4FJCA

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
472
structure length
447
Chain Sequence
b'AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 126
structure length 447
sequence length 472
chains with identical sequence E
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fjcA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fjcA02
3IV2A 2KGIA 1PADA 1JQPA 2L0BA 3PURA 2AS8A 3S3RA 5LKTA 5J94A 1NLJA 1WESA 2EA6A 5FPWA 4CDDB 2L75A 3U5PA 3PDFA 2FSAA 3P5VA 2CT2A 1WFKA 3IOQA 5DKAA 2AIMA 2DCBA 2E00A 4AVXA 3N9OA 3SOUA 3I3TA 3OF9A 1DF0A 2K4DA 1HYIA 4N3WA 5F02A 2KWOA 5EYAF 3EB5A 4BHWA 5B77A 3U5NA 4AXMA 5I3LA 2G6QA 2ECJA 4V3KC 2KU3A 1NQCA 5LCWB 2YSJA 3F5VA 1EWLA 3N3GA 3NHEA 2OULA 3LQJA 2AYNA 1Z2QA 3O70A 4YABA 4ZDTA 3CBJA 2DCCA 2G8EA 2P86A 5K16A 3HHAA 2B1NA 3H8CA 2G43A 2K16A 2YHOA 1U9XA 2YJ8A 4CDFB 1MDWA 1KHPA 1BQIA 2YU4A 3ZPV1 1U6GB 1NL6A 2NQGA 1PXVA 3PHDA 1X4JA 1CJLA 1AYWA 4GB0A 2MA5A 2IBIA 4QRGA 3K9MA 2ECIA 3O33A 1XKGA 2BDZA 3FL2A 3GCBA 4QH6A 2MT5A 3O7AA 3DPLR 1F2BA 1MIRA 3N9LA 4PPEA 3LQIA 5H1UA 3RVXA 3QSDA 4AYCB 2ARYA 2Y1NA 5H1VA 1EF7A 2IPPB 1QDQA 4N4FA 1CSBB 1RMDA 4MSXA 2FYEA 2R6NA 5B8DA 1WIMA 5G04B 2F6JA 2LXHC 2YREA 2KWNA 1U9VA 3S3QA 5JH3A 3PBHA 5KH3A 4X6HA 4ZUXU 2Y1MA 4A4CA 2C0YA 4XI1A 1ME4A 5TBNA 4W4UA 4YYQA 4XUIA 1Y08A 2DZZA 3RPGC 4PP1A 4RY2A 2YURA 1YK7A 2R9OA 5B76A 2VNFA 1FH0A 3RTRB 3ZYQA 1LDJB 2H7JA 1DEUA 2R9FA 5CVOB 3BCNA 3O37A 2UZGA 4WZ0A 2OZ2A 1QOLA 3HTKC 1WEPA 2L5UA 2VPBA 5FB1A 1WENA 1TL9A 3OVZA 1SNKA 2BDLA 4GNEA 3SOWA 3BPMA 2PBHA 2Y43A 1E4UA 1CTEA 1PBHA 4YATA 2GHUA 2MA6A 1GECE 4FO9A 2Y6EA 1X4UA 1EWOA 1T1HA 4AUQB 3QT4A 4Q8HA 1BP4A 2VP7A 1YK8A 3M62A 3KFQA 3USVA 2R9NA 2M85A 3V6EA 2YUCA 4CCGX 1HYJA 1TLOA 4XR7A 4I7DA 3RVWA 7PCKA 3QZVA 5KH9A 3D6SA 1KFXL 2G45A 2M6MA 2YQLA 1ZIVA 4Q6FA 4YBTA 5H1TA 1V87A 2L43A 3HD3A 4CZWA 4OEMA 2F1GA 3OVXA 3U5MA 4ZQLA 1PPNA 5B78A 2DZYA 2VHSA 3N9MA 2H0DA 2AN6A 3KV5A 1WGMA 2MD8C 4F52B 4NN2A 2R9CA 5H9MA 3KX1A 1YVBA 2K1JA 1YALA 4OELA 3M63A 3KWZA 1WEMA 2CIOA 1AYUA 2VPGA 5FEYA 1FP0A 5JA7A 3L1XA 2XU5A 3KKUA 2EODA 3EB6A 9PAPA 3OF8A 2FRQA 1O0EA 3K8UA 1KHQA 3I06A 4A0CD 1IYMA 3E1ZB 5CVNB 3PUQA 2E03A 4TKPB 1X4IA 2QIZA 3C9EA 3BC3A 3T6RA 2KYUA 4DMYA 1THEA 2Y5BA 1WEEA 4QBBA 3MORA 1WILA 4YYUA 3ZTGA 3B79A 5EGWA 4I7BA 2OP3A 2PUYA 4PI3A 1Q6KA 1TU6A 2AU1A 2LGLA 2FUDA 3KSEA 4PADA 3ZNIA 2ECNA 4P5OB 2KR4A 4YBMA 1JOCA 2PNXA 3IHPA 2E6SA 2XU1A 1BGOA 1AU3A 4N79A 2FUIA 2LQ6A 3ZPVE 2PADA 1XWHA 1QXPA 4A49A 3H8BA 3SOXA 3HWNA 2MUMA 2LGKA 5EF4A 4I7CA 1N87A 2HXZA 1WEOA 1AU2A 2P0RA 3V6CA 5C13A 4YYVA 1F2CA 2OXQC 5G05B 5D1MB 3V43A 1F29A 4I05A 1MHWA 3HHIA 4S3OB 5TABA 4YC9A 2AUZA 2ECGA 3H7DA 4I04A 4PP2E 1PPOA 2FUUA 3DQVR 4K7CA 1MM3A 3ZVZB 3RVVA 4BBQA 2G8JA 2F6NA 3I2DA 2L80A 2YT5A 4P6EA 4W5BA 2ECTA 4WZ2A 3N3KA 4R7EA 4WZ3B 1PE6A 2H0DB 3CBKA 4G54A 2F42A 3NG2A 4LLBA 1U5IA 2P7UA 1POPA 4IC3A 3KNVA 1CPJA 1A6RA 2HD5A 2YHNA 1YT7A 1LDKC 1STFE 2HH5A 3RPGB 2CKLA 1VFYA 1SP4B 2DCDA 2DCAA 4P6GA 1WE9A 3WXGA 3F75A 5AIUA 4QF2A 2G7YA 2D8SA 4WA6A 4UP0A 3WXFA 3OISA 3IEJA 1CV8A 5PADA 2GFOA 2LRIC 1K3BB 4R8PK 4FJCA 3ZUAA 1GMYA 5TDRA 4UI9B 2FT2A 2G6DA 3U5OA 3O34A 4YYRA 3BPFA 3O1GA 2FRAA 1MM2A 3GV4A 4YADA 1PPPA 1PPDA 5CHTA 1WEUA 2WBFX 1Y4HA 1AYVA 3O0UA 4MZOA 4B7YC 5CVMA 2JRJA 2KWJA 1CVZA 2VJEA 5LKUA 3N9NA 3ZVYA 3VK6A 1U9WA 3N4CA 3HCTA 3H89A 1K2FA 4BSQA 3P5WA 3ASLA 2ECWA 3C5KA 2E02A 4N4ZA 1BORA 1G25A 3U8EA 4R2YA 1Z6UA 2DJFB 4GNDA 1HUCB 2NQIA 3MTNA 1JM7A 4FIPA 1NB3A 2VJFB 3LQHA 2YJ9A 4W5CA 6PADA 5B79A 1EWPA 4YBSA 2ATOA 2DX8A 3BOWA 1MS6A 4BS5A 1WEQA 2AYOA 1F2AA 3K24A 1ZCMA 2MNZA 2JQFR 5A24A 5C11A 2HHNA 2XEUA 5LKZA 4YV8A 2CB5A 2KWKA 8PCHA 1IWDA 3MHHA 2E01A 1CHCA 2PREA 4HWYA 3WXEA 4DMXA 1VD4A 4CDEB 1CQDA 3O35A 2CKLB 3MHSA 1AECA 4LADB 3N9QA 1CB5A 5TDWA 2MD7B 4X3GA 3ERVA 1MEGA 2VHFA 4AP4A 4LKAA 2XU4A 2FO5A 3HCUA 4CA1A 2QJ0A 2HDPA 1U9QX 4BPVA 2YQMA 2K17A 2C2VS 2CSYA 3L11A 4GNFA 5B75A 2JMIA 3LFYA 4QF3A 5JG6A 1GLOA 3DF0A 4AXLA 4YAXA 4L7XA 4BS6A 2VJFA 4I07A 2PNSA 2DJGB 1VSNA 2ZETC 1CS8A 5CHVA 5AITA 3SHBA 2BAYA 1DVPA 5D1KB 1EWMA 2O6XA 2JMJA 2IDAA 4QRVA 2KIZA 2VJEB 2B1MA 2QICA 3P5XA 3AI8A 1MEMA 3O36A 3PW3A 3T7LA 5D1LB 1VYXA 2E6RA 1AIMA 1S4VA 1KXRA 1NB5A 2NQAA 4PTBA 1ZBDB 2YJCA 2MIQA 2HYED 1M6DA 2YJBA 2JQGR 4YYSA 2LDRA 1GCBA 1ICFA 2RI7A 1AU4A 1JM7B 1KFUL 1WEWA 5J3XA 2DC7A 3BWKA 2R9MA 2LXPC 3M99A 2VPDA 4LK9A 4S3OC 4BQVA 2YW8A 1NPZA 4UP5A 1WEVA 2CSZA 2LGGA 4QRXA 4KLBA 2DC9A 1AU0A 3LRQA 3KQIA 1QMYA 2KE1A 3HCSA 2NQDB 2EGPA 1ATKA 4Q8GA 2RSDA 5LKXA 2C2LA 1VJVA 4X6JA 3KV6A 3KWBX 5FB0A 5TRBA 1FBVA 2ECVA 2LGVA 4B86C 3KW9A 2DC8A 5DINA 4L58A 2JMDA 2KFTA 2F7DA 2VPEA 2YSMA 2FQ9A 1BY8A 2MNYA 1ITOA 3QJ3A 2XB1A 2M1RA 3LXSA 2LV9A 2YJ2A 3CH2X 3N9PA 3C6WA 2AVWA 3CH3X 2YYRA 2LN0A 2AUXA 2XU3A 3IMAA 3L1ZB 4MZSA 4V3LC 1PCIA 4MVTA 2KREA 4LJNA 4O64A 5G0FA 4C9ZA 2ACTA 2KGGA 4AYCA 3PNRA 3H6SA 5FERA 4FK5A 1PIPA 3IUTA 5KH7A 3TNXA 3GL6A 1ME3A 2NAAA 2DC6A 1F62A 4X6IA 4YYWA 4GNGA 4IC2A 1X9YA 4A4BA 4YVAA 4N8WA 2I50A 2FTDA 4CDCB 2M3HA 3P5UA 1Z60A
