;  4F52 B;  1YK7 A;  5G0F A;  4BSQ A;  3PBH A;  2R9O A;  1MEM A;  2FUU A;  1WEO A;  1WES A;  2E03 A;  4AXM A;  2FUD A;  4QRX A;  1STF E;  4PI3 A;  2E01 A;  1AIM A;  2FUI A;  4WZ2 A;  4BBQ A;  2CB5 A;  4OEM A;  4YYQ A;  2FO5 A;  4YYU A;  5CVN B;  5CVO B;  2KWK A;  3BC3 A;  1YAL A;  2LGK A;  1U9X A;  3BOW A;  1BGO A;  2NQA A;  2DJF B;  2YT5 A;  2YYR A;  2YJ2 A;  2R9F A;  3P5W A;  3U8E A;  4PP2 E;  4OEL A;  4W5B A;  2E6S A;  5JA7 A;  1Q6K A;  2H7J A;  1K2F A;  3L1Z B;  2VPE A;  2G45 A;  4P6G A;  5PAD A;  1ME4 A;  3ZPV E;  2DC9 A;  4X6I A;  2MNY A;  3NG2 A;  5C13 A;  4AYC B;  3C5K A;  3AI8 A;  3GCB A;  3QZV A;  3KX1 A;  1JM7 B;  4GNG A;  1MS6 A;  1V87 A;  3ZVY A;  3C9E A;  3K8U A;  2LXP C;  3QT4 A;  1MEG A;  3P5X A;  4AUQ B;  3TNX A;  2FRQ A;  2FTD A;  2DC8 A;  2KE1 A;  4B7Y C;  1QOL A;  1HUC B;  2L75 A;  5EYA F;  4UP5 A;  5C11 A;  4TKP B;  2YQL A;  4I7D A;  4MZO A;  1AU3 A;  4MSX A;  2DX8 A;  3VK6 A;  4YBM A;  2YHO A;  2E02 A;  3S3Q A;  1Z60 A;  1NLJ A;  1WIL A;  3P5U A;  1NPZ A;  5FPW A;  3GL6 A;  2AYN A;  2CSY A;  1VYX A;  1CVZ A;  2JMJ A;  4V3K C;  3ASL A;  2KWN A;  1WEW A;  2K4D A;  3RPG B;  2MT5 A;  4PPE A;  5B76 A;  3BPM A;  2YJB A;  4A0C D;  2DZZ A;  4UI9 B;  5G05 B;  3QSD A;  2LGL A;  1N87 A;  1TU6 A;  3HHI A;  4QBB A;  2F6N A;  2E00 A;  4YBT A;  2JMI A;  5B8D A;  3H7D A;  1CS8 A;  2HD5 A;  1WFK A;  1ZIV A;  1BOR A;  1QXP A;  4R7E A;  2R6N A;  3B79 A;  1WEM A;  1Y08 A;  1VSN A;  2ATO A;  2BDL A;  3IHP A;  2M1R A;  4UP0 A;  2FSA A;  1Z6U A;  1AU4 A;  3PDF A;  2AYO A;  2KFT A;  2YUC A;  1CB5 A;  4BS5 A;  1JOC A;  3SOW A;  2YJC A;  3KNV A;  2DC7 A;  1VD4 A;  1MM2 A;  3O37 A;  1SNK A;  2HXZ A;  3I2D A;  2E6R A;  1ATK A;  4I07 A;  4MZS A;  2HDP A;  2MIQ A;  2XEU A;  1PPN A;  5B78 A;  5DIN A;  2PNX A;  2ECT A;  1YK8 A;  2GHU A;  1GMY A;  4LKA A;  3KKU A;  1TL9 A;  4X6J A;  2KWJ A;  5F02 A;  1X4U A;  1YVB A;  2ECW A;  3BCN A;  2NQG A;  2B1M A;  2HH5 A;  4AXL A;  1THE A;  2AUX A;  2XU5 A;  4CDE B;  2D8S A;  5FB0 A;  1MHW A;  2PAD A;  3CBK A;  2M85 A;  2DCC A;  2Y1N A;  4YYV A;  1ZCM A;  2AN6 A;  2MNZ A;  2UZG A;  1F29 A;  2R9N A;  2L43 A;  5CVM A;  4S3O B;  3KV6 A;  3T7L A;  1FH0 A;  4L7X A;  4QF2 A;  2CIO A;  4BHW A;  2I50 A;  2YUR A;  2FQ9 A;  2OXQ C;  3HTK C;  2PBH A;  3CH2 X;  4X6H A;  3RVW A;  2KWO A;  1G25 A;  2YJ9 A;  2Y1M A;  3LQH A;  3WXF A;  2DC6 A;  3O36 A;  1POP A;  3L11 A;  1TLO A;  3KFQ A;  4N4Z A;  4CA1 A;  4I04 A;  3U5M A;  3ERV A;  1KHP A;  2PNS A;  2AS8 A;  1U5I A;  2KRE A;  5H1V A;  3OIS