4FJCA

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
472
structure length
447
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 126
structure length 447
sequence length 472
chains with identical sequence E
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fjcA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fjcA02
2FT2A 2B1MA 1PPOA 3GCBA 4QRXA 2FUDA 4YC9A 3KKUA 3E1ZB 2H0DB 3QJ3A 2AYNA 1BORA 2RSDA 2G6DA 4X6HA 3N9LA 4YYQA 3OVZA 4MZOA 2ECGA 3LRQA 2GFOA 2ECTA 4K7CA 2Y1NA 2MD8C 4W5CA 2VPBA 1PXVA 2MUMA 2LXHC 2E00A 1Q6KA 1WEPA 3N9QA 4PP1A 2MT5A 4V3KC 4L58A 3T6RA 4PP2E 2VPDA 1MS6A 4F52B 3HCTA 5EF4A 2G43A 2DCDA 1WEOA 1SP4B 5G05B 5CVNB 4AP4A 3N9OA 3PURA 5B79A 2C0YA 4AYCB 2KFTA 5I3LA 3AI8A 4CDDB 2ATOA 4Q6FA 5K16A 2FTDA 1WEQA 3C5KA 2R9NA 1PIPA 2F6JA 2Y5BA 2DX8A 2VJFA 1G25A 5A24A 4DMYA 3K9MA 3ASLA 2K17A 1VD4A 3MTNA 1FH0A 4WZ2A 5C11A 4YATA 1O0EA 2R6NA 4YABA 2JQFR 1NLJA 3BCNA 2YSJA 2YURA 3ZPV1 1VJVA 2FRQA 1NB5A 3RVVA 4OEMA 3M99A 4ZQLA 3RPGC 2G6QA 4LLBA 1NB3A 3RVWA 2O6XA 3KV5A 1X9YA 5H1UA 3BPMA 1PPDA 2XU5A 3F5VA 2Y1MA 4QF3A 1KFUL 3O0UA 3FL2A 2NQGA 1LDKC 2MIQA 1N87A 1BP4A 2CB5A 2VJFB 5KH7A 5FERA 3IMAA 1WEVA 3C9EA 2G8JA 4WZ0A 2LXPC 4IC2A 1KXRA 2GHUA 2PNSA 4HWYA 2IPPB 3I06A 4CDEB 2HHNA 2YUCA 2LRIC 1CS8A 4CDCB 3LQJA 5B76A 5DINA 1FP0A 2YYRA 1Z60A 2MD7B 1JQPA 1MM2A 4I07A 3IEJA 3H7DA 1VFYA 4BHWA 2R9FA 2VNFA 3T7LA 1X4UA 1WILA 5EGWA 4O64A 1EWLA 1BGOA 3U5MA 2OZ2A 3SOUA 1U9QX 5FB0A 5F02A 2YU4A 3MHHA 2NAAA 2L5UA 4S3OB 1F2AA 1GMYA 3HCUA 1Y4HA 1TLOA 2P7UA 2BAYA 4MSXA 4R8PK 4FK5A 1ZBDB 4YBSA 1T1HA 2MNZA 2AS8A 2CIOA 2E01A 3IUTA 1AU3A 3NG2A 1EWMA 3QT4A 4AYCA 4I05A 5TDWA 3EB5A 2EGPA 3LQHA 1ME4A 2L43A 2E03A 4BBQA 3EB6A 3CBJA 2KIZA 4BS5A 3CH3X 1JOCA 4Q8HA 5G04B 1LDJB 2G45A 1A6RA 2BDZA 1WEUA 4YADA 2XEUA 1K2FA 1EF7A 3N3KA 2YSMA 1EWOA 3DF0A 4BSQA 2YHNA 2C2VS 2ZETC 1BY8A 2P86A 1BQIA 3KQIA 1WEEA 3KV6A 3H8CA 3L11A 3DPLR 2KWKA 3KWZA 2LGGA 4AXMA 5C13A 4P6GA 3U5PA 5LKUA 4WA6A 1U9XA 2LQ6A 2K16A 3BWKA 2YHOA 4AVXA 2VJEA 2DCCA 1X4IA 3V6CA 1WEMA 4QH6A 3O33A 1X4JA 2LN0A 4YBMA 2C2LA 3IV2A 1STFE 1WGMA 4N3WA 3PHDA 4LK9A 2YJBA 5JG6A 3ERVA 4LJNA 1QMYA 4X3GA 3P5VA 5LKZA 3CH2X 1ZCMA 3CBKA 4R7EA 4GB0A 1AU2A 4P5OB 2B1NA 2Y6EA 3H6SA 2CSYA 9PAPA 3F75A 2AUZA 2PADA 3PBHA 2DC9A 1AYWA 3SOXA 3ZTGA 3PDFA 4YBTA 4YAXA 1JM7A 3HHIA 3SOWA 1TL9A 2ECIA 4A4CA 2L75A 3ZPVE 5KH9A 1GECE 3ZYQA 1GLOA 4CA1A 5CVOB 3ZVYA 2PNXA 1WESA 1XWHA 1AYUA 5CVMA 2KE1A 3P5XA 2VJEB 2OULA 2KREA 4X6JA 3I3TA 2H7JA 3KSEA 1F2CA 5TRBA 2YJ2A 2LGKA 3O37A 1IWDA 2AUXA 2FYEA 2VHFA 4YYRA 2LGLA 1CTEA 1CVZA 3OISA 2MA5A 2CKLA 