chains in the Genus database with same CATH superfamily
3IV2A 4QQ4A 2KGIA 4F1PA 1PADA 1JQPA 2L0BA 3PURA 3PRPA 2AS8A 3S3RA 5LKTA 5J94A 1NLJA 1WESA 2EA6A 5FPWA 4CDDB 2L75A 3U5PA 3PDFA 2FSAA 3P5VA 2XOZA 2CT2A 1WFKA 3IOQA 5DKAA 2AIMA 2DCBA 2E00A 4AVXA 3N9OA 5SVIA 2XOYA 3SOUA 3I3TA 3OF9A 1DF0A 2K4DA 1HYIA 4N3WA 5F02A 2KWOA 5EYAF 3EB5A 4BHWA 5B77A 2LAUA 3U5NA 4AXMA 5I3LA 2G6QA 2ECJA 4V3KC 2KU3A 1NQCA 5LCWB 2YSJA 3F5VA 1EWLA 3N3GA 3NHEA 2OULA 3LQJA 3FEHA 2AYNA 1Z2QA 1DCQA 3O70A 4YABA 4ZDTA 3LVQE 3CBJA 2DCCA 2G8EA 2P86A 5K16A 5SVXA 3RNVA 3HHAA 2B1NA 4OW0A 3H8CA 2G43A 2K16A 1DKIA 2DOSA 4OVZA 2YHOA 1U9XA 2YJ8A 4CDFB 1MDWA 2FD4A 1KHPA 1BQIA 2YU4A 3ZPV1 1U6GB 1NL6A 2NQGA 3BBAA 1PXVA 3PHDA 1X4JA 1CJLA 1AYWA 4GB0A 2MA5A 2IBIA 4QRGA 5EZSA 3K9MA 4BOUA 2ECIA 3O33A 1XKGA 2BDZA 3FL2A 3GCBA 4QH6A 2MT5A 3O7AA 3DPLR 1F2BA 1MIRA 3E2DA 3N9LA 4PPEA 3LQIA 5H1UA 3RVXA 3QSDA 4AYCB 2ARYA 2Y1NA 5H1VA 1EF7A 4M0WA 2IPPB 1QDQA 4N4FA 3MTVA 1CSBB 1RMDA 4MSXA 2FYEA 2R6NA 5B8DA 1WIMA 5G04B 2F6JA 2LXHC 2YREA 2KWNA 1U9VA 3S3QA 2JUNA 2E61A 5JH3A 3PBHA 5KH3A 4X6HA 4ZUXU 2Y1MA 2AGAA 4A4CA 2EGMA 2C0YA 4XI1A 1ME4A 5TBNA 4W4UA 4YYQA 4XUIA 1Y08A 2DZZA 3RPGC 4MI7A 4PP1A 3PHWA 2YURA 1YK7A 2R9OA 4RY2A 5B76A 2RR4A 2VNFA 1FH0A 3RTRB 3ZYQA 1LDJB 2H7JA 1DEUA 2R9FA 5CVOB 3DDTA 3BCNA 3O37A 2UZGA 4GUAA 4WZ0A 2OZ2A 5SVIB 1QOLA 3HTKC 3LJUX 1WEPA 2L5UA 2VPBA 5FB1A 1WENA 3FAOA 1TL9A 3OVZA 1SNKA 2BDLA 4GNEA 3SOWA 3BPMA 2PBHA 2Y43A 1E4UA 1YZBA 1CTEA 1PBHA 4YATA 2GHUA 4RF0A 2MA6A 1GECE 4FO9A 2Y6EA 1X4UA 1EWOA 1T1HA 4AUQB 3QT4A 4Q8HA 1BP4A 2VP7A 1YK8A 3M62A 3KFQA 5K3QA 3USVA 2R9NA 2M85A 2CSVA 3V6EA 2YUCA 4CCGX 1HYJA 1TLOA 4P16A 4XR7A 4I7DA 3RVWA 7PCKA 3QZVA 5KH9A 3D6SA 3W31A 3JUEA 1KFXL 2G45A 2M6MA 2YQLA 1ZIVA 4Q6FA 4YBTA 5H1TA 1V87A 2L43A 3HD3A 2J7QC 4CZWA 4RNAA 4OEMA 2F1GA 3OVXA 3U5MA 4ZQLA 1PPNA 5B78A 2DZYA 2VHSA 3N9MA 2H0DA 3LVRE 2AN6A 3KV5A 1WGMA 2MD8C 4F52B 4NN2A 2R9CA 5H9MA 3KX1A 1YVBA 2K1JA 1YALA 4OELA 3M63A 3KWZA 1WEMA 2CIOA 1AYUA 2VPGA 5FEYA 1FP0A 5JA7A 3L1XA 2XU5A 3KKUA 2EODA 3EB6A 2UZJA 9PAPA 3OF8A 2FRQA 1O0EA 3K8UA 1KHQA 3I06A 4A0CD 1IYMA 3E1ZB 5CVNB 3FANA 3PUQA 4OGCA 2E03A 4TKPB 1X4IA 2QIZA 3MP2A 3C9EA 3BC3A 3T6RA 2KYUA 4DMYA 3O65A 1THEA 2Y5BA 1WEEA 4QBBA 3MORA 1WILA 3MJ5A 4YYUA 3FJUB 3ZTGA 2D8UA 3B79A 5EGWA 4I7BA 2OP3A 2PUYA 4PI3A 2DSMA 2B0OE 1Q6KA 1TU6A 2AU1A 2LGLA 2FUDA 3KSEA 4PADA 3ZNIA 2ECNA 4P5OB 2KR4A 3Q1DA 1JOCA 2PNXA 3IHPA 2E6SA 4YBMA 2XU1A 1BGOA 1AU3A 4N79A 2FUIA 2LQ6A 3ZPVE 2PADA 1XWHA 1QXPA 4A49A 3E9SA 3H8BA 3SOXA 4ZTBA 3HWNA 2MUMA 2LGKA 5EF4A 4I7CA 1N87A 2HXZA 1WEOA 1AU2A 2P0RA 2BTWB 3V6CA 5C13A 4YYVA 1F2CA 2OXQC 5G05B 5D1MB 3V43A 1F29A 4I05A 1MHWA 3HHIA 4S3OB 5TABA 4YC9A 2AUZA 2ECGA 3H7DA 4I04A 4PP2E 1PPOA 2FUUA 4RF1A 3DQVR 4K7CA 2P57A 1MM3A 3ZVZB 2L7PA 3RVVA 4BBQA 2G8JA 2F6NA 3I2DA 2L80A 2YT5A 4P6EA 4W5BA 2ECTA 4WZ2A 3N3KA 4R7EA 4WZ3B 1PE6A 2H0DB 3PHUA 4HXDB 3CBKA 4G54A 2F42A 3NG2A 4LLBA 1U5IA 2BU3A 1POPA 2P7UA 3MDBC 4IC3A 4IP3A 3KNVA 1CPJA 1A6RA 2HD5A 2YHNA 1YT7A 4D8BA 1LDKC 1STFE 2HH5A 3RPGB 2CKLA 1VFYA 1SP4B 2DCDA 2DCAA 3DWDA 3ZNHA 3FM8C 4P6GA 1WE9A 3WXGA 3F75A 5AIUA 4QF2A 2G7YA 2D8SA 4WA6A 4UP0A 3WXFA 3OISA 3IEJA 1CV8A 5PADA 2GFOA 3TRKA 2LRIC 1K3BB 4Z0OA 4R8PK 4FJCA 3ZUAA 1GMYA 5TDRA 4UI9B 2FT2A 2G6DA 3U5OA 3O34A 4YYRA 3BPFA 3O1GA 2FRAA 1MM2A 3GV4A 4YADA 1PPPA 1PPDA 2BTWA 1WEUA 5CHTA 2WBFX 1Y4HA 1AYVA 3O0UA 4MZOA 4B7YC 5CVMA 3H7HA 2JRJA 2KWJA 3LDYA 1CVZA 2VJEA 4XZXA 5LKUA 3N9NA 3ZVYA 3VK6A 2EXUA 1U9WA 3N4CA 3HCTA 3H89A 1K2FA 4BSQA 3P5WA 3ASLA 2ECWA 3C5KA 2E02A 4N4ZA 1BORA 1G25A 3SUBA 3U8EA 4R2YA 1Z6UA 4Z0RA 2DJFB 4GNDA 1HUCB 2NQIA 3MTNA 1JM7A 4PT5A 4FIPA 1NB3A 2IQJA 2VJFB 5EZQA 3W30A 3LQHA 3BY4A 2YJ9A 4W5CA 6PADA 5B79A 4BOQA 1EWPA 4YBSA 2ATOA 2DX8A 3BOWA 1MS6A 4BS5A 2YVRA 1WEQA 2AYOA 3PSEA 1F2AA 3K24A 1ZCMA 2MNZA 2JQFR 4REZA 5A24A 5C11A 2HHNA 2XEUA 5LKZA 4YV8A 2DJAA 4BOSA 5SVYA 3TMPA 1UKFA 2KKYA 2CB5A 5E6JA 2KWKA 8PCHA 1IWDA 3MHHA 2E01A 1CHCA 2PREA 4HWYA 3WXEA 2CRWA 4DMXA 1VD4A 4CDEB 1CQDA 3O35A 5KO3A 3B21A 2CKLB 2MKEA 3MHSA 1AECA 4LADB 3N9QA 1CB5A 5TDWA 2MD7B 4X3GA 1MBMA 3ERVA 3PLWA 1MEGA 2VHFA 4AP4A 4LKAA 2XU4A 2FO5A 2XOCA 3HCUA 4CA1A 3O47A 2QJ0A 2HDPA 1U9QX 4BPVA 2YQMA 2K17A 2JTCA 2C2VS 2CSYA 3L11A 3M7KA 4GNFA 5B75A 2JMIA 3LFYA 2J7QA 2JM3A 4QF3A 5JG6A 1GLOA 3DF0A 2JRIA 4YAXA 3PT2A 4AXLA 4L7XA 4BS6A 2VJFA 4I07A 2PNSA 2DJGB 1VSNA 2ZETC 1CS8A 5CHVA 5AITA 3SHBA 2BAYA 1DVPA 5D1KB 1EWMA 2O6XA 2JMJA 3PHXA 2IDAA 4RKXA 4QRVA 4WURA 2KIZA 