A;  5EGW A;  2VPB A;  5TBN A;  4CZW A;  4V3L C;  7PCK A;  4PP1 A;  5CHV A;  1O0E A;  1PAD A;  4XI1 A;  3HCU A;  1DF0 A;  4WZ3 B;  1CJL A;  3P5V A;  1WEU A;  2IDA A;  3OF9 A;  2YQM A;  1JM7 A;  2G6D A;  4BQV A;  3H8B A;  5KH7 A;  3RTR B;  1GCB A;  4DMY A;  4Q8H A;  3KV5 A;  5TAB A;  4QH6 A;  5K16 A;  3PUR A;  1DEU A;  4XUI A;  4G54 A;  4GB0 A;  1LDK C;  2L0B A;  4DMX A;  2CSZ A;  2KYU A;  2PRE A;  3MTN A;  3HHA A;  3I06 A;  5AIU A;  4BS6 A;  1PCI A;  2G6Q A;  1NQC A;  2R9M A;  3U5O A;  3N4C A;  4N79 A;  3O0U A;  2LGV A;  4W4U A;  1F2A A;  3SHB A;  2VJE A;  2R9C A;  2DCA A;  2LDR A;  2VHS A;  1AYU A;  1AU0 A;  3HWN A;  1S4V A;  4ZQL A;  1KHQ A;  3NHE A;  2HHN A;  5LKT A;  3M62 A;  4Q6F A;  2IBI A;  1AYW A;  2HYE D;  2XB1 A;  1HYI A;  2JQF R;  2XU3 A;  3RVX A;  2KU3 A;  4YYR A;  2ECG A;  2YSM A;  2PUY A;  1EWP A;  3H6S A;  3GV4 A;  3N9P A;  3T6R A;  3ZTG A;  4CDF B;  2LN0 A;  3USV A;  3FL2 A;  4AYC A;  1U9Q X;  4K7C A;  3KSE A;  5A24 A;  2K16 A;  3O35 A;  4L58 A;  1XWH A;  3M99 A;  2OZ2 A;  1RMD A;  3V6C A;  2ECJ A;  2BDZ A;  3RVV A;  3OVX A;  3MOR A;  4I7C A;  1WEP A;  2DCD A;  1WEV A;  2MUM A;  3MHS A;  4A49 A;  2O6X A;  2XU1 A;  5H9M A;  4HWY A;  4CDD B;  3CH3 X;  2KGG A;  4YBS A;  3V6E A;  1IYM A;  1F2B A;  1A6R A;  4O64 A;  1CQD A;  1F2C A;  4S3O C;  4YAD A;  9PAP A;  5D1K B;  3F5V A;  3WXG A;  4CDC B;  3O70 A;  2EA6 A;  1YT7 A;  2DJG B;  4FIP A;  1HYJ A;  1PPO A;  5LCW B;  3OF8 A;  2B1N A;  5I3L A;  1MM3 A;  5TDW A;  3I3T A;  2AVW A;  2VNF A;  5D1M B;  4FJC A;  5DKA A;  4GNF A;  4AP4 A;  5TDR A;  2K1J A;  2G7Y A;  1WEE A;  4KLB A;  1AYV A;  3N9L A;  5LKX A;  1PPP A;  4MVT A;  3N9O A;  5JG6 A;  3LFY A;  3S3R A;  3C6W A;  2QIZ A;  3DPL R;  4GNE A;  2YJ8 A;  2P7U A;  5J94 A;  2L80 A;  1K3B B;  1GEC E;  1CV8 A;  2VHF A;  2BAY A;  1KFU L;  2FT2 A;  3LXS A;  2VPG A;  5LKZ A;  3E1Z B;  3O1G A;  4IC3 A;  1ME3 A;  1MIR A;  3PHD A;  5H1T A;  2MA5 A;  3QJ3 A;  2M3H A;  1EWM A;  1WIM A;  4ZUX U;  5D1L B;  1PXV A;  3V43 A;  2WBF X;  4N3W A;  3CBJ A;  1AU2 A;  2CT2 A;  1NB3 A;  1FBV A;  1BP4 A;  3L1X A;  3N3K A;  1AEC A;  4YAX A;  1ITO A;  1PBH A;  2LV9 A;  3ZYQ A;  3IV2 A;  3OVZ A;  2NQI A;  1CHC A;  3O34 A;  3ZNI A;  4X3G A;  2H0D A;  1T1H A;  2MD7 B;  3N9M A;  3KWB X;  1QMY A;  1BQI A;  4I05 A;  2EOD A;  3KW9 A;  5KH9 A;  2LGG A;  3EB6 A;  4XR7 A;  3IEJ A; 
#chains in the Genus database with same CATH topology