4FIPA 3MHSA 5JA7A 1DF0A 1U6GB 3KWBX 1AU4A 1WIMA 2FUUA 2XU4A 2ARYA 2L0BA 4GNDA 1HYIA 2LGVA 2ECJA 5TABA 2M1RA 5B75A 1WEWA 1ZIVA 3BC3A 1DVPA 2PUYA 6PADA 2EODA 3O35A 2FRAA 3GV4A 1JM7B 1U5IA 2YREA 1AECA 5FEYA 4UI9B 1HUCB 3PUQA 4DMXA 4B7YC 5B77A 1ICFA 2DC8A 1MHWA 2JMJA 1SNKA 2LV9A 2E6SA 4I7DA 2ECNA 1CB5A 3KFQA 4QRGA 2XU1A 3WXEA 2KWJA 4YV8A 4BQVA 1WE9A 2JQGR 3HWNA 2OP3A 3N4CA 5CHTA 4V3LC 2YJCA 4PI3A 2HD5A 1ATKA 2R9MA 2KYUA 2CKLB 3HCSA 4NN2A 4W4UA 1K3BB 5AITA 4N8WA 2DC7A 4W5BA 1F2BA 2R9OA 4BPVA 1YK7A 2AN6A 2DCBA 1MEMA 3OF9A 5D1MB 4B86C 2XB1A 2M6MA 3K8UA 2JRJA 1CPJA 4N4FA 1PPNA 1U9WA 4G54A 1EWPA 2JMDA 3M62A 2M85A 3O7AA 4A0CD 3LXSA 4P6EA 2KU3A 1CSBB 2NQIA 1THEA 3N9NA 5FB1A 2VPEA 4I7CA 4AUQB 1PPPA 2G8EA 3N3GA 3N9PA 3PNRA 4FJCA 4PTBA 2DJFB 3KNVA 3D6SA 2EA6A 2VHSA 3ZVZB 1KHQA 2ACTA 4TKPB 2NQDB 1ME3A 3OVXA 1YALA 1KFXL 2D8SA 3H8BA 3RTRB 4GNGA 5J3XA 1CV8A 2KGIA 2DC6A 3P5WA 3QZVA 4RY2A 2KWOA 2ECVA 1F62A 1AYVA 2HYED 1WENA 4LADB 5DKAA 1MDWA 1NL6A 1CQDA 1CJLA 2BDLA 2ECWA 3M63A 2NQAA 3USVA 2PREA 3IOQA 4YYWA 5TBNA 5D1KB 4A4BA 4R2YA 4A49A 1AU0A 3HHAA 1S4VA 3TNXA 4XUIA 3H89A 2CT2A 3LFYA 2K4DA 7PCKA 1M6DA 3V43A 3S3QA 4MVTA 1ITOA 1PADA 2G7YA 2P0RA 1PE6A 4AXLA 1CHCA 2HH5A 4UP5A 4S3OC 3L1ZB 1NPZA 5LCWB 1VYXA 3C6WA 3DQVR 2DJGB 8PCHA 2OXQC 4LKAA 5D1LB 3SHBA 2YQLA 2E6RA 2YQMA 1PBHA 2YT5A 2DZYA 3VK6A 3BPFA 2UZGA 1Z2QA 1MM3A 3BOWA 4C9ZA 2F42A 4L7XA 1YK8A 2DZZA 1PCIA 1QOLA 3B79A 3P5UA 1F29A 4QF2A 3L1XA 5H9MA 3U5NA 2AYOA 4GNFA 2LDRA 4ZDTA 1XKGA 2DCAA 1WFKA 2RI7A 2FQ9A 2I50A 1RMDA 2YJ8A 5LKTA 5B8DA 3O70A 5H1VA 1Z6UA 1GCBA 1E4UA 1TU6A 3IHPA 3ZUAA 2IBIA 3U5OA 4WZ3B 1QDQA 2VP7A 3ZNIA 1AIMA 2AVWA 3QSDA 2F7DA 5CHVA 5J94A 4PPEA 5KH3A 2KGGA 4Q8GA 2QJ0A 1MEGA 1V87A 3HTKC 2AU1A 5G0FA 1VSNA 1MIRA 4QBBA 1HYJA 5TDRA 4X6IA 5H1TA 3NHEA 3WXFA 2KR4A 4MZSA 4CDFB 2F6NA 3KW9A 4OELA 2E02A 4PADA 2FSAA 1Y08A 2QICA 2M3HA 5AIUA 5PADA 3K24A 5LKXA 2WBFX 1U9VA 2L80A 1YVBA 4N4ZA 3PW3A 3LQIA 2F1GA 3O1GA 3GL6A 1YT7A 4I7BA 2Y43A 4I04A 1IYMA 2H0DA 4YYSA 2CSZA 2QIZA 4QRVA 4GNEA 3RVXA 4CCGX 2YW8A 4ZUXU 3OF8A 1NQCA 1QXPA 2R9CA 2MA6A 3KX1A 5FPWA 3V6EA 3MORA 4YVAA 4YYUA 5B78A 3HD3A 2YJ9A 2IDAA 3O36A 1POPA 4BS6A 2MNYA 3O34A 2K1JA 4IC3A 2XU3A 4YYVA 5JH3A 3I2DA 1FBVA 3N9MA 4XI1A 5EYAF 2FUIA 3U8EA 4FO9A 2FO5A 2PBHA 3WXGA 4XR7A 1KHPA 2JMIA 3RPGB 2AIMA 2HXZA 4N79A 3S3RA 4UP0A 4CZWA 1DEUA 2VPGA 4KLBA 2HDPA 2KWNA
chains in the Genus database with same CATH superfamily