2VJEB 2B1MA 2QICA 3P5XA 3AI8A 4YYSA 1MEMA 3O36A 3PW3A 3T7LA 5D1LB 3C0RA 4BOZA 1VYXA 4MM3B 2E6RA 3PRMA 1AIMA 3IFUA 1S4VA 1KXRA 1NB5A 2NQAA 2HWKA 4PTBA 2CRRA 1ZBDB 2YJCA 2MIQA 2HYED 1M6DA 2YJBA 2JQGR 4IUMA 2LDRA 1GCBA 1ICFA 2RI7A 1AU4A 1JM7B 1KFUL 1WEWA 5J3XA 2DC7A 3BWKA 2R9MA 2LXPC 3M99A 2VPDA 4LK9A 4S3OC 4BQVA 2YW8A 1NPZA 4UP5A 4A5UA 1WEVA 2CSZA 2LGGA 4QRXA 4KLBA 2DC9A 1AU0A 3LRQA 3KQIA 1QMYA 2KE1A 2FFWA 3HCSA 2Z84A 2NQDB 2EGPA 1ATKA 4Q8GA 2RSDA 5LKXA 2FE8A 2C2LA 1VJVA 4X6JA 3KV6A 3KWBX 5FB0A 5TRBA 4BOPA 1FBVA 3OQCA 2ECVA 2LGVA 4B86C 3KW9A 2KKXA 2DC8A 2XP0A 5DINA 4L58A 2JMDA 2KFTA 2F7DA 2VPEA 2YSMA 2FQ9A 1BY8A 2MNYA 4H9DA 1ITOA 3QJ3A 5JZEA 2XB1A 2M1RA 3LXSA 2LV9A 4O62A 2YJ2A 3CH2X 3N9PA 3C6WA 2AVWA 3CH3X 2YYRA 3KDEC 2LN0A 2AUXA 3T9KA 2XU3A 3IMAA 4D8EA 3L1ZB 4MZSA 4V3LC 1PCIA 4MVTA 2KREA 4LJNA 2M13A 4D8IA 4O64A 5G0FA 4C9ZA 1PVJA 2ACTA 2KGGA 4AYCA 4OGEA 3H6SA 5FERA 3PNRA 4FK5A 1PIPA 3IUTA 5KH7A 3TNXA 3GL6A 1ME3A 2CONA 2NAAA 3BB7A 2DC6A 1F62A 4X6IA 4YYWA 4GNGA 4OVZB 4IC2A 2OWAA 4R3DA 1X9YA 4A4BA 4YVAA 4N8WA 2I50A 2FTDA 4CDCB 2M3HA 3P5UA 1Z60A
chains in the Genus database with same CATH topology
3IV2A 2KGIA 1PADA 1JQPA 2L0BA 3PURA 2AS8A 3S3RA 5LKTA 5J94A 1NLJA 1WESA 2EA6A 5FPWA 4CDDB 2L75A 3U5PA 3PDFA 2FSAA 3P5VA 1E2TA 2CT2A 1WFKA 3IOQA 5DKAA 2AIMA 2DCBA 2E00A 4AVXA 3N9OA 3SOUA 3I3TA 3OF9A 1DF0A 2K4DA 1HYIA 4N3WA 5F02A 2KWOA 5EYAF 3EB5A 4BHWA 5B77A 3U5NA 4AXMA 5I3LA 2G6QA 2ECJA 4V3KC 2KU3A 1NQCA 5LCWB 2YSJA 3F5VA 1EWLA 3N3GA 3NHEA 2OULA 3LQJA 2AYNA 1Z2QA 3O70A 4YABA 4ZDTA 3CBJA 2DCCA 2G8EA 2P86A 5K16A 3HHAA 2B1NA 3H8CA 2G43A 2K16A 2YHOA 1U9XA 2YJ8A 4CDFB 1MDWA 1KHPA 1BQIA 2YU4A 3ZPV1 1U6GB 1NL6A 2NQGA 1PXVA 3PHDA 1X4JA 1CJLA 1AYWA 4GB0A 2MA5A 2IBIA 4QRGA 3K9MA 2ECIA 3O33A 1XKGA 2BDZA 3FL2A 3GCBA 4QH6A 2MT5A 3O7AA 3DPLR 1F2BA 1MIRA 3N9LA 4PPEA 3LQIA 5H1UA 3RVXA 3QSDA 4AYCB 2ARYA 2Y1NA 5H1VA 1EF7A 2IPPB 1QDQA 4N4FA 1CSBB 1RMDA 4MSXA 2FYEA 2R6NA 5B8DA 1WIMA 5G04B 2F6JA 2LXHC 2YREA 2KWNA 1U9VA 3S3QA 5JH3A 3PBHA 5KH3A 4X6HA 4ZUXU 2Y1MA 4A4CA 2C0YA 4XI1A 1ME4A 5TBNA 4W4UA 4YYQA 4XUIA 1Y08A 2DZZA 3RPGC 4PP1A 4RY2A 2YURA 1YK7A 2R9OA 5B76A 2VNFA 1FH0A 3RTRB 3ZYQA 4B55A 4BGFA 1LDJB 2H7JA 1DEUA 2R9FA 5CVOB 3BCNA 3O37A 2UZGA 4WZ0A 2OZ2A 1QOLA 3HTKC 1WEPA 2L5UA 2VPBA 5FB1A 1WENA 1TL9A 3OVZA 1SNKA 2BDLA 4GNEA 3SOWA 2BSZA 3BPMA 2PBHA 2Y43A 1E4UA 1CTEA 1PBHA 4YATA 2GHUA 2MA6A 1GECE 4FO9A 2Y6EA 1X4UA 1EWOA 1T1HA 4AUQB 3QT4A 4Q8HA 1BP4A 2VP7A 1YK8A 3M62A 3KFQA 3USVA 2R9NA 2M85A 3V6EA 2YUCA 4CCGX 1HYJA 1TLOA 4XR7A 4I7DA 3RVWA 7PCKA 3QZVA 5KH9A 3D6SA 1KFXL 2G45A 2M6MA 2YQLA 1ZIVA 4Q6FA 4YBTA 5H1TA 1V87A 2L43A 3HD3A 4CZWA 4OEMA 2F1GA 3OVXA 3U5MA 4ZQLA 1PPNA 5B78A 2DZYA 2VHSA 3N9MA 2H0DA 2AN6A 3KV5A 1WGMA 2MD8C 4F52B 4NN2A 2R9CA 5H9MA 3KX1A 1YVBA 2K1JA 1YALA 4OELA 3M63A 3LTWA 3KWZA 1WEMA 2CIOA 1AYUA 2VPGA 5FEYA 1FP0A 5JA7A 3L1XA 2XU5A 3KKUA 2EODA 3EB6A 9PAPA 3OF8A 2FRQA 1O0EA 3K8UA 1KHQA 3I06A 4A0CD 1IYMA 3E1ZB 1W6FA 5CVNB 3PUQA 2E03A 4TKPB 1X4IA 2QIZA 2VFBA 3C9EA 3BC3A 3T6RA 2KYUA 4DMYA 1THEA 2Y5BA 1WEEA 4QBBA 3MORA 1WILA 4YYUA 3ZTGA 3B79A 5EGWA 4I7BA 2OP3A 2PUYA 4PI3A 1Q6KA 1TU6A 2AU1A 2LGLA 2FUDA 3KSEA 4PADA 3ZNIA 2ECNA 4P5OB 2KR4A 4YBMA 1JOCA 2PNXA 3IHPA 2E6SA 2XU1A 1BGOA 1AU3A 4N79A 2FUIA 2LQ6A 3ZPVE 2PADA 1XWHA 1QXPA 4A49A 3H8BA 3SOXA 3HWNA 2MUMA 2LGKA 5EF4A 4I7CA 4NV7A 1N87A 2HXZA 1WEOA 1AU2A 2P0RA 3V6CA 5C13A 4YYVA 1F2CA 2OXQC 5G05B 5D1MB 3V43A 1F29A 4I05A 1MHWA 3HHIA 4S3OB 5TABA 4YC9A 2AUZA 2ECGA 3H7DA 4I04A 4PP2E 1PPOA 2FUUA 3DQVR 4K7CA 1MM3A 3ZVZB 3RVVA 4BBQA 2G8JA 2F6NA 3I2DA 2L80A 2YT5A 4P6EA 4W5BA 2ECTA 4WZ2A 3N3KA 4R7EA 4WZ3B 1PE6A 2H0DB 3CBKA 4G54A 2F42A 3NG2A 4LLBA 1U5IA 2P7UA 1POPA 4IC3A 3KNVA 1CPJA 1A6RA 2HD5A 2YHNA 1YT7A 1LDKC 1STFE 2HH5A 3RPGB 2CKLA 1VFYA 1SP4B 2DCDA 2DCAA 4P6GA 1WE9A 3WXGA 3F75A 5AIUA 4QF2A 2G7YA 2D8SA 4WA6A 4UP0A 3WXFA 1GX3A 3IEJA 1CV8A 3OISA 2GFOA 5PADA 2LRIC 1K3BB 4R8PK 4FJCA 3ZUAA 1GMYA 5TDRA 4UI9B 2FT2A 2G6DA 3U5OA 3O34A 4YYRA 3BPFA 3O1GA 2FRAA 1MM2A 3GV4A 4YADA 1PPPA 1PPDA 5CHTA 1WEUA 2WBFX 1Y4HA 1AYVA 3O0UA 4MZOA 4B7YC 5CVMA 2JRJA 2KWJA 1CVZA 2VJEA 5LKUA 3N9NA 3ZVYA 3VK6A 1U9WA 3N4CA 3HCTA 3H89A 1K2FA 4BSQA 3P5WA 3ASLA 2ECWA 3C5KA 2E02A 4N4ZA 4C5PA 1BORA 1G25A 3U8EA 4R2YA 1Z6UA 2DJFB 4GNDA 1HUCB 2NQIA 3MTNA 1JM7A 4FIPA 1NB3A 2VJFB 3LQHA 2YJ9A 4W5CA 6PADA 5B79A 4NV8A 1EWPA 4YBSA 2ATOA 2DX8A 3BOWA 1MS6A 4BS5A 1WEQA 2AYOA 1F2AA 3K24A 1ZCMA 2MNZA 2JQFR 5A24A 5C11A 2HHNA 2XEUA 5LKZA 4YV8A 2CB5A 2KWKA 8PCHA 1IWDA 3MHHA 2E01A 1CHCA 2PREA 4HWYA 3WXEA 4DMXA 1VD4A 4CDEB 1CQDA 3O35A 2CKLB 3MHSA 1AECA 4LADB 3N9QA 1CB5A 5TDWA 2MD7B 4X3GA 3ERVA 1MEGA 2VHFA 4AP4A 4LKAA 2XU4A 2FO5A 3HCUA 4CA1A 2QJ0A 2HDPA 1U9QX 4BPVA 2YQMA 2K17A 2C2VS 