 2C2L A;  4GND A;  1MDW A;  1PPD A;  4LLB A;  1SP4 B;  4BPV A;  2YU4 A;  1F62 A;  2FYE A;  3ZVZ B;  2YSJ A;  4P5O B;  3M63 A;  3SOX A;  4OVZ B;  3LQJ A;  4OGE A;  2UZJ A;  4W5C A;  2L5U A;  1IWD A;  1BY8 A;  2DJA A;  3U5N A;  1CPJ A;  4QRG A;  2P57 A;  1KFX L;  1VJV A;  2K17 A;  2NQD B;  2ECI A;  2DZY A;  2LQ6 A;  4PTB A;  2Y5B A;  3HD3 A;  4BOZ A;  4N4F A;  1JQP A;  4AVX A;  2C2V S;  2KGI A;  3E2D A;  1LDJ B;  1WEQ A;  3LVQ E;  1X9Y A;  2Y43 A;  1E4U A;  2YHN A;  4QF3 A;  4FO9 A;  2AUZ A;  3WXE A;  3IMA A;  3N3G A;  2P86 A;  3HCS A;  1KXR A;  3IUT A;  1XKG A;  3O7A A;  1EWL A;  4IUM A;  5LKU A;  2KIZ A;  5EF4 A;  5KH3 A;  4LK9 A;  4GUA A;  2YVR A;  1VFY A;  5B77 A;  2DCB A;  2LRI C;  2EGM A;  2F42 A;  2VPD A;  4R8P K;  3DWD A;  3LRQ A;  4QRV A;  1WGM A;  2VP7 A;  4YV8 A;  3BWK A;  1EWO A;  3IFU A;  3H8C A;  4I7B A;  1DVP A;  1X4I A;  4NN2 A;  4YAB A;  3PT2 A;  4BOQ A;  2OUL A;  8PCH A;  1GLO A;  2P0R A;  2RI7 A;  1CSB B;  3H7H A;  1X4J A;  3N9N A;  4N8W A;  4WZ0 A;  4LJN A;  2MA6 A;  2QIC A;  5CHT A;  3SOU A;  4Q8G A;  5FEY A;  1U9V A;  4IC2 A;  2ZET C;  2BTW A;  2F1G A;  2G8J A;  3D6S A;  2F7D A;  2LXH C;  3DF0 A;  2H0D B;  1FP0 A;  2RR4 A;  2CKL B;  5JH3 A;  2YW8 A;  5SVY A;  2CKL A;  2JRJ A;  2Z84 A;  4YVA A;  3N9Q A;  3FJU B;  3LVR E;  5TRB A;  2L7P A;  4C9Z A;  3K9M A;  5B75 A;  1Z2Q A;  3RNV A;  2ECN A;  2FRA A;  2Y6E A;  3RPG C;  3HCT A;  2G8E A;  2AU1 A;  2JMD A;  1U9W A;  1Y4H A;  2C0Y A;  5J3X A;  4ZDT A;  2XU4 A;  2G43 A;  2F6J A;  1QDQ A;  3ZPV 1;  1DKI A;  5B79 A;  2VJF B;  1ICF A;  3PNR A;  2YRE A;  5AIT A;  4R2Y A;  4RKX A;  3K24 A;  3ZUA A;  2RSD A;  4H9D A;  5H1U A;  2VJE B;  3MHH A;  3BPF A;  4P6E A;  4RY2 A;  4YAT A;  3IOQ A;  2M6M A;  5SVX A;  3PW3 A;  4B86 C;  2MD8 C;  2QJ0 A;  2NAA A;  3O33 A;  2OP3 A;  4PAD A;  1M6D A;  4RNA A;  3LQI A;  4OVZ A;  3PUQ A;  2EGP A;  4XR7 A;  2CRR A;  2ECV A;  1PIP A;  1EF7 A;  5G04 B;  3KWZ A;  3PHU A;  1WEN A;  4WA6 A;  3DQV R;  4YYS A;  1NL6 A;  3F75 A;  2JQG R;  4YYW A;  4RF0 A;  4Z0O A;  2ACT A;  1PE6 A;  3EB5 A;  2KR4 A;  4A4B A;  2BU3 A;  1CTE A;  1WE9 A;  2VJF A;  6PAD A;  5FER A;  4D8E A;  4YC9 A;  1ZBD B;  1U6G B;  2AIM A;  4A4C A;  2GFO A;  4FK5 A;  4CCG X;  3H89 A;  2IPP B;  1NB5 A;  3U5P A;  4LAD B;  2ARY A;  5FB1 A;  3KQI A;  4OW0 A;  4F52 B;  4REZ A;  1YK7 A;  5G0F A;  4BSQ A;  3PBH A;  2R9O A;  4O62 A;  1MEM A;  2FUU A;  1WEO A;  1WES A;  2E03 A;  4AXM A;  2M13 A;  2FUD A;  4QRX A;  1STF E;  4PI3 A;  2E01 A;  3SUB A;  3MP2 A;  1AIM A;  2CRW A;  2FUI A;  4WZ2 A;  4BBQ A;  2CB5 A;  4OEM A;  2FO5 A;  4YYQ A;  5CVN B;  4YYU A;  5CVO B;  3C0R