2FT2A 2B1MA 1PPOA 3GCBA 4BOUA 4QRXA 3RNVA 2FUDA 4YC9A 3KKUA 3E1ZB 2H0DB 3QJ3A 2AYNA 1BORA 2RSDA 2G6DA 4X6HA 2CRRA 3N9LA 3DWDA 3OVZA 4YYQA 4MZOA 2ECGA 3LRQA 2GFOA 2ECTA 4A5UA 4BOQA 3PRMA 4IUMA 4K7CA 4REZA 2Y1NA 2MD8C 4W5CA 2VPBA 1PXVA 2MUMA 2LXHC 2E00A 1Q6KA 1WEPA 3N9QA 3ZNHA 4PP1A 2MT5A 4V3KC 2LAUA 4L58A 3T6RA 4PP2E 5EZQA 2VPDA 1MS6A 4F52B 3HCTA 5EF4A 3FJUB 2G43A 2DCDA 1WEOA 1SP4B 5G05B 5CVNB 4AP4A 3N9OA 4OVZA 3PURA 5B79A 2C0YA 3W31A 4AYCB 2KFTA 5I3LA 3AI8A 4OW0A 4CDDB 2ATOA 4Q6FA 5K16A 2FTDA 1WEQA 3C5KA 3JUEA 2R9NA 1PIPA 2F6JA 2Y5BA 2DX8A 2VJFA 1G25A 5A24A 2E61A 4DMYA 3K9MA 3ASLA 2K17A 1VD4A 3MTNA 3FM8C 1FH0A 4WZ2A 5C11A 4YATA 1O0EA 2R6NA 5K3QA 4HXDB 2EGMA 4YABA 2JQFR 1NLJA 4R3DA 3BCNA 2YSJA 1MBMA 2YURA 3ZPV1 1VJVA 2FRQA 1NB5A 3RVVA 4OEMA 3M99A 3IFUA 4ZQLA 4Z0RA 3T9KA 3RPGC 2IQJA 2G6QA 4LLBA 1NB3A 3RVWA 2O6XA 3KV5A 1X9YA 5H1UA 4OVZB 3BPMA 1PPDA 2XU5A 3F5VA 2Y1MA 3PHWA 4M0WA 4QF3A 1KFUL 3O0UA 2UZJA 3FL2A 2NQGA 1LDKC 2MIQA 1N87A 1DCQA 1BP4A 2CB5A 2VJFB 5KH7A 5FERA 3IMAA 3MJ5A 1WEVA 3C9EA 2JRIA 2G8JA 4WZ0A 3FANA 2LXPC 4IC2A 1KXRA 2GHUA 2PNSA 4HWYA 2P57A 2CONA 2IPPB 3I06A 4CDEB 2HHNA 2FFWA 4RF0A 2YUCA 2LRIC 1CS8A 4CDCB 3LQJA 5B76A 2DOSA 5DINA 1FP0A 2YYRA 1Z60A 2MD7B 1JQPA 1MM2A 4I07A 3IEJA 3H7DA 1VFYA 4BHWA 2R9FA 2VNFA 3T7LA 1X4UA 2XOYA 1WILA 5EGWA 4O64A 1EWLA 4BOSA 2D8UA 1BGOA 3U5MA 2OZ2A 3SOUA 1U9QX 5FB0A 5F02A 2YU4A 3MHHA 2NAAA 2L5UA 4S3OB 4RF1A 1F2AA 1GMYA 3HCUA 1Y4HA 1TLOA 2P7UA 2BAYA 4MSXA 3TRKA 2XOZA 4R8PK 3LDYA 4FK5A 1ZBDB 4YBSA 1T1HA 2MNZA 2AS8A 2CIOA 2E01A 3IUTA 1AU3A 3NG2A 1EWMA 3QT4A 4AYCA 4I05A 4D8BA 5TDWA 3EB5A 2EGPA 3LQHA 1ME4A 2L43A 3BB7A 2E03A 4BBQA 3EB6A 3CBJA 2KIZA 4MI7A 4BS5A 2FE8A 1JOCA 3CH3X 5G04B 4RKXA 4Q8HA 1LDJB 2G45A 1A6RA 2BDZA 1WEUA 4YADA 2XEUA 1K2FA 1EF7A 3N3KA 2YSMA 1EWOA 4BOPA 3DF0A 4BSQA 3H7HA 2XP0A 2C2VS 2YHNA 2ZETC 1BY8A 1BQIA 3KQIA 2P86A 3B21A 1WEEA 3KV6A 4O62A 3H8CA 2BU3A 3TMPA 3L11A 3DPLR 2KWKA 3KWZA 2JM3A 2LGGA 4AXMA 5C13A 4P6GA 3U5PA 5LKUA 3LVQE 4WA6A 1U9XA 2LQ6A 2K16A 3BWKA 2YHOA 4AVXA 2VJEA 3O65A 2DCCA 1X4IA 3V6CA 1WEMA 4QH6A 3O33A 3M7KA 1X4JA 3MDBC 2LN0A 4YBMA 2C2LA 3IV2A 1STFE 5SVIA 1WGMA 3LVRE 4N3WA 3PHDA 4LK9A 2YJBA 5JG6A 3ERVA 4LJNA 1QMYA 4X3GA 3P5VA 5LKZA 3CH2X 2VPGA 4Z0OA 1ZCMA 3CBKA 4R7EA 4GB0A 1AU2A 4P5OB 2B1NA 2Y6EA 3H6SA 4BOZA 2CSYA 9PAPA 3F75A 2AUZA 2PADA 3PBHA 2DC9A 1AYWA 3SOXA 3ZTGA 3PDFA 4YBTA 4YAXA 1JM7A 3HHIA 3SOWA 2Z84A 3PRPA 1TL9A 2ECIA 2KKYA 4A4CA 2L75A 3ZPVE 5KH9A 1GECE 3ZYQA 1GLOA 4CA1A 5CVOB 3ZVYA 4P16A 3MP2A 2PNXA 1WESA 1XWHA 1AYUA 3DDTA 5CVMA 2KE1A 4ZTBA 3P5XA 2VJEB 2OULA 2KREA 2EXUA 4X6JA 3I3TA 3PHUA 2H7JA 3KSEA 5SVIB 1F2CA 5TRBA 4GUAA 2YJ2A 2LGKA 3O37A 1IWDA 2AUXA 2FYEA 2VHFA 4YYRA 2LGLA 1CTEA 1CVZA 3OISA 4MM3B 2MA5A 2CKLA 