2CSYA 3L11A 1W5RA 4GNFA 5B75A 2JMIA 3LFYA 4QF3A 5JG6A 1GLOA 3DF0A 4AXLA 4YAXA 4L7XA 4BS6A 2VJFA 4I07A 2PNSA 2DJGB 1VSNA 4GUZA 2ZETC 1CS8A 5CHVA 5AITA 3SHBA 2BAYA 1DVPA 5D1KB 1EWMA 2O6XA 2JMJA 2IDAA 4QRVA 2KIZA 2VJEB 2B1MA 2QICA 3P5XA 3AI8A 1MEMA 3O36A 3PW3A 3T7LA 5D1LB 1VYXA 2E6RA 1AIMA 1S4VA 1KXRA 1NB5A 2NQAA 4PTBA 1ZBDB 2YJCA 2MIQA 2HYED 1M6DA 2YJBA 2JQGR 4YYSA 2LDRA 1GCBA 1ICFA 2RI7A 1AU4A 2VFCA 1JM7B 1KFUL 1WEWA 5J3XA 2DC7A 3BWKA 2R9MA 2LXPC 3M99A 2VPDA 4LK9A 4S3OC 4BQVA 2YW8A 1NPZA 4UP5A 1WEVA 2CSZA 2LGGA 4QRXA 4KLBA 2DC9A 1AU0A 3LRQA 3KQIA 1QMYA 2KE1A 3HCSA 2NQDB 2EGPA 1ATKA 4Q8GA 2RSDA 5LKXA 2C2LA 1VJVA 4X6JA 3KV6A 3KWBX 5FB0A 5TRBA 1FBVA 2ECVA 2LGVA 4B86C 3KW9A 2DC8A 5DINA 4L58A 2JMDA 2KFTA 2F7DA 2VPEA 2YSMA 2FQ9A 1BY8A 2MNYA 1ITOA 3QJ3A 2XB1A 2M1RA 3LXSA 2LV9A 2YJ2A 3CH2X 3N9PA 3C6WA 2AVWA 3CH3X 2YYRA 2LN0A 2AUXA 2XU3A 3IMAA 3L1ZB 4MZSA 4V3LC 1PCIA 4MVTA 2KREA 4LJNA 4O64A 5G0FA 4C9ZA 2ACTA 2KGGA 4AYCA 3PNRA 3H6SA 5FERA 4FK5A 1PIPA 3IUTA 5KH7A 3TNXA 3GL6A 1ME3A 2NAAA 3D9WA 2DC6A 1W4TA 1F62A 4X6IA 4YYWA 4GNGA 4IC2A 1X9YA 4A4BA 4YVAA 4N8WA 2I50A 2FTDA 4CDCB 2M3HA 3P5UA 1Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV2 A;  2KGI A;  1PAD A;  1JQP A;  2L0B A;  3PUR A;  2AS8 A;  3S3R A;  5LKT A;  5J94 A;  1NLJ A;  1WES A;  2EA6 A;  5FPW A;  4CDD B;  2L75 A;  3U5P A;  3PDF A;  2FSA A;  3P5V A;  2CT2 A;  1WFK A;  3IOQ A;  5DKA A;  2AIM A;  2DCB A;  2E00 A;  4AVX A;  3N9O A;  3SOU A;  3I3T A;  3OF9 A;  1DF0 A;  2K4D A;  1HYI A;  4N3W A;  5F02 A;  2KWO A;  5EYA F;  3EB5 A;  4BHW A;  5B77 A;  3U5N A;  4AXM A;  5I3L A;  2G6Q A;  2ECJ A;  4V3K C;  2KU3 A;  1NQC A;  5LCW B;  2YSJ A;  3F5V A;  1EWL A;  3N3G A;  3NHE A;  2OUL A;  3LQJ A;  2AYN A;  1Z2Q A;  3O70 A;  4YAB A;  4ZDT A;  3CBJ A;  2DCC A;  2G8E A;  2P86 A;  5K16 A;  3HHA A;  2B1N A;  3H8C A;  2G43 A;  2K16 A;  2YHO A;  1U9X A;  2YJ8 A;  4CDF B;  1MDW A;  1KHP A;  1BQI A;  2YU4 A;  3ZPV 1;  1U6G B;  1NL6 A;  2NQG A;  1PXV A;  3PHD A;  1X4J A;  1CJL A;  1AYW A;  4GB0 A;  2MA5 A;  2IBI A;  4QRG A;  3K9M A;  2ECI A;  3O33 A;  1XKG A;  2BDZ A;  3FL2 A;  3GCB A;  4QH6 A;  2MT5 A;  3O7A A;  3DPL R;  1F2B A;  1MIR A;  3N9L A;  4PPE A;  3LQI A;  5H1U A;  3RVX A;  3QSD A;  4AYC B;  2ARY A;  2Y1N A;  5H1V A;  1EF7 A;  2IPP B;  1QDQ A;  4N4F A;  1CSB B;  1RMD A;  4MSX A;  2FYE A;  2R6N A;  5B8D A;  1WIM A;  5G04 B;  2F6J A;  2LXH C;  2YRE A;  2KWN A;  1U9V A;  3S3Q A;  5JH3 A;  3PBH A;  5KH3 A;  4X6H A;  4ZUX U;  2Y1M A;  4A4C A;  2C0Y A;  4XI1 A;  1ME4 A;  5TBN A;  4W4U A;  4YYQ A;  4XUI A;  1Y08 A;  2DZZ A;  3RPG C;  4PP1 A;  4RY2 A;  2YUR A;  1YK7 A;  2R9O A;  5B76 A;  2VNF A;  1FH0 A;  3RTR B;  3ZYQ A;  1LDJ B;  2H7J A;  1DEU A;  2R9F A;  5CVO B;  3BCN A;  3O37 A;  2UZG A;  4WZ0 A;  2OZ2 A;  1QOL A;  3HTK C;  1WEP A;  2L5U A;  2VPB A;  5FB1 A;  1WEN A;  1TL9 A;  3OVZ A;  1SNK A;  2BDL A;  4GNE A;  3SOW A;  3BPM A;  2PBH A;  2Y43 A;  1E4U A;  1CTE A;  1PBH A;  4YAT A;  2GHU A;  2MA6 A;  1GEC E;  4FO9 A;  2Y6E A;  1X4U A;  1EWO A;  1T1H A;  4AUQ B;  3QT4 A;  4Q8H A;  1BP4 A;  2VP7 A;  1YK8 A;  3M62 A;  3KFQ A;  3USV A;  2R9N A;  2M85 A;  3V6E A;  2YUC A;  4CCG X;  1HYJ A;  1TLO A;  4XR7 A;  4I7D A;  3RVW A;  7PCK A;  3QZV A;  5KH9 A;  3D6S A;  1KFX L;  2G45 A;  2M6M A;  2YQL A;  1ZIV A;  4Q6F A;  4YBT A;  5H1T A;  1V87 A;  2L43 A;  3HD3 A;  4CZW A;  4OEM A;  2F1G A;  3OVX A;  3U5M A;  4ZQL A;  1PPN A;  5B78 A;  2DZY A;  2VHS A;  3N9M A;  2H0D A;  2AN6 A;  3KV5 A;  1WGM A;  2MD8 C;  4F52 B;  4NN2 A;  2R9C A;  5H9M A;  3KX1 A;  1YVB A;  2K1J A;  1YAL A;  4OEL A;  3M63 A;  3KWZ A;  1WEM A;  2CIO A;  1AYU A;  2VPG A;  5FEY A;  1FP0 A;  5JA7 A;  3L1X A;  2XU5 A;  3KKU A;  2EOD A;  3EB6 A;  9PAP A;  3OF8 A;  2FRQ A;  1O0E A;  3K8U A;  1KHQ A;  3I06 A;  4A0C D;  1IYM A;  3E1Z B;  5CVN B;  3PUQ A;  2E03 A;  4TKP B;  1X4I A;  2QIZ A;  3C9E A;  3BC3 A;  3T6R A;  2KYU A;  4DMY A;  1THE A;  2Y5B A;  1WEE A;  4QBB A;  3MOR A;  1WIL A;  4YYU A;  3ZTG A;  3B79 A;  5EGW A;  4I7B A;  2OP3 A;  2PUY A;  4PI3 A;  1Q6K A;  1TU6 A;  2AU1 A;  2LGL A;  2FUD A;  3KSE A;  4PAD A;  3ZNI A;  2ECN A;  4P5O B;  2KR4 A;  4YBM A;  1JOC A;  2PNX A;  3IHP A;  2E6S A;  2XU1 A;  1BGO A;  1AU3 A;  4N79 A;  2FUI A;  2LQ6 A;  3ZPV E;  2PAD A;  1XWH A;  1QXP A;  4A49 A;  3H8B A;  3SOX A;  3HWN A;  2MUM A;  2LGK A;  5EF4 A;  4I7C A;  1N87 A;  2HXZ A;  1WEO A;  1AU2 A;  2P0R A;  3V6C A;  5C13 A;  4YYV A;  1F2C A;  2OXQ C;  5G05 B;  5D1M B;  3V43 A;  1F29 A;  4I05 A;  1MHW A;  3HHI A;  4S3O B;  5TAB A;  4YC9 A;  2AUZ A;  2ECG A;  3H7D A;  4I04 A;  4PP2 E;  1PPO A;  2FUU A;  3DQV R;  4K7C A;  1MM3 A;  3ZVZ B;  3RVV A;  4BBQ A;  