A;  2KWK A;  3BC3 A;  1YAL A;  2LGK A;  1U9X A;  3BOW A;  1BGO A;  2NQA A;  2IQJ A;  2DJF B;  2YT5 A;  2YYR A;  2YJ2 A;  2R9F A;  3P5W A;  3U8E A;  4PP2 E;  4OEL A;  4W5B A;  2E6S A;  2XOC A;  1Q6K A;  3MJ5 A;  2H7J A;  5JA7 A;  1K2F A;  3L1Z B;  3W30 A;  2VPE A;  2G45 A;  4P6G A;  5PAD A;  1ME4 A;  3ZPV E;  2DC9 A;  4X6I A;  2MNY A;  3NG2 A;  5C13 A;  3DDT A;  4AYC B;  3C5K A;  3AI8 A;  4IP3 A;  3BPM A;  3GCB A;  3QZV A;  3KX1 A;  1JM7 B;  4GNG A;  1MS6 A;  4PT5 A;  3JUE A;  1V87 A;  3ZVY A;  3C9E A;  3K8U A;  2LXP C;  4D8I A;  3QT4 A;  1MEG A;  3BBA A;  3P5X A;  4AUQ B;  3TNX A;  2FRQ A;  2FTD A;  2DC8 A;  2KE1 A;  4B7Y C;  1QOL A;  1HUC B;  2L75 A;  5EYA F;  4UP5 A;  2JM3 A;  5C11 A;  4TKP B;  2YQL A;  4I7D A;  2HWK A;  4MZO A;  1AU3 A;  4MSX A;  3PHX A;  2DX8 A;  3VK6 A;  4YBM A;  2AGA A;  2YHO A;  2E02 A;  3S3Q A;  1Z60 A;  1NLJ A;  1WIL A;  3P5U A;  1NPZ A;  5FPW A;  3GL6 A;  5JZE A;  1YZB A;  2CSY A;  2AYN A;  1VYX A;  1CVZ A;  2JMJ A;  4V3K C;  3ASL A;  2KWN A;  1WEW A;  2K4D A;  4PPE A;  2MT5 A;  3RPG B;  2XOY A;  5B76 A;  2YJB A;  4A0C D;  2DZZ A;  4UI9 B;  5G05 B;  3QSD A;  2LGL A;  1N87 A;  1TU6 A;  3Q1D A;  3HHI A;  4QBB A;  2F6N A;  2E00 A;  4YBT A;  2JMI A;  5B8D A;  3H7D A;  3LJU X;  4F1P A;  1CS8 A;  3E9S A;  2HD5 A;  1WFK A;  1ZIV A;  1BOR A;  2BTW B;  1QXP A;  4R7E A;  2R6N A;  3B79 A;  1WEM A;  1Y08 A;  2DOS A;  1VSN A;  2ATO A;  2BDL A;  3IHP A;  2M1R A;  4UP0 A;  2FSA A;  1Z6U A;  1AU4 A;  3PDF A;  2AYO A;  2J7Q A;  2KFT A;  2YUC A;  1CB5 A;  4HXD B;  1JOC A;  3SOW A;  2YJC A;  3KNV A;  5SVI A;  4BS5 A;  2DC7 A;  1VD4 A;  1MM2 A;  3O37 A;  1SNK A;  2HXZ A;  3I2D A;  2E6R A;  1ATK A;  4I07 A;  4XZX A;  4MZS A;  2HDP A;  2MIQ A;  2XEU A;  1PPN A;  5B78 A;  5DIN A;  2PNX A;  3MTV A;  2ECT A;  1YK8 A;  2GHU A;  2XOZ A;  1GMY A;  4LKA A;  3KKU A;  1TL9 A;  4MI7 A;  2KWJ A;  4X6J A;  5F02 A;  1X4U A;  1YVB A;  2ECW A;  2D8U A;  1DCQ A;  3BCN A;  2NQG A;  2B1M A;  2HH5 A;  4AXL A;  1THE A;  2AUX A;  2XU5 A;  2CSV A;  1UKF A;  2FD4 A;  4CDE B;  5EZQ A;  2D8S A;  5FB0 A;  3PLW A;  1MHW A;  2PAD A;  3CBK A;  2M85 A;  2DCC A;  2Y1N A;  4YYV A;  1ZCM A;  2AN6 A;  2MNZ A;  3ZNH A;  2UZG A;  2MKE A;  1F29 A;  2L43 A;  2R9N A;  5CVM A;  2KKX A;  4S3O B;  3KV6 A;  3T7L A;  1FH0 A;  4L7X A;  4QF2 A;  2CIO A;  4BHW A;  2I50 A;  2YUR A;  2FQ9 A;  2OXQ C;  3HTK C;  2PBH A;  3CH2 X;  4X6H A;  3RVW A;  2KWO A;  1G25 A;  2FFW A;  2YJ9 A;  2JRI A;  2Y1M A;  3LQH A;  3TMP A;  3WXF A;  2DC6 A;  3O36 A;  5K3Q