2DJAA 4FIPA 3MHSA 5JA7A 1DF0A 1U6GB 3KWBX 1AU4A 1WIMA 2FUUA 2XU4A 2ARYA 3KDEC 2L0BA 2MKEA 4GNDA 1HYIA 2LGVA 1DKIA 2ECJA 5TABA 2M1RA 5B75A 1WEWA 1ZIVA 3BC3A 1DVPA 2PUYA 6PADA 2EODA 3O35A 2FRAA 3GV4A 1JM7B 1U5IA 2YREA 1AECA 5FEYA 4UI9B 1HUCB 3BBAA 3PUQA 2DSMA 2RR4A 4DMXA 4B7YC 5B77A 1ICFA 3PSEA 2DC8A 1MHWA 2JMJA 1SNKA 2LV9A 4QQ4A 2E6SA 4I7DA 2ECNA 1CB5A 3KFQA 4QRGA 2XU1A 4PT5A 3WXEA 2KWJA 4YV8A 4BQVA 1WE9A 4IP3A 3C0RA 2JQGR 2AGAA 3HWNA 2OP3A 3N4CA 5CHTA 4V3LC 2YJCA 4PI3A 2HD5A 1ATKA 2R9MA 2KYUA 2CKLB 3HCSA 4D8IA 4NN2A 4W4UA 1K3BB 5AITA 2J7QA 4N8WA 2DC7A 4W5BA 4OGEA 1F2BA 2R9OA 4BPVA 1YK7A 2AN6A 2DCBA 1MEMA 3OF9A 5D1MB 4B86C 2KKXA 2XB1A 2M6MA 3K8UA 2JRJA 1CPJA 4N4FA 1PPNA 1U9WA 4G54A 1EWPA 2JMDA 3M62A 2M85A 3O7AA 3FAOA 4A0CD 3LXSA 3OQCA 4P6EA 2KU3A 1CSBB 2NQIA 1THEA 3N9NA 5FB1A 2VPEA 4I7CA 4AUQB 1PPPA 2G8EA 3N3GA 4H9DA 3N9PA 3PNRA 3E2DA 4FJCA 4PTBA 2DJFB 3KNVA 3D6SA 2EA6A 2VHSA 3ZVZB 1KHQA 2ACTA 4TKPB 2NQDB 1ME3A 3OVXA 1YALA 4D8EA 1KFXL 2D8SA 3H8BA 3RTRB 4GNGA 5J3XA 3E9SA 1CV8A 2KGIA 2DC6A 3P5WA 3QZVA 1PVJA 4RY2A 2KWOA 2ECVA 1F62A 1AYVA 2HYED 1WENA 3LJUX 4RNAA 4LADB 5DKAA 1MDWA 1NL6A 3PHXA 1CQDA 1CJLA 5E6JA 2BDLA 2ECWA 3M63A 2NQAA 3USVA 2PREA 3IOQA 4YYWA 5TBNA 5D1KB 4A4BA 4R2YA 3SUBA 4A49A 1AU0A 3HHAA 1S4VA 3TNXA 4XUIA 3H89A 2CT2A 3LFYA 2K4DA 7PCKA 1M6DA 3V43A 2FD4A 3S3QA 4MVTA 1ITOA 1PADA 2G7YA 2P0RA 1PE6A 4AXLA 2L7PA 3PT2A 1CHCA 2CRWA 2HH5A 4UP5A 1YZBA 4S3OC 3L1ZB 1NPZA 5LCWB 1VYXA 3C6WA 3DQVR 2DJGB 8PCHA 2OXQC 5SVYA 4LKAA 5D1LB 3SHBA 2YQLA 2E6RA 2YQMA 1PBHA 2YT5A 2DZYA 3VK6A 4F1PA 3BPFA 2UZGA 1Z2QA 1MM3A 3BOWA 4C9ZA 2F42A 4L7XA 1YK8A 2DZZA 2YVRA 1PCIA 1QOLA 3B79A 3P5UA 1F29A 4QF2A 3L1XA 5H9MA 3U5NA 2HWKA 2AYOA 4GNFA 2LDRA 4ZDTA 1XKGA 4WURA 2DCAA 1WFKA 2RI7A 2FQ9A 2I50A 4XZXA 1RMDA 2YJ8A 5LKTA 5B8DA 3O70A 5H1VA 1Z6UA 1GCBA 1E4UA 1TU6A 3IHPA 3ZUAA 5SVXA 2IBIA 3U5OA 4WZ3B 2OWAA 1QDQA 2VP7A 3ZNIA 1AIMA 2AVWA 3QSDA 2F7DA 5CHVA 5J94A 4PPEA 5KH3A 2KGGA 4Q8GA 1UKFA 2QJ0A 1MEGA 1V87A 3HTKC 2AU1A 5G0FA 1VSNA 1MIRA 4QBBA 1HYJA 3O47A 5TDRA 5H1TA 2BTWA 3NHEA 3MTVA 4X6IA 2KR4A 3WXFA 4MZSA 4CDFB 2J7QC 2F6NA 3KW9A 4OELA 2E02A 4PADA 2FSAA 1Y08A 2QICA 2M3HA 3PLWA 5AIUA 5PADA 3K24A 5LKXA 2JUNA 2WBFX 1U9VA 5KO3A 2L80A 2CSVA 1YVBA 4N4ZA 3PW3A 5JZEA 3LQIA 2F1GA 3O1GA 3BY4A 3GL6A 1YT7A 4I7BA 2Y43A 3W30A 4I04A 1IYMA 3Q1DA 2H0DA 4YYSA 2CSZA 2M13A 2QIZA 4QRVA 4GNEA 5EZSA 3RVXA 2JTCA 4CCGX 2YW8A 2XOCA 4ZUXU 3OF8A 1NQCA 1QXPA 2R9CA 2MA6A 3KX1A 5FPWA 3V6EA 3MORA 4YVAA 4YYUA 5B78A 3HD3A 2YJ9A 2IDAA 3O36A 1POPA 4BS6A 2MNYA 3O34A 4OGCA 2BTWB 2K1JA 4IC3A 2XU3A 2B0OE 4YYVA 5JH3A 3I2DA 1FBVA 3N9MA 4XI1A 5EYAF 2FUIA 3U8EA 4FO9A 2FO5A 2PBHA 3WXGA 4XR7A 1KHPA 2JMIA 3RPGB 2AIMA 2HXZA 4N79A 3S3RA 4UP0A 4CZWA 1DEUA 3FEHA 4KLBA 2HDPA 2KWNA