2G8J A;  2F6N A;  3I2D A;  2L80 A;  2YT5 A;  4P6E A;  4W5B A;  2ECT A;  4WZ2 A;  3N3K A;  4R7E A;  4WZ3 B;  1PE6 A;  2H0D B;  3CBK A;  4G54 A;  2F42 A;  3NG2 A;  4LLB A;  1U5I A;  2P7U A;  1POP A;  4IC3 A;  3KNV A;  1CPJ A;  1A6R A;  2HD5 A;  2YHN A;  1YT7 A;  1LDK C;  1STF E;  2HH5 A;  3RPG B;  2CKL A;  1VFY A;  1SP4 B;  2DCD A;  2DCA A;  4P6G A;  1WE9 A;  3WXG A;  3F75 A;  5AIU A;  4QF2 A;  2G7Y A;  2D8S A;  4WA6 A;  4UP0 A;  3WXF A;  3OIS A;  3IEJ A;  1CV8 A;  5PAD A;  2GFO A;  2LRI C;  1K3B B;  4R8P K;  4FJC A;  3ZUA A;  1GMY A;  5TDR A;  4UI9 B;  2FT2 A;  2G6D A;  3U5O A;  3O34 A;  4YYR A;  3BPF A;  3O1G A;  2FRA A;  1MM2 A;  3GV4 A;  4YAD A;  1PPP A;  1PPD A;  5CHT A;  1WEU A;  2WBF X;  1Y4H A;  1AYV A;  3O0U A;  4MZO A;  4B7Y C;  5CVM A;  2JRJ A;  2KWJ A;  1CVZ A;  2VJE A;  5LKU A;  3N9N A;  3ZVY A;  3VK6 A;  1U9W A;  3N4C A;  3HCT A;  3H89 A;  1K2F A;  4BSQ A;  3P5W A;  3ASL A;  2ECW A;  3C5K A;  2E02 A;  4N4Z A;  1BOR A;  1G25 A;  3U8E A;  4R2Y A;  1Z6U A;  2DJF B;  4GND A;  1HUC B;  2NQI A;  3MTN A;  1JM7 A;  4FIP A;  1NB3 A;  2VJF B;  3LQH A;  2YJ9 A;  4W5C A;  6PAD A;  5B79 A;  1EWP A;  4YBS A;  2ATO A;  2DX8 A;  3BOW A;  1MS6 A;  4BS5 A;  1WEQ A;  2AYO A;  1F2A A;  3K24 A;  1ZCM A;  2MNZ A;  2JQF R;  5A24 A;  5C11 A;  2HHN A;  2XEU A;  5LKZ A;  4YV8 A;  2CB5 A;  2KWK A;  8PCH A;  1IWD A;  3MHH A;  2E01 A;  1CHC A;  2PRE A;  4HWY A;  3WXE A;  4DMX A;  1VD4 A;  4CDE B;  1CQD A;  3O35 A;  2CKL B;  3MHS A;  1AEC A;  4LAD B;  3N9Q A;  1CB5 A;  5TDW A;  2MD7 B;  4X3G A;  3ERV A;  1MEG A;  2VHF A;  4AP4 A;  4LKA A;  2XU4 A;  2FO5 A;  3HCU A;  4CA1 A;  2QJ0 A;  2HDP A;  1U9Q X;  4BPV A;  2YQM A;  2K17 A;  2C2V S;  2CSY A;  3L11 A;  4GNF A;  5B75 A;  2JMI A;  3LFY A;  4QF3 A;  5JG6 A;  1GLO A;  3DF0 A;  4AXL A;  4YAX A;  4L7X A;  4BS6 A;  2VJF A;  4I07 A;  2PNS A;  2DJG B;  1VSN A;  2ZET C;  1CS8 A;  5CHV A;  5AIT A;  3SHB A;  2BAY A;  1DVP A;  5D1K B;  1EWM A;  2O6X A;  2JMJ A;  2IDA A;  4QRV A;  2KIZ A;  2VJE B;  2B1M A;  2QIC A;  3P5X A;  3AI8 A;  1MEM A;  3O36 A;  3PW3 A;  3T7L A;  5D1L B;  1VYX A;  2E6R A;  1AIM A;  1S4V A;  1KXR A;  1NB5 A;  2NQA A;  4PTB A;  1ZBD B;  2YJC A;  2MIQ A;  2HYE D;  1M6D A;  2YJB A;  2JQG R;  4YYS A;  2LDR A;  1GCB A;  1ICF A;  2RI7 A;  1AU4 A;  1JM7 B;  1KFU L;  1WEW A;  5J3X A;  2DC7 A;  3BWK A;  2R9M A;  2LXP C;  3M99 A;  2VPD A;  4LK9 A;  4S3O C;  4BQV A;  2YW8 A;  1NPZ A;  4UP5 A;  1WEV A;  2CSZ A;  2LGG A;  4QRX A;  4KLB A;  2DC9 A;  1AU0 A;  3LRQ A;  3KQI A;  1QMY A;  2KE1 A;  3HCS A;  2NQD B;  2EGP A;  1ATK A;  4Q8G A;  2RSD A;  5LKX A;  2C2L A;  1VJV A;  4X6J A;  3KV6 A;  3KWB X;  5FB0 A;  5TRB A;  1FBV A;  2ECV A;  2LGV A;  4B86 C;  3KW9 A;  2DC8 A;  5DIN A;  4L58 A;  2JMD A;  2KFT A;  2F7D A;  2VPE A;  2YSM A;  2FQ9 A;  1BY8 A;  2MNY A;  1ITO A;  3QJ3 A;  2XB1 A;  2M1R A;  3LXS A;  2LV9 A;  2YJ2 A;  3CH2 X;  3N9P A;  3C6W A;  2AVW A;  3CH3 X;  2YYR A;  2LN0 A;  2AUX A;  2XU3 A;  3IMA A;  3L1Z B;  4MZS A;  4V3L C;  1PCI A;  4MVT A;  2KRE A;  4LJN A;  4O64 A;  5G0F A;  4C9Z A;  2ACT A;  2KGG A;  4AYC A;  3PNR A;  3H6S A;  5FER A;  4FK5 A;  1PIP A;  3IUT A;  5KH7 A;  3TNX A;  3GL6 A;  1ME3 A;  2NAA A;  2DC6 A;  1F62 A;  4X6I A;  4YYW A;  4GNG A;  4IC2 A;  1X9Y A;  4A4B A;  4YVA A;  4N8W A;  2I50 A;  2FTD A;  4CDC B;  2M3H A;  3P5U A;  1Z60 A; 
#chains in the Genus database with same CATH topology
 3IV2 A;  4QQ4 A;  2KGI A;  4F1P A;  1PAD A;  1JQP A;  2L0B A;  3PUR A;  3PRP A;  2AS8 A;  3S3R A;  5LKT A;  5J94 A;  1NLJ A;  1WES A;  2EA6 A;  5FPW A;  4CDD B;  2L75 A;  3U5P A;  3PDF A;  2FSA A;  3P5V A;  2XOZ A;  2CT2 A;  1WFK A;  3IOQ A;  5DKA A;  2AIM A;  2DCB A;  2E00 A;  4AVX A;  3N9O A;  5SVI A;  2XOY A;  3SOU A;  3I3T A;  3OF9 A;  1DF0 A;  2K4D A;  1HYI A;  4N3W A;  5F02 A;  2KWO A;  5EYA F;  3EB5 A;  4BHW A;  5B77 A;  2LAU A;  3U5N A;  4AXM A;  5I3L A;  2G6Q A;  2ECJ A;  4V3K C;  2KU3 A;  1NQC A;  5LCW B;  2YSJ A;  3F5V A;  1EWL A;  3N3G A;  3NHE A;  2OUL A;  3LQJ A;  3FEH A;  2AYN A;  1Z2Q A;  1DCQ A;  3O70 A;  4YAB A;  4ZDT A;  3LVQ E;  3CBJ A;  2DCC A;  2G8E A;  2P86 A;  5K16 A;  5SVX A;  3RNV A;  3HHA A;  2B1N A;  4OW0 A;  3H8C A;  2G43 A;  2K16 A;  1DKI A;  2DOS A;  4OVZ A;  2YHO A;  1U9X A;  2YJ8 A;  4CDF B;  1MDW A;  2FD4 A;  1KHP A;  1BQI A;  2YU4 A;  3ZPV 1;  1U6G B;  1NL6 A;  2NQG A;  3BBA A;  1PXV A;  3PHD A;  1X4J A;  1CJL A;  1AYW A;  4GB0 A;  2MA5 A;  2IBI A;  4QRG A;  5EZS A;  3K9M A;  4BOU A;  2ECI A;  3O33 A;  1XKG A;  2BDZ A;  3FL2 A;  3GCB A;  4QH6 A;  2MT5 A;  3O7A A;  3DPL R;  1F2B A;  1MIR A;  3E2D A;  3N9L A;  4PPE A;  3LQI A;  5H1U A;  3RVX A;  3QSD A;  4AYC B;  2ARY