A;  1POP A;  3PHW A;  3L11 A;  1TLO A;  3KFQ A;  3MDB C;  4N4Z A;  4CA1 A;  4I04 A;  3U5M A;  3ERV A;  1KHP A;  3O65 A;  2PNS A;  2AS8 A;  1U5I A;  2KRE A;  5H1V A;  3OIS A;  5EGW A;  2KKY A;  2VPB A;  5TBN A;  4CZW A;  4V3L C;  7PCK A;  4PP1 A;  5CHV A;  1O0E A;  1PAD A;  4XI1 A;  3HCU A;  1DF0 A;  4A5U A;  4WZ3 B;  4Z0R A;  1CJL A;  4BOS A;  3P5V A;  1WEU A;  4R3D A;  2IDA A;  3OF9 A;  2YQM A;  1JM7 A;  2G6D A;  4OGC A;  3H8B A;  4BQV A;  5KH7 A;  3RTR B;  1GCB A;  4DMY A;  4Q8H A;  3KV5 A;  5TAB A;  4QH6 A;  5K16 A;  3PUR A;  1DEU A;  4MM3 B;  4XUI A;  4G54 A;  4GB0 A;  1LDK C;  2L0B A;  3W31 A;  4BOP A;  4DMX A;  2CSZ A;  2KYU A;  2PRE A;  3MTN A;  3HHA A;  3I06 A;  5AIU A;  3LDY A;  4BS6 A;  3FM8 C;  1PCI A;  2G6Q A;  1NQC A;  2R9M A;  4M0W A;  3U5O A;  3N4C A;  4N79 A;  3O0U A;  2LGV A;  4W4U A;  1F2A A;  1PVJ A;  3SHB A;  2VJE A;  2R9C A;  2DCA A;  2EXU A;  3PSE A;  2LDR A;  2VHS A;  1AYU A;  1AU0 A;  3HWN A;  1S4V A;  4ZQL A;  1KHQ A;  3NHE A;  2HHN A;  5LKT A;  5E6J A;  3M62 A;  4Q6F A;  2IBI A;  1AYW A;  2HYE D;  2XB1 A;  1HYI A;  2JQF R;  2XU3 A;  3RVX A;  2KU3 A;  4YYR A;  2ECG A;  2YSM A;  2PUY A;  1EWP A;  3H6S A;  3GV4 A;  3N9P A;  3T6R A;  3ZTG A;  4CDF B;  2LN0 A;  3USV A;  3FL2 A;  1MBM A;  4AYC A;  1U9Q X;  4K7C A;  3KSE A;  5A24 A;  2K16 A;  3FAO A;  3O35 A;  3T9K A;  4L58 A;  1XWH A;  3M99 A;  3M7K A;  2OZ2 A;  1RMD A;  3PRP A;  3V6C A;  2ECJ A;  2BDZ A;  3RVV A;  3OVX A;  3MOR A;  2OWA A;  4I7C A;  1WEP A;  2DCD A;  1WEV A;  2MUM A;  3MHS A;  4A49 A;  2O6X A;  2XU1 A;  2J7Q C;  5H9M A;  4HWY A;  4CDD B;  3CH3 X;  2KGG A;  4YBS A;  3V6E A;  4D8B A;  3OQC A;  3TRK A;  1IYM A;  1F2B A;  1A6R A;  4O64 A;  2XP0 A;  1CQD A;  1F2C A;  4S3O C;  4YAD A;  9PAP A;  5D1K B;  3F5V A;  3WXG A;  4CDC B;  2FE8 A;  2CON A;  2EA6 A;  3O70 A;  1YT7 A;  2DJG B;  4FIP A;  3O47 A;  1HYJ A;  1PPO A;  5LCW B;  3OF8 A;  2B1N A;  5I3L A;  1MM3 A;  5TDW A;  3I3T A;  2AVW A;  2VNF A;  4P16 A;  5D1M B;  4FJC A;  5DKA A;  4GNF A;  4AP4 A;  5TDR A;  2K1J A;  2G7Y A;  1WEE A;  4KLB A;  1AYV A;  3N9L A;  5LKX A;  1PPP A;  4MVT A;  3N9O A;  5JG6 A;  3LFY A;  3S3R A;  5KO3 A;  3C6W A;  2QIZ A;  5EZS A;  4QQ4 A;  3DPL R;  4GNE A;  2YJ8 A;  3FAN A;  2P7U A;  5J94 A;  2L80 A;  2LAU A;  1GEC E;  1K3B B;  1CV8 A;  2VHF A;  2BAY A;  2B0O E;  1KFU L;  3FEH A;  2FT2 A;  3LXS A;  2VPG A;  5LKZ A;  2DSM A;  2JTC A;  3E1Z B;  3O1G A;  4IC3 A;  1ME3 A;  1MIR A;  3PHD A;  5H1T A;  3BB7 A;  5SVI B;  2MA5 A;  2E61 A;  3QJ3 A;  2M3H