chains in the Genus database with same CATH topology
2FT2A 2B1MA 1PPOA 3GCBA 4QRXA 2FUDA 4YC9A 3KKUA 3E1ZB 2H0DB 3QJ3A 2AYNA 1BORA 2RSDA 2G6DA 4X6HA 3N9LA 4YYQA 3OVZA 4MZOA 2ECGA 3LRQA 2GFOA 2ECTA 4K7CA 2Y1NA 2MD8C 4W5CA 2VPBA 1PXVA 2MUMA 1W4TA 2LXHC 2E00A 1Q6KA 1WEPA 3N9QA 4PP1A 2MT5A 4V3KC 4L58A 3T6RA 4PP2E 2VPDA 1MS6A 4F52B 3HCTA 5EF4A 2G43A 2DCDA 1WEOA 1SP4B 5G05B 5CVNB 4AP4A 3N9OA 3PURA 5B79A 2C0YA 4AYCB 2KFTA 5I3LA 3AI8A 4CDDB 2ATOA 4Q6FA 5K16A 2FTDA 1WEQA 3C5KA 2R9NA 1PIPA 2F6JA 2Y5BA 2DX8A 2VJFA 1G25A 5A24A 4DMYA 3K9MA 3ASLA 2K17A 1VD4A 3MTNA 1FH0A 4WZ2A 5C11A 4YATA 1O0EA 2R6NA 4YABA 2JQFR 1NLJA 3BCNA 2YSJA 4NV7A 2YURA 3ZPV1 1VJVA 2FRQA 1NB5A 3RVVA 1W6FA 4OEMA 3M99A 4ZQLA 3RPGC 2G6QA 4LLBA 1NB3A 3RVWA 2O6XA 3KV5A 1X9YA 5H1UA 3BPMA 1PPDA 2XU5A 3F5VA 2Y1MA 4QF3A 1KFUL 3O0UA 3FL2A 2NQGA 1LDKC 2MIQA 1N87A 1BP4A 2CB5A 2VJFB 5KH7A 5FERA 3IMAA 1WEVA 3C9EA 2G8JA 4WZ0A 2LXPC 4IC2A 1KXRA 2GHUA 2PNSA 4HWYA 1E2TA 2IPPB 3I06A 4CDEB 2HHNA 2YUCA 2LRIC 1CS8A 4CDCB 3LQJA 5B76A 5DINA 1FP0A 2YYRA 1Z60A 2MD7B 1JQPA 1MM2A 4I07A 3IEJA 3H7DA 1VFYA 4BHWA 2R9FA 2VNFA 3T7LA 1X4UA 1WILA 5EGWA 4O64A 1EWLA 1BGOA 3U5MA 2OZ2A 3SOUA 1U9QX 5FB0A 5F02A 2YU4A 3MHHA 2NAAA 2L5UA 4S3OB 1F2AA 1GMYA 3HCUA 1Y4HA 1TLOA 2P7UA 2BAYA 4MSXA 4R8PK 4FK5A 1ZBDB 4YBSA 1T1HA 2MNZA 2AS8A 2CIOA 2E01A 3IUTA 1AU3A 3NG2A 1EWMA 3QT4A 4AYCA 4I05A 5TDWA 3EB5A 2EGPA 3LQHA 1ME4A 2L43A 2E03A 4BBQA 3EB6A 3CBJA 2KIZA 4BS5A 3CH3X 1JOCA 4Q8HA 5G04B 1LDJB 2G45A 1A6RA 2BDZA 1WEUA 4YADA 2XEUA 1K2FA 1EF7A 3N3KA 2YSMA 1EWOA 3DF0A 2VFCA 4BSQA 2YHNA 2C2VS 2ZETC 1BY8A 2P86A 1BQIA 3KQIA 1WEEA 3KV6A 3H8CA 3L11A 3DPLR 2KWKA 2VFBA 3KWZA 2LGGA 4AXMA 5C13A 4P6GA 3U5PA 5LKUA 4WA6A 1U9XA 2LQ6A 2K16A 3BWKA 2YHOA 4AVXA 2VJEA 2DCCA 1X4IA 3V6CA 1WEMA 4QH6A 3O33A 1X4JA 2LN0A 4YBMA 2C2LA 3IV2A 1STFE 1WGMA 4N3WA 3PHDA 4LK9A 2YJBA 5JG6A 3ERVA 4LJNA 1QMYA 4X3GA 3P5VA 5LKZA 3CH2X 1W5RA 1ZCMA 3CBKA 4R7EA 4GB0A 1AU2A 4P5OB 2B1NA 2Y6EA 3H6SA 2CSYA 9PAPA 3F75A 2AUZA 2PADA 3PBHA 2DC9A 1AYWA 3SOXA 3ZTGA 3PDFA 4YBTA 4YAXA 1JM7A 3HHIA 3SOWA 1TL9A 2ECIA 4A4CA 2L75A 3ZPVE 5KH9A 1GECE 3ZYQA 1GLOA 4CA1A 5CVOB 3ZVYA 2PNXA 1WESA 1XWHA 1AYUA 5CVMA 2KE1A 3P5XA 2VJEB 2OULA 2KREA 4X6JA 3I3TA 2H7JA 3KSEA 1F2CA 5TRBA 2YJ2A 2LGKA 3O37A 1IWDA 2AUXA 2FYEA 2VHFA 4YYRA 2LGLA 1CTEA 1CVZA 3OISA 2MA5A 2CKLA 4FIPA 3MHSA 5JA7A 1DF0A 1U6GB 3KWBX 1AU4A 1WIMA 2FUUA 2XU4A 2ARYA 2L0BA 