A;  2Y1N A;  5H1V A;  1EF7 A;  4M0W A;  2IPP B;  1QDQ A;  4N4F A;  3MTV A;  1CSB B;  1RMD A;  4MSX A;  2FYE A;  2R6N A;  5B8D A;  1WIM A;  5G04 B;  2F6J A;  2LXH C;  2YRE A;  2KWN A;  1U9V A;  3S3Q A;  2JUN A;  2E61 A;  5JH3 A;  3PBH A;  5KH3 A;  4X6H A;  4ZUX U;  2Y1M A;  2AGA A;  4A4C A;  2EGM A;  2C0Y A;  4XI1 A;  1ME4 A;  5TBN A;  4W4U A;  4YYQ A;  4XUI A;  1Y08 A;  2DZZ A;  3RPG C;  4MI7 A;  4PP1 A;  3PHW A;  2YUR A;  1YK7 A;  2R9O A;  4RY2 A;  5B76 A;  2RR4 A;  2VNF A;  1FH0 A;  3RTR B;  3ZYQ A;  1LDJ B;  2H7J A;  1DEU A;  2R9F A;  5CVO B;  3DDT A;  3BCN A;  3O37 A;  2UZG A;  4GUA A;  4WZ0 A;  2OZ2 A;  5SVI B;  1QOL A;  3HTK C;  3LJU X;  1WEP A;  2L5U A;  2VPB A;  5FB1 A;  1WEN A;  3FAO A;  1TL9 A;  3OVZ A;  1SNK A;  2BDL A;  4GNE A;  3SOW A;  3BPM A;  2PBH A;  2Y43 A;  1E4U A;  1YZB A;  1CTE A;  1PBH A;  4YAT A;  2GHU A;  4RF0 A;  2MA6 A;  1GEC E;  4FO9 A;  2Y6E A;  1X4U A;  1EWO A;  1T1H A;  4AUQ B;  3QT4 A;  4Q8H A;  1BP4 A;  2VP7 A;  1YK8 A;  3M62 A;  3KFQ A;  5K3Q A;  3USV A;  2R9N A;  2M85 A;  2CSV A;  3V6E A;  2YUC A;  4CCG X;  1HYJ A;  1TLO A;  4P16 A;  4XR7 A;  4I7D A;  3RVW A;  7PCK A;  3QZV A;  5KH9 A;  3D6S A;  3W31 A;  3JUE A;  1KFX L;  2G45 A;  2M6M A;  2YQL A;  1ZIV A;  4Q6F A;  4YBT A;  5H1T A;  1V87 A;  2L43 A;  3HD3 A;  2J7Q C;  4CZW A;  4RNA A;  4OEM A;  2F1G A;  3OVX A;  3U5M A;  4ZQL A;  1PPN A;  5B78 A;  2DZY A;  2VHS A;  3N9M A;  2H0D A;  3LVR E;  2AN6 A;  3KV5 A;  1WGM A;  2MD8 C;  4F52 B;  4NN2 A;  2R9C A;  5H9M A;  3KX1 A;  1YVB A;  2K1J A;  1YAL A;  4OEL A;  3M63 A;  3KWZ A;  1WEM A;  2CIO A;  1AYU A;  2VPG A;  5FEY A;  1FP0 A;  5JA7 A;  3L1X A;  2XU5 A;  3KKU A;  2EOD A;  3EB6 A;  2UZJ A;  9PAP A;  3OF8 A;  2FRQ A;  1O0E A;  3K8U A;  1KHQ A;  3I06 A;  4A0C D;  1IYM A;  3E1Z B;  5CVN B;  3FAN A;  3PUQ A;  4OGC A;  2E03 A;  4TKP B;  1X4I A;  2QIZ A;  3MP2 A;  3C9E A;  3BC3 A;  3T6R A;  2KYU A;  4DMY A;  3O65 A;  1THE A;  2Y5B A;  1WEE A;  4QBB A;  3MOR A;  1WIL A;  3MJ5 A;  4YYU A;  3FJU B;  3ZTG A;  2D8U A;  3B79 A;  5EGW A;  4I7B A;  2OP3 A;  2PUY A;  4PI3 A;  2DSM A;  2B0O E;  1Q6K A;  1TU6 A;  2AU1 A;  2LGL A;  2FUD A;  3KSE A;  4PAD A;  3ZNI A;  2ECN A;  4P5O B;  2KR4 A;  3Q1D A;  1JOC A;  2PNX A;  3IHP A;  2E6S A;  4YBM A;  2XU1 A;  1BGO A;  1AU3 A;  4N79 A;  2FUI A;  2LQ6 A;  3ZPV E;  2PAD A;  1XWH A;  1QXP A;  4A49 A;  3E9S A;  3H8B A;  3SOX A;  4ZTB A;  3HWN A;  2MUM A;  2LGK A;  5EF4 A;  4I7C A;  1N87 A;  2HXZ A;  1WEO A;  1AU2 A;  2P0R A;  2BTW B;  3V6C A;  5C13 A;  4YYV A;  1F2C A;  2OXQ C;  5G05 B;  5D1M B;  3V43 A;  1F29 A;  4I05 A;  1MHW A;  3HHI A;  4S3O B;  5TAB A;  4YC9 A;  2AUZ A;  2ECG A;  3H7D A;  4I04 A;  4PP2 E;  1PPO A;  2FUU A;  4RF1 A;  3DQV R;  4K7C A;  2P57 A;  1MM3 A;  3ZVZ B;  2L7P A;  3RVV A;  4BBQ A;  2G8J A;  2F6N A;  3I2D A;  2L80 A;  2YT5 A;  4P6E A;  4W5B A;  2ECT A;  4WZ2 A;  3N3K A;  4R7E A;  4WZ3 B;  1PE6 A;  2H0D B;  3PHU A;  4HXD B;  3CBK A;  4G54 A;  2F42 A;  3NG2 A;  4LLB A;  1U5I A;  2BU3 A;  1POP A;  2P7U A;  3MDB C;  4IC3 A;  4IP3 A;  3KNV A;  1CPJ A;  1A6R A;  2HD5 A;  2YHN A;  1YT7 A;  4D8B A;  1LDK C;  1STF E;  2HH5 A;  3RPG B;  2CKL A;  1VFY A;  1SP4 B;  2DCD A;  2DCA A;  3DWD A;  3ZNH A;  3FM8 C;  4P6G A;  1WE9 A;  3WXG A;  3F75 A;  5AIU A;  4QF2 A;  2G7Y A;  2D8S A;  4WA6 A;  4UP0 A;  3WXF A;  3OIS A;  3IEJ A;  1CV8 A;  5PAD A;  2GFO A;  3TRK A;  2LRI C;  1K3B B;  4Z0O A;  4R8P K;  4FJC A;  3ZUA A;  1GMY A;  5TDR A;  4UI9 B;  2FT2 A;  2G6D A;  3U5O A;  3O34 A;  4YYR A;  3BPF A;  3O1G A;  2FRA A;  1MM2 A;  3GV4 A;  4YAD A;  1PPP A;  1PPD A;  2BTW A;  1WEU A;  5CHT A;  2WBF X;  1Y4H A;  1AYV A;  3O0U A;  4MZO A;  4B7Y C;  5CVM A;  3H7H A;  2JRJ A;  2KWJ A;  3LDY A;  1CVZ A;  2VJE A;  4XZX A;  5LKU A;  3N9N A;  3ZVY A;  3VK6 A;  2EXU A;  1U9W A;  3N4C A;  3HCT A;  3H89 A;  1K2F A;  4BSQ A;  3P5W A;  3ASL A;  2ECW A;  3C5K A;  2E02 A;  4N4Z A;  1BOR A;  1G25 A;  3SUB A;  3U8E A;  4R2Y A;  1Z6U A;  4Z0R A;  2DJF B;  4GND A;  1HUC B;  2NQI A;  3MTN A;  1JM7 A;  4PT5 A;  4FIP A;  1NB3 A;  2IQJ A;  2VJF B;  5EZQ A;  3W30 A;  3LQH A;  3BY4 A;  2YJ9 A;  4W5C A;  6PAD A;  5B79 A;  4BOQ A;  1EWP A;  4YBS A;  2ATO A;  2DX8 A;  3BOW A;  1MS6 A;  4BS5 A;  2YVR A;  1WEQ A;  2AYO A;  3PSE A;  1F2A A;  3K24 A;  1ZCM A;  2MNZ A;  2JQF R;  4REZ A;  5A24 A;  5C11 A;  2HHN A;  2XEU A;  5LKZ A;  4YV8 A;  2DJA A;  4BOS A;  5SVY A;  3TMP A;  1UKF A;  2KKY A;  2CB5 A;  5E6J A;  2KWK A;  8PCH A;  1IWD A;  3MHH A;  2E01 A;  1CHC A;  2PRE A;  4HWY A;  3WXE A;  2CRW A;  4DMX A;  1VD4 A;  4CDE B;  1CQD A;  3O35 A;  5KO3 A;  3B21 A;  2CKL B;  2MKE A;  3MHS A;  1AEC A;  4LAD B;  3N9Q A;  