A;  1EWM A;  3KDE C;  1WIM A;  4ZUX U;  5D1L B;  1PXV A;  3V43 A;  2WBF X;  4N3W A;  3CBJ A;  1AU2 A;  3PRM A;  2CT2 A;  1NB3 A;  1FBV A;  1BP4 A;  3L1X A;  3N3K A;  1AEC A;  4YAX A;  1ITO A;  1PBH A;  2LV9 A;  3ZYQ A;  3BY4 A;  3IV2 A;  3OVZ A;  2NQI A;  1CHC A;  3O34 A;  3ZNI A;  4X3G A;  2H0D A;  1T1H A;  3B21 A;  4ZTB A;  2MD7 B;  3N9M A;  3KWB X;  1QMY A;  4WUR A;  1BQI A;  4I05 A;  2EOD A;  3KW9 A;  5KH9 A;  4BOU A;  2LGG A;  2JUN A;  3EB6 A;  4RF1 A;  3IEJ A; 
#chains in the Genus database with same CATH homology
 2C2L A;  4GND A;  1MDW A;  1PPD A;  4LLB A;  1SP4 B;  4BPV A;  2YU4 A;  1F62 A;  2FYE A;  3ZVZ B;  2YSJ A;  4P5O B;  3M63 A;  3SOX A;  3LQJ A;  4W5C A;  2L5U A;  1IWD A;  1BY8 A;  3U5N A;  1CPJ A;  4QRG A;  1KFX L;  1VJV A;  2K17 A;  2NQD B;  2ECI A;  2DZY A;  2LQ6 A;  4PTB A;  2Y5B A;  3HD3 A;  4N4F A;  1JQP A;  4AVX A;  2C2V S;  2KGI A;  1LDJ B;  1WEQ A;  1X9Y A;  2Y43 A;  1E4U A;  2YHN A;  4QF3 A;  4FO9 A;  2AUZ A;  3WXE A;  3IMA A;  3N3G A;  2P86 A;  3HCS A;  1KXR A;  3IUT A;  1XKG A;  3O7A A;  1EWL A;  5LKU A;  2KIZ A;  5EF4 A;  5KH3 A;  4LK9 A;  2DCB A;  1VFY A;  5B77 A;  2LRI C;  2F42 A;  2VPD A;  4R8P K;  3LRQ A;  4QRV A;  1WGM A;  2VP7 A;  4YV8 A;  3BWK A;  1EWO A;  3H8C A;  4I7B A;  1DVP A;  1X4I A;  4NN2 A;  4YAB A;  2OUL A;  8PCH A;  1GLO A;  2P0R A;  2RI7 A;  1CSB B;  4B55 A;  1X4J A;  3N9N A;  4N8W A;  4WZ0 A;  4LJN A;  2MA6 A;  2QIC A;  5CHT A;  3SOU A;  4Q8G A;  5FEY A;  1U9V A;  1E2T A;  4IC2 A;  2ZET C;  2G8J A;  2F1G A;  3D6S A;  2F7D A;  2LXH C;  3DF0 A;  2H0D B;  1FP0 A;  2CKL B;  5JH3 A;  2YW8 A;  2CKL A;  2JRJ A;  4YVA A;  3N9Q A;  1GX3 A;  4C9Z A;  5TRB A;  4C5P A;  3K9M A;  5B75 A;  1Z2Q A;  2ECN A;  2FRA A;  2Y6E A;  3RPG C;  3HCT A;  2G8E A;  2AU1 A;  2JMD A;  1U9W A;  1Y4H A;  2C0Y A;  5J3X A;  4ZDT A;  2XU4 A;  2G43 A;  2F6J A;  1QDQ A;  3ZPV 1;  5B79 A;  2VJF B;  1ICF A;  3PNR A;  2YRE A;  5AIT A;  4R2Y A;  3K24 A;  3ZUA A;  2RSD A;  5H1U A;  2VJE B;  3MHH A;  3BPF A;  4P6E A;  4RY2 A;  4YAT A;  3IOQ A;  2M6M A;  3PW3 A;  4B86 C;  2MD8 C;  2QJ0 A;  2NAA A;  3O33 A;  2OP3 A;  4PAD A;  1M6D A;  3LQI A;  3PUQ A;  2EGP A;  2ECV A;  1PIP A;  1EF7 A;  5G04 B;  3KWZ A;  1WEN A;  4WA6 A;  3DQV R;  4NV8 A;  4YYS A;  1NL6 A;  3F75 A;  2JQG R;  4YYW A;  2ACT A;  1PE6 A;  3EB5 A;  2KR4 A;  4A4B A;  1CTE A;  1WE9 A;  2VJF A;  6PAD A;  5FER A;  4YC9 A;  1ZBD B;  1U6G B;  2AIM A;  4A4C A;  2GFO A;  4FK5 A;  4CCG X;  3H89 A;  2IPP B;  1NB5 A;  3U5P A;  4LAD B;  2ARY A;  5FB1 