4GNDA 1HYIA 2LGVA 2ECJA 5TABA 2M1RA 5B75A 1WEWA 1ZIVA 3BC3A 1DVPA 2PUYA 6PADA 2EODA 3O35A 2FRAA 3GV4A 1JM7B 1U5IA 2YREA 1AECA 5FEYA 4UI9B 1HUCB 3PUQA 4DMXA 4B7YC 5B77A 1ICFA 2DC8A 1MHWA 2JMJA 1SNKA 2LV9A 2E6SA 4I7DA 2ECNA 1CB5A 3KFQA 4QRGA 2XU1A 3WXEA 2KWJA 4YV8A 4BQVA 1WE9A 2BSZA 2JQGR 3HWNA 2OP3A 3N4CA 5CHTA 4V3LC 2YJCA 4PI3A 2HD5A 1ATKA 2R9MA 2KYUA 2CKLB 3HCSA 4NN2A 4W4UA 1K3BB 5AITA 3LTWA 4N8WA 2DC7A 4W5BA 1F2BA 2R9OA 4BPVA 1YK7A 2AN6A 4B55A 2DCBA 1MEMA 3OF9A 5D1MB 4B86C 2XB1A 2M6MA 3K8UA 2JRJA 1CPJA 4N4FA 1PPNA 1U9WA 4G54A 1EWPA 2JMDA 3M62A 2M85A 3O7AA 4A0CD 3LXSA 4P6EA 2KU3A 1CSBB 2NQIA 1THEA 3N9NA 5FB1A 2VPEA 4I7CA 4AUQB 1PPPA 2G8EA 3N3GA 3N9PA 3PNRA 4FJCA 4PTBA 2DJFB 3KNVA 3D6SA 2EA6A 2VHSA 3ZVZB 1KHQA 2ACTA 4TKPB 2NQDB 1ME3A 3OVXA 1YALA 1KFXL 2D8SA 3H8BA 3RTRB 4GNGA 5J3XA 4C5PA 1CV8A 2KGIA 2DC6A 3P5WA 3QZVA 4RY2A 2KWOA 2ECVA 1F62A 1AYVA 2HYED 1WENA 4LADB 5DKAA 1MDWA 1NL6A 1CQDA 1CJLA 2BDLA 2ECWA 3M63A 2NQAA 3USVA 2PREA 3IOQA 4YYWA 5TBNA 5D1KB 4A4BA 4R2YA 4A49A 1AU0A 3HHAA 1S4VA 3TNXA 4XUIA 3H89A 2CT2A 3LFYA 2K4DA 7PCKA 1M6DA 3V43A 3S3QA 4MVTA 1ITOA 1PADA 2G7YA 2P0RA 1PE6A 4AXLA 1CHCA 2HH5A 4UP5A 4S3OC 3L1ZB 1NPZA 5LCWB 1VYXA 3C6WA 3DQVR 2DJGB 8PCHA 2OXQC 4LKAA 5D1LB 3SHBA 2YQLA 2E6RA 2YQMA 1PBHA 2YT5A 2DZYA 3VK6A 3BPFA 2UZGA 1Z2QA 1MM3A 3BOWA 4C9ZA 2F42A 4L7XA 1YK8A 2DZZA 1PCIA 1QOLA 3B79A 3P5UA 1F29A 4QF2A 3L1XA 5H9MA 3U5NA 2AYOA 4GNFA 2LDRA 4ZDTA 1XKGA 2DCAA 1WFKA 2RI7A 2FQ9A 2I50A 1RMDA 2YJ8A 5LKTA 5B8DA 3O70A 5H1VA 1Z6UA 1GCBA 1E4UA 1TU6A 3IHPA 3ZUAA 1GX3A 2IBIA 3U5OA 4BGFA 4WZ3B 1QDQA 2VP7A 3ZNIA 1AIMA 2AVWA 3QSDA 2F7DA 5CHVA 5J94A 4PPEA 5KH3A 2KGGA 4Q8GA 2QJ0A 1MEGA 1V87A 3HTKC 2AU1A 5G0FA 1VSNA 1MIRA 4QBBA 1HYJA 5TDRA 4X6IA 5H1TA 3NHEA 3WXFA 2KR4A 4MZSA 4CDFB 2F6NA 3KW9A 4OELA 2E02A 4PADA 2FSAA 1Y08A 2QICA 2M3HA 5AIUA 5PADA 3K24A 5LKXA 2WBFX 1U9VA 2L80A 1YVBA 4N4ZA 3PW3A 3LQIA 2F1GA 3O1GA 3GL6A 1YT7A 4I7BA 2Y43A 4I04A 1IYMA 2H0DA 4YYSA 2CSZA 2QIZA 4QRVA 4GNEA 3RVXA 3D9WA 4CCGX 2YW8A 4ZUXU 3OF8A 1NQCA 1QXPA 2R9CA 2MA6A 3KX1A 5FPWA 3V6EA 3MORA 4NV8A 4YVAA 4YYUA 5B78A 3HD3A 2YJ9A 2IDAA 3O36A 1POPA 4BS6A 2MNYA 3O34A 4GUZA 2K1JA 4IC3A 2XU3A 4YYVA 5JH3A 3I2DA 1FBVA 3N9MA 4XI1A 5EYAF 2FUIA 3U8EA 4FO9A 2FO5A 2PBHA 3WXGA 4XR7A 1KHPA 2JMIA 3RPGB 2AIMA 2HXZA 4N79A 3S3RA 4UP0A 4CZWA 1DEUA 2VPGA 4KLBA 2HDPA 2KWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT2 A;  2B1M A;  1PPO A;  3GCB A;  4QRX A;  2FUD A;  4YC9 A;  3KKU A;  3E1Z B;  2H0D B;  3QJ3 A;  2AYN A;  1BOR A;  2RSD A;  2G6D A;  4X6H A;  3N9L A;  4YYQ A;  3OVZ A;  4MZO