1CB5 A;  5TDW A;  2MD7 B;  4X3G A;  1MBM A;  3ERV A;  3PLW A;  1MEG A;  2VHF A;  4AP4 A;  4LKA A;  2XU4 A;  2FO5 A;  2XOC A;  3HCU A;  4CA1 A;  3O47 A;  2QJ0 A;  2HDP A;  1U9Q X;  4BPV A;  2YQM A;  2K17 A;  2JTC A;  2C2V S;  2CSY A;  3L11 A;  3M7K A;  4GNF A;  5B75 A;  2JMI A;  3LFY A;  2J7Q A;  2JM3 A;  4QF3 A;  5JG6 A;  1GLO A;  3DF0 A;  2JRI A;  4YAX A;  3PT2 A;  4AXL A;  4L7X A;  4BS6 A;  2VJF A;  4I07 A;  2PNS A;  2DJG B;  1VSN A;  2ZET C;  1CS8 A;  5CHV A;  5AIT A;  3SHB A;  2BAY A;  1DVP A;  5D1K B;  1EWM A;  2O6X A;  2JMJ A;  3PHX A;  2IDA A;  4RKX A;  4QRV A;  4WUR A;  2KIZ A;  2VJE B;  2B1M A;  2QIC A;  3P5X A;  3AI8 A;  4YYS A;  1MEM A;  3O36 A;  3PW3 A;  3T7L A;  5D1L B;  3C0R A;  4BOZ A;  1VYX A;  4MM3 B;  2E6R A;  3PRM A;  1AIM A;  3IFU A;  1S4V A;  1KXR A;  1NB5 A;  2NQA A;  2HWK A;  4PTB A;  2CRR A;  1ZBD B;  2YJC A;  2MIQ A;  2HYE D;  1M6D A;  2YJB A;  2JQG R;  4IUM A;  2LDR A;  1GCB A;  1ICF A;  2RI7 A;  1AU4 A;  1JM7 B;  1KFU L;  1WEW A;  5J3X A;  2DC7 A;  3BWK A;  2R9M A;  2LXP C;  3M99 A;  2VPD A;  4LK9 A;  4S3O C;  4BQV A;  2YW8 A;  1NPZ A;  4UP5 A;  4A5U A;  1WEV A;  2CSZ A;  2LGG A;  4QRX A;  4KLB A;  2DC9 A;  1AU0 A;  3LRQ A;  3KQI A;  1QMY A;  2KE1 A;  2FFW A;  3HCS A;  2Z84 A;  2NQD B;  2EGP A;  1ATK A;  4Q8G A;  2RSD A;  5LKX A;  2FE8 A;  2C2L A;  1VJV A;  4X6J A;  3KV6 A;  3KWB X;  5FB0 A;  5TRB A;  4BOP A;  1FBV A;  3OQC A;  2ECV A;  2LGV A;  4B86 C;  3KW9 A;  2KKX A;  2DC8 A;  2XP0 A;  5DIN A;  4L58 A;  2JMD A;  2KFT A;  2F7D A;  2VPE A;  2YSM A;  2FQ9 A;  1BY8 A;  2MNY A;  4H9D A;  1ITO A;  3QJ3 A;  5JZE A;  2XB1 A;  2M1R A;  3LXS A;  2LV9 A;  4O62 A;  2YJ2 A;  3CH2 X;  3N9P A;  3C6W A;  2AVW A;  3CH3 X;  2YYR A;  3KDE C;  2LN0 A;  2AUX A;  3T9K A;  2XU3 A;  3IMA A;  4D8E A;  3L1Z B;  4MZS A;  4V3L C;  1PCI A;  4MVT A;  2KRE A;  4LJN A;  2M13 A;  4D8I A;  4O64 A;  5G0F A;  4C9Z A;  1PVJ A;  2ACT A;  2KGG A;  4AYC A;  4OGE A;  3H6S A;  5FER A;  3PNR A;  4FK5 A;  1PIP A;  3IUT A;  5KH7 A;  3TNX A;  3GL6 A;  1ME3 A;  2CON A;  2NAA A;  3BB7 A;  2DC6 A;  1F62 A;  4X6I A;  4YYW A;  4GNG A;  4OVZ B;  4IC2 A;  2OWA A;  4R3D A;  1X9Y A;  4A4B A;  4YVA A;  4N8W A;  2I50 A;  2FTD A;  4CDC B;  2M3H A;  3P5U A;  1Z60 A; 
#chains in the Genus database with same CATH homology
 3IV2 A;  2KGI A;  1PAD A;  1JQP A;  2L0B A;  3PUR A;  2AS8 A;  3S3R A;  5LKT A;  5J94 A;  1NLJ A;  1WES A;  2EA6 A;  5FPW A;  4CDD B;  2L75 A;  3U5P A;  3PDF A;  2FSA A;  3P5V A;  1E2T A;  2CT2 A;  1WFK A;  3IOQ A;  5DKA A;  2AIM A;  2DCB A;  2E00 A;  4AVX A;  3N9O A;  3SOU A;  3I3T A;  3OF9 A;  1DF0 A;  2K4D A;  1HYI A;  4N3W A;  5F02 A;  2KWO A;  5EYA F;  3EB5 A;  4BHW A;  5B77 A;  3U5N A;  4AXM A;  5I3L A;  2G6Q A;  2ECJ A;  4V3K C;  2KU3 A;  1NQC A;  5LCW B;  2YSJ A;  3F5V A;  1EWL A;  3N3G A;  3NHE A;  2OUL A;  3LQJ A;  2AYN A;  1Z2Q A;  3O70 A;  4YAB A;  4ZDT A;  3CBJ A;  2DCC A;  2G8E A;  2P86 A;  5K16 A;  3HHA A;  2B1N A;  3H8C A;  2G43 A;  2K16 A;  2YHO A;  1U9X A;  2YJ8 A;  4CDF B;  1MDW A;  1KHP A;  1BQI A;  2YU4 A;  3ZPV 1;  1U6G B;  1NL6 A;  2NQG A;  1PXV A;  3PHD A;  1X4J A;  1CJL A;  1AYW A;  4GB0 A;  2MA5 A;  2IBI A;  4QRG A;  3K9M A;  2ECI A;  3O33 A;  1XKG A;  2BDZ A;  3FL2 A;  3GCB A;  4QH6 A;  2MT5 A;  3O7A A;  3DPL R;  1F2B A;  1MIR A;  3N9L A;  4PPE A;  3LQI A;  5H1U A;  3RVX A;  3QSD A;  4AYC B;  2ARY A;  2Y1N A;  5H1V A;  1EF7 A;  2IPP B;  1QDQ A;  4N4F A;  1CSB B;  1RMD A;  4MSX A;  2FYE A;  2R6N A;  5B8D A;  1WIM A;  5G04 B;  2F6J A;  2LXH C;  2YRE A;  2KWN A;  1U9V A;  3S3Q A;  5JH3 A;  3PBH A;  5KH3 A;  4X6H A;  4ZUX U;  2Y1M A;  4A4C A;  2C0Y A;  4XI1 A;  1ME4 A;  5TBN A;  4W4U A;  4YYQ A;  4XUI A;  1Y08 A;  2DZZ A;  3RPG C;  4PP1 A;  4RY2 A;  2YUR A;  1YK7 A;  2R9O A;  5B76 A;  2VNF A;  1FH0 A;  3RTR B;  3ZYQ A;  4B55 A;  4BGF A;  1LDJ B;  2H7J A;  1DEU A;  2R9F A;  5CVO B;  3BCN A;  3O37 A;  2UZG A;  4WZ0 A;  2OZ2 A;  1QOL A;  3HTK C;  1WEP A;  2L5U A;  2VPB A;  5FB1 A;  1WEN A;  1TL9 A;  3OVZ A;  1SNK A;  2BDL A;  4GNE A;  3SOW A;  2BSZ A;  3BPM A;  2PBH A;  2Y43 A;  1E4U A;  1CTE A;  1PBH A;  4YAT A;  2GHU A;  2MA6 A;  1GEC E;  4FO9 A;  2Y6E A;  1X4U A;  1EWO A;  1T1H A;  4AUQ B;  3QT4 A;  4Q8H A;  1BP4 A;  2VP7 A;  1YK8 A;  3M62 A;  3KFQ A;  3USV A;  2R9N A;  2M85 A;  3V6E A;  2YUC A;  4CCG X;  1HYJ A;  1TLO A;  4XR7 A;  4I7D A;  3RVW A;  7PCK A;  3QZV A;  5KH9 A;  3D6S A;  1KFX L;  2G45 A;  2M6M A;  2YQL A;  1ZIV A;  4Q6F A;  4YBT A;  5H1T A;  1V87 A;  2L43 A;  3HD3 A;  4CZW A;  4OEM A;  2F1G A;  3OVX A;  3U5M A;  4ZQL A;  1PPN A;  5B78 A;  2DZY A;  2VHS A;  3N9M A;  2H0D A;  2AN6 A;  3KV5 A;  1WGM A;  2MD8 C;  4F52 