A;  3KQI A;  4F52 B;  1YK7 A;  5G0F A;  4BSQ A;  3PBH A;  2R9O A;  1MEM A;  2FUU A;  1WEO A;  1WES A;  2E03 A;  4AXM A;  2FUD A;  4QRX A;  1STF E;  4PI3 A;  2E01 A;  1AIM A;  2FUI A;  4WZ2 A;  4BBQ A;  1W4T A;  2CB5 A;  4OEM A;  2FO5 A;  4YYQ A;  5CVN B;  4YYU A;  5CVO B;  2KWK A;  3BC3 A;  1YAL A;  4NV7 A;  2LGK A;  1U9X A;  3BOW A;  1BGO A;  2NQA A;  2DJF B;  2YT5 A;  2YYR A;  2YJ2 A;  2R9F A;  3P5W A;  3U8E A;  4PP2 E;  4OEL A;  4W5B A;  2E6S A;  5JA7 A;  1Q6K A;  2H7J A;  1K2F A;  3L1Z B;  2VPE A;  2G45 A;  4P6G A;  5PAD A;  1ME4 A;  3ZPV E;  2DC9 A;  4X6I A;  2MNY A;  3NG2 A;  5C13 A;  4AYC B;  3C5K A;  3AI8 A;  3GCB A;  3QZV A;  3KX1 A;  1JM7 B;  4GNG A;  1MS6 A;  1V87 A;  3ZVY A;  3C9E A;  3K8U A;  2LXP C;  3QT4 A;  1MEG A;  3P5X A;  4AUQ B;  3TNX A;  2FRQ A;  2FTD A;  2DC8 A;  2KE1 A;  4B7Y C;  1QOL A;  1HUC B;  2L75 A;  5EYA F;  4UP5 A;  5C11 A;  4TKP B;  2YQL A;  4I7D A;  4MZO A;  1AU3 A;  4MSX A;  2DX8 A;  3VK6 A;  4YBM A;  2YHO A;  2E02 A;  3S3Q A;  1Z60 A;  1NLJ A;  1WIL A;  3P5U A;  1NPZ A;  5FPW A;  3GL6 A;  4BGF A;  2AYN A;  2CSY A;  1VYX A;  1CVZ A;  2JMJ A;  4GUZ A;  4V3K C;  3ASL A;  2KWN A;  1WEW A;  2K4D A;  3RPG B;  2MT5 A;  4PPE A;  5B76 A;  3BPM A;  2YJB A;  4A0C D;  2DZZ A;  4UI9 B;  5G05 B;  3QSD A;  2LGL A;  1N87 A;  1TU6 A;  3HHI A;  4QBB A;  2F6N A;  2E00 A;  4YBT A;  2JMI A;  5B8D A;  3H7D A;  1CS8 A;  2HD5 A;  1WFK A;  1ZIV A;  1BOR A;  1QXP A;  4R7E A;  2R6N A;  3B79 A;  1WEM A;  1Y08 A;  1VSN A;  2ATO A;  2BDL A;  3IHP A;  2M1R A;  4UP0 A;  2FSA A;  1Z6U A;  1AU4 A;  3PDF A;  2AYO A;  2KFT A;  2YUC A;  1CB5 A;  4BS5 A;  1JOC A;  3SOW A;  1W6F A;  3KNV A;  2YJC A;  2DC7 A;  1VD4 A;  1MM2 A;  3O37 A;  1SNK A;  2HXZ A;  3I2D A;  2E6R A;  1ATK A;  4I07 A;  4MZS A;  2HDP A;  2MIQ A;  2XEU A;  1PPN A;  5B78 A;  5DIN A;  2PNX A;  2ECT A;  1YK8 A;  2GHU A;  1GMY A;  4LKA A;  3KKU A;  1TL9 A;  4X6J A;  2KWJ A;  5F02 A;  1X4U A;  1YVB A;  2ECW A;  3BCN A;  2NQG A;  2B1M A;  2HH5 A;  4AXL A;  1THE A;  2AUX A;  2XU5 A;  4CDE B;  2D8S A;  5FB0 A;  1MHW A;  2PAD A;  3CBK A;  2M85 A;  2DCC A;  2Y1N A;  4YYV A;  1ZCM A;  2AN6 A;  2MNZ A;  2UZG A;  1F29 A;  2R9N A;  2L43 A;  5CVM A;  4S3O B;  3KV6 A;  3T7L A;  1FH0 A;  4L7X A;  4QF2 A;  2CIO A;  4BHW A;  2I50 A;  2YUR A;  2FQ9 A;  2OXQ C;  3HTK C;  2PBH A;  3CH2 X;  4X6H A;  3RVW A;  2KWO A;  1G25 A;  2YJ9 A;  2VFB A;  2Y1M A;  3LQH A;  3WXF A;  2DC6 A;  3O36 A;  1POP A;  3LTW A;  3L11 A;  2BSZ A;  1TLO A;  3KFQ A;  4N4Z A;  4CA1 A;  4I04 