A;  2ECG A;  3LRQ A;  2GFO A;  2ECT A;  4K7C A;  2Y1N A;  2MD8 C;  4W5C A;  2VPB A;  1PXV A;  2MUM A;  2LXH C;  2E00 A;  1Q6K A;  1WEP A;  3N9Q A;  4PP1 A;  2MT5 A;  4V3K C;  4L58 A;  3T6R A;  4PP2 E;  2VPD A;  1MS6 A;  4F52 B;  3HCT A;  5EF4 A;  2G43 A;  2DCD A;  1WEO A;  1SP4 B;  5G05 B;  5CVN B;  4AP4 A;  3N9O A;  3PUR A;  5B79 A;  2C0Y A;  4AYC B;  2KFT A;  5I3L A;  3AI8 A;  4CDD B;  2ATO A;  4Q6F A;  5K16 A;  2FTD A;  1WEQ A;  3C5K A;  2R9N A;  1PIP A;  2F6J A;  2Y5B A;  2DX8 A;  2VJF A;  1G25 A;  5A24 A;  4DMY A;  3K9M A;  3ASL A;  2K17 A;  1VD4 A;  3MTN A;  1FH0 A;  4WZ2 A;  5C11 A;  4YAT A;  1O0E A;  2R6N A;  4YAB A;  2JQF R;  1NLJ A;  3BCN A;  2YSJ A;  2YUR A;  3ZPV 1;  1VJV A;  2FRQ A;  1NB5 A;  3RVV A;  4OEM A;  3M99 A;  4ZQL A;  3RPG C;  2G6Q A;  4LLB A;  1NB3 A;  3RVW A;  2O6X A;  3KV5 A;  1X9Y A;  5H1U A;  3BPM A;  1PPD A;  2XU5 A;  3F5V A;  2Y1M A;  4QF3 A;  1KFU L;  3O0U A;  3FL2 A;  2NQG A;  1LDK C;  2MIQ A;  1N87 A;  1BP4 A;  2CB5 A;  2VJF B;  5KH7 A;  5FER A;  3IMA A;  1WEV A;  3C9E A;  2G8J A;  4WZ0 A;  2LXP C;  4IC2 A;  1KXR A;  2GHU A;  2PNS A;  4HWY A;  2IPP B;  3I06 A;  4CDE B;  2HHN A;  2YUC A;  2LRI C;  1CS8 A;  4CDC B;  3LQJ A;  5B76 A;  5DIN A;  1FP0 A;  2YYR A;  1Z60 A;  2MD7 B;  1JQP A;  1MM2 A;  4I07 A;  3IEJ A;  3H7D A;  1VFY A;  4BHW A;  2R9F A;  2VNF A;  3T7L A;  1X4U A;  1WIL A;  5EGW A;  4O64 A;  1EWL A;  1BGO A;  3U5M A;  2OZ2 A;  3SOU A;  1U9Q X;  5FB0 A;  5F02 A;  2YU4 A;  3MHH A;  2NAA A;  2L5U A;  4S3O B;  1F2A A;  1GMY A;  3HCU A;  1Y4H A;  1TLO A;  2P7U A;  2BAY A;  4MSX A;  4R8P K;  4FK5 A;  1ZBD B;  4YBS A;  1T1H A;  2MNZ A;  2AS8 A;  2CIO A;  2E01 A;  3IUT A;  1AU3 A;  3NG2 A;  1EWM A;  3QT4 A;  4AYC A;  4I05 A;  5TDW A;  3EB5 A;  2EGP A;  3LQH A;  1ME4 A;  2L43 A;  2E03 A;  4BBQ A;  3EB6 A;  3CBJ A;  2KIZ A;  4BS5 A;  3CH3 X;  1JOC A;  4Q8H A;  5G04 B;  1LDJ B;  2G45 A;  1A6R A;  2BDZ A;  1WEU A;  4YAD A;  2XEU A;  1K2F A;  1EF7 A;  3N3K A;  2YSM A;  1EWO A;  3DF0 A;  4BSQ A;  2YHN A;  2C2V S;  2ZET C;  1BY8 A;  2P86 A;  1BQI A;  3KQI A;  1WEE A;  3KV6 A;  3H8C A;  3L11 A;  3DPL R;  2KWK A;  3KWZ A;  2LGG A;  4AXM A;  5C13 A;  4P6G A;  3U5P A;  5LKU A;  4WA6 A;  1U9X A;  2LQ6 A;  2K16 A;  3BWK A;  2YHO A;  4AVX A;  2VJE A;  2DCC A;  1X4I A;  3V6C A;  1WEM A;  4QH6 A;  3O33 A;  1X4J A;  2LN0 A;  4YBM A;  2C2L A;  3IV2 A;  1STF E;  1WGM A;  4N3W A;  3PHD A;  4LK9 A;  2YJB A;  5JG6 A;  3ERV A;  4LJN A;  1QMY A;  4X3G A;  3P5V A;  5LKZ A;  3CH2 X;  1ZCM A;  3CBK A;  4R7E A;  4GB0 A;  1AU2 A;  4P5O B;  2B1N A;  2Y6E A;  3H6S A;  2CSY A;  9PAP A;  3F75 A;  2AUZ A;  2PAD A;  3PBH A;  2DC9 A;  1AYW A;  3SOX A;  3ZTG A;  3PDF A;  4YBT A;  4YAX A;  1JM7 A;  3HHI A;  3SOW A;  1TL9 A;  2ECI A;  4A4C A;  2L75 A;  3ZPV E;  5KH9 A;  1GEC E;  3ZYQ A;  1GLO A;  4CA1 A;  5CVO B;  3ZVY A;  2PNX A;  1WES A;  1XWH A;  1AYU A;  5CVM A;  2KE1 A;  3P5X A;  2VJE B;  2OUL A;  2KRE A;  4X6J A;  3I3T A;  2H7J A;  3KSE A;  1F2C A;  5TRB A;  2YJ2 A;  2LGK A;  3O37 A;  1IWD A;  2AUX A;  2FYE A;  2VHF A;  4YYR A;  2LGL A;  1CTE A;  1CVZ A;  3OIS A;  2MA5 A;  2CKL A;  4FIP A;  3MHS A;  5JA7 A;  1DF0 A;  1U6G B;  3KWB X;  1AU4 A;  1WIM A;  2FUU A;  2XU4 A;  2ARY A;  2L0B A;  4GND A;  1HYI A;  2LGV A;  2ECJ A;  5TAB A;  2M1R A;  5B75 A;  1WEW A;  1ZIV A;  3BC3 A;  1DVP A;  2PUY A;  6PAD A;  2EOD A;  3O35 A;  2FRA A;  3GV4 A;  1JM7 B;  1U5I A;  2YRE A;  1AEC A;  5FEY A;  4UI9 B;  1HUC B;  3PUQ A;  4DMX A;  4B7Y C;  5B77 A;  1ICF A;  2DC8 A;  1MHW A;  2JMJ A;  1SNK A;  2LV9 A;  2E6S A;  4I7D A;  2ECN A;  1CB5 A;  3KFQ A;  4QRG A;  2XU1 A;  3WXE A;  2KWJ A;  4YV8 A;  4BQV A;  1WE9 A;  2JQG R;  3HWN A;  2OP3 A;  3N4C A;  5CHT A;  4V3L C;  2YJC A;  4PI3 A;  2HD5 A;  1ATK A;  2R9M A;  2KYU A;  2CKL B;  3HCS A;  4NN2 A;  4W4U A;  1K3B B;  5AIT A;  4N8W A;  2DC7 A;  4W5B A;  1F2B A;  2R9O A;  4BPV A;  1YK7 A;  2AN6 A;  2DCB A;  1MEM A;  3OF9 A;  5D1M B;  4B86 C;  2XB1 A;  2M6M A;  3K8U A;  2JRJ A;  1CPJ A;  4N4F A;  1PPN A;  1U9W A;  4G54 A;  1EWP A;  2JMD A;  3M62 A;  2M85 A;  3O7A A;  4A0C D;  3LXS A;  4P6E A;  2KU3 A;  1CSB B;  2NQI A;  1THE A;  3N9N A;  5FB1 A;  2VPE A;  4I7C A;  4AUQ B;  1PPP A;  2G8E A;  3N3G A;  3N9P A;  3PNR A;  4FJC A;  4PTB A;  2DJF B;  3KNV A;  3D6S A;  2EA6 A;  2VHS A;  3ZVZ B;  1KHQ A;  2ACT A;  4TKP B;  2NQD B;  1ME3 A;  3OVX A;  1YAL A;  1KFX L;  2D8S A;  3H8B A;  3RTR B;  4GNG A;  5J3X A;  1CV8 A;  2KGI A;  2DC6 A;  3P5W A;  3QZV A;  4RY2 A;  2KWO A;  2ECV A;  1F62 A;  1AYV A;  2HYE D;  1WEN A;  4LAD B;  5DKA A;  1MDW A;  1NL6 A;  1CQD A;  1CJL A;  2BDL A;  2ECW A;  3M63 A;  2NQA A;  3USV A;  2PRE A;  3IOQ A;  4YYW A;  5TBN A;  5D1K B;  4A4B A;  4R2Y A;  4A49 A;  1AU0 A;  3HHA A;  1S4V A;  3TNX A;  4XUI A;  3H89 A;  2CT2 A;  3LFY A;  2K4D A;  7PCK A;  1M6D A;  3V43 A;  3S3Q A;  4MVT A;  1ITO A;  1PAD A;  2G7Y A;  2P0R A;  1PE6 A;  4AXL A;  1CHC A;  2HH5 A;  4UP5 A;  4S3O C;  3L1Z B;  1NPZ A;  5LCW B;  1VYX A;  3C6W A;  3DQV R;  2DJG B;  8PCH A;  2OXQ C;  4LKA A;  5D1L B;  3SHB A;  2YQL A;  2E6R A;  2YQM A;  1PBH A;  2YT5 A;  2DZY A;