B;  4NN2 A;  2R9C A;  5H9M A;  3KX1 A;  1YVB A;  2K1J A;  1YAL A;  4OEL A;  3M63 A;  3LTW A;  3KWZ A;  1WEM A;  2CIO A;  1AYU A;  2VPG A;  5FEY A;  1FP0 A;  5JA7 A;  3L1X A;  2XU5 A;  3KKU A;  2EOD A;  3EB6 A;  9PAP A;  3OF8 A;  2FRQ A;  1O0E A;  3K8U A;  1KHQ A;  3I06 A;  4A0C D;  1IYM A;  3E1Z B;  1W6F A;  5CVN B;  3PUQ A;  2E03 A;  4TKP B;  1X4I A;  2QIZ A;  2VFB A;  3C9E A;  3BC3 A;  3T6R A;  2KYU A;  4DMY A;  1THE A;  2Y5B A;  1WEE A;  4QBB A;  3MOR A;  1WIL A;  4YYU A;  3ZTG A;  3B79 A;  5EGW A;  4I7B A;  2OP3 A;  2PUY A;  4PI3 A;  1Q6K A;  1TU6 A;  2AU1 A;  2LGL A;  2FUD A;  3KSE A;  4PAD A;  3ZNI A;  2ECN A;  4P5O B;  2KR4 A;  4YBM A;  1JOC A;  2PNX A;  3IHP A;  2E6S A;  2XU1 A;  1BGO A;  1AU3 A;  4N79 A;  2FUI A;  2LQ6 A;  3ZPV E;  2PAD A;  1XWH A;  1QXP A;  4A49 A;  3H8B A;  3SOX A;  3HWN A;  2MUM A;  2LGK A;  5EF4 A;  4I7C A;  4NV7 A;  1N87 A;  2HXZ A;  1WEO A;  1AU2 A;  2P0R A;  3V6C A;  5C13 A;  4YYV A;  1F2C A;  2OXQ C;  5G05 B;  5D1M B;  3V43 A;  1F29 A;  4I05 A;  1MHW A;  3HHI A;  4S3O B;  5TAB A;  4YC9 A;  2AUZ A;  2ECG A;  3H7D A;  4I04 A;  4PP2 E;  1PPO A;  2FUU A;  3DQV R;  4K7C A;  1MM3 A;  3ZVZ B;  3RVV A;  4BBQ A;  2G8J A;  2F6N A;  3I2D A;  2L80 A;  2YT5 A;  4P6E A;  4W5B A;  2ECT A;  4WZ2 A;  3N3K A;  4R7E A;  4WZ3 B;  1PE6 A;  2H0D B;  3CBK A;  4G54 A;  2F42 A;  3NG2 A;  4LLB A;  1U5I A;  2P7U A;  1POP A;  4IC3 A;  3KNV A;  1CPJ A;  1A6R A;  2HD5 A;  2YHN A;  1YT7 A;  1LDK C;  1STF E;  2HH5 A;  3RPG B;  2CKL A;  1VFY A;  1SP4 B;  2DCD A;  2DCA A;  4P6G A;  1WE9 A;  3WXG A;  3F75 A;  5AIU A;  4QF2 A;  2G7Y A;  2D8S A;  4WA6 A;  4UP0 A;  3WXF A;  1GX3 A;  3IEJ A;  1CV8 A;  3OIS A;  2GFO A;  5PAD A;  2LRI C;  1K3B B;  4R8P K;  4FJC A;  3ZUA A;  1GMY A;  5TDR A;  4UI9 B;  2FT2 A;  2G6D A;  3U5O A;  3O34 A;  4YYR A;  3BPF A;  3O1G A;  2FRA A;  1MM2 A;  3GV4 A;  4YAD A;  1PPP A;  1PPD A;  5CHT A;  1WEU A;  2WBF X;  1Y4H A;  1AYV A;  3O0U A;  4MZO A;  4B7Y C;  5CVM A;  2JRJ A;  2KWJ A;  1CVZ A;  2VJE A;  5LKU A;  3N9N A;  3ZVY A;  3VK6 A;  1U9W A;  3N4C A;  3HCT A;  3H89 A;  1K2F A;  4BSQ A;  3P5W A;  3ASL A;  2ECW A;  3C5K A;  2E02 A;  4N4Z A;  4C5P A;  1BOR A;  1G25 A;  3U8E A;  4R2Y A;  1Z6U A;  2DJF B;  4GND A;  1HUC B;  2NQI A;  3MTN A;  1JM7 A;  4FIP A;  1NB3 A;  2VJF B;  3LQH A;  2YJ9 A;  4W5C A;  6PAD A;  5B79 A;  4NV8 A;  1EWP A;  4YBS A;  2ATO A;  2DX8 A;  3BOW A;  1MS6 A;  4BS5 A;  1WEQ A;  2AYO A;  1F2A A;  3K24 A;  1ZCM A;  2MNZ A;  2JQF R;  5A24 A;  5C11 A;  2HHN A;  2XEU A;  5LKZ A;  4YV8 A;  2CB5 A;  2KWK A;  8PCH A;  1IWD A;  3MHH A;  2E01 A;  1CHC A;  2PRE A;  4HWY A;  3WXE A;  4DMX A;  1VD4 A;  4CDE B;  1CQD A;  3O35 A;  2CKL B;  3MHS A;  1AEC A;  4LAD B;  3N9Q A;  1CB5 A;  5TDW A;  2MD7 B;  4X3G A;  3ERV A;  1MEG A;  2VHF A;  4AP4 A;  4LKA A;  2XU4 A;  2FO5 A;  3HCU A;  4CA1 A;  2QJ0 A;  2HDP A;  1U9Q X;  4BPV A;  2YQM A;  2K17 A;  2C2V S;  2CSY A;  3L11 A;  1W5R A;  4GNF A;  5B75 A;  2JMI A;  3LFY A;  4QF3 A;  5JG6 A;  1GLO A;  3DF0 A;  4AXL A;  4YAX A;  4L7X A;  4BS6 A;  2VJF A;  4I07 A;  2PNS A;  2DJG B;  1VSN A;  4GUZ A;  2ZET C;  1CS8 A;  5CHV A;  5AIT A;  3SHB A;  2BAY A;  1DVP A;  5D1K B;  1EWM A;  2O6X A;  2JMJ A;  2IDA A;  4QRV A;  2KIZ A;  2VJE B;  2B1M A;  2QIC A;  3P5X A;  3AI8 A;  1MEM A;  3O36 A;  3PW3 A;  3T7L A;  5D1L B;  1VYX A;  2E6R A;  1AIM A;  1S4V A;  1KXR A;  1NB5 A;  2NQA A;  4PTB A;  1ZBD B;  2YJC A;  2MIQ A;  2HYE D;  1M6D A;  2YJB A;  2JQG R;  4YYS A;  2LDR A;  1GCB A;  1ICF A;  2RI7 A;  1AU4 A;  2VFC A;  1JM7 B;  1KFU L;  1WEW A;  5J3X A;  2DC7 A;  3BWK A;  2R9M A;  2LXP C;  3M99 A;  2VPD A;  4LK9 A;  4S3O C;  4BQV A;  2YW8 A;  1NPZ A;  4UP5 A;  1WEV A;  2CSZ A;  2LGG A;  4QRX A;  4KLB A;  2DC9 A;  1AU0 A;  3LRQ A;  3KQI A;  1QMY A;  2KE1 A;  3HCS A;  2NQD B;  2EGP A;  1ATK A;  4Q8G A;  2RSD A;  5LKX A;  2C2L A;  1VJV A;  4X6J A;  3KV6 A;  3KWB X;  5FB0 A;  5TRB A;  1FBV A;  2ECV A;  2LGV A;  4B86 C;  3KW9 A;  2DC8 A;  5DIN A;  4L58 A;  2JMD A;  2KFT A;  2F7D A;  2VPE A;  2YSM A;  2FQ9 A;  1BY8 A;  2MNY A;  1ITO A;  3QJ3 A;  2XB1 A;  2M1R A;  3LXS A;  2LV9 A;  2YJ2 A;  3CH2 X;  3N9P A;  3C6W A;  2AVW A;  3CH3 X;  2YYR A;  2LN0 A;  2AUX A;  2XU3 A;  3IMA A;  3L1Z B;  4MZS A;  4V3L C;  1PCI A;  4MVT A;  2KRE A;  4LJN A;  4O64 A;  5G0F A;  4C9Z A;  2ACT A;  2KGG A;  4AYC A;  3PNR A;  3H6S A;  5FER A;  4FK5 A;  1PIP A;  3IUT A;  5KH7 A;  3TNX A;  3GL6 A;  1ME3 A;  2NAA A;  3D9W A;  2DC6 A;  1W4T A;  1F62 A;  4X6I A;  4YYW A;  4GNG A;  4IC2 A;  1X9Y A;  4A4B A;  4YVA A;  4N8W A;  2I50 A;  2FTD A;  4CDC B;  2M3H A;  3P5U A;  1Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...