A;  3U5M A;  3ERV A;  1KHP A;  2PNS A;  2AS8 A;  1U5I A;  2KRE A;  5H1V A;  3OIS A;  5EGW A;  2VPB A;  5TBN A;  4CZW A;  4V3L C;  7PCK A;  4PP1 A;  5CHV A;  1O0E A;  1PAD A;  4XI1 A;  3HCU A;  1DF0 A;  4WZ3 B;  1CJL A;  3P5V A;  1WEU A;  2IDA A;  3OF9 A;  2YQM A;  1JM7 A;  2G6D A;  4BQV A;  3H8B A;  5KH7 A;  3RTR B;  1GCB A;  4DMY A;  4Q8H A;  3KV5 A;  5TAB A;  4QH6 A;  5K16 A;  3PUR A;  1DEU A;  4XUI A;  4G54 A;  4GB0 A;  1LDK C;  2L0B A;  4DMX A;  2CSZ A;  2KYU A;  2PRE A;  3MTN A;  3HHA A;  3I06 A;  5AIU A;  4BS6 A;  1PCI A;  2G6Q A;  1NQC A;  2R9M A;  3U5O A;  3N4C A;  4N79 A;  3O0U A;  2LGV A;  4W4U A;  1F2A A;  3SHB A;  2VJE A;  2R9C A;  2DCA A;  2LDR A;  2VHS A;  1AYU A;  1AU0 A;  3HWN A;  1S4V A;  4ZQL A;  1KHQ A;  3NHE A;  2HHN A;  5LKT A;  3M62 A;  4Q6F A;  2IBI A;  1AYW A;  2HYE D;  2XB1 A;  1HYI A;  2JQF R;  2XU3 A;  3RVX A;  2KU3 A;  4YYR A;  2ECG A;  2YSM A;  2PUY A;  1EWP A;  3H6S A;  3GV4 A;  3N9P A;  3T6R A;  3ZTG A;  4CDF B;  2LN0 A;  3D9W A;  3USV A;  3FL2 A;  4AYC A;  1U9Q X;  4K7C A;  3KSE A;  5A24 A;  2K16 A;  3O35 A;  4L58 A;  1XWH A;  3M99 A;  2OZ2 A;  1RMD A;  3V6C A;  2ECJ A;  2BDZ A;  3RVV A;  3OVX A;  3MOR A;  4I7C A;  1WEP A;  2DCD A;  1WEV A;  2MUM A;  3MHS A;  4A49 A;  2O6X A;  2XU1 A;  5H9M A;  4HWY A;  4CDD B;  3CH3 X;  2KGG A;  4YBS A;  3V6E A;  1IYM A;  1F2B A;  1A6R A;  4O64 A;  1CQD A;  1F2C A;  4S3O C;  4YAD A;  9PAP A;  5D1K B;  3F5V A;  3WXG A;  4CDC B;  3O70 A;  2EA6 A;  1YT7 A;  2DJG B;  4FIP A;  1HYJ A;  1PPO A;  5LCW B;  3OF8 A;  2B1N A;  5I3L A;  1MM3 A;  5TDW A;  3I3T A;  2AVW A;  2VNF A;  5D1M B;  4FJC A;  5DKA A;  4GNF A;  4AP4 A;  5TDR A;  2K1J A;  2G7Y A;  1WEE A;  4KLB A;  1AYV A;  3N9L A;  5LKX A;  1PPP A;  4MVT A;  3N9O A;  5JG6 A;  3LFY A;  3S3R A;  3C6W A;  2QIZ A;  3DPL R;  4GNE A;  2YJ8 A;  2P7U A;  5J94 A;  2L80 A;  1K3B B;  1GEC E;  1CV8 A;  2VHF A;  2BAY A;  1KFU L;  2FT2 A;  3LXS A;  2VPG A;  5LKZ A;  3E1Z B;  3O1G A;  4IC3 A;  1ME3 A;  1MIR A;  3PHD A;  5H1T A;  2VFC A;  2MA5 A;  3QJ3 A;  2M3H A;  1EWM A;  1WIM A;  4ZUX U;  5D1L B;  1PXV A;  3V43 A;  2WBF X;  4N3W A;  3CBJ A;  1AU2 A;  2CT2 A;  1NB3 A;  1FBV A;  1BP4 A;  3L1X A;  3N3K A;  1AEC A;  4YAX A;  1ITO A;  1PBH A;  2LV9 A;  1W5R A;  3ZYQ A;  3IV2 A;  3OVZ A;  2NQI A;  1CHC A;  3O34 A;  3ZNI A;  4X3G A;  2H0D A;  1T1H A;  2MD7 B;  3N9M A;  3KWB X;  1QMY A;  1BQI A;  4I05 A;  2EOD A;  3KW9 A;  5KH9 A;  2LGG A;  3EB6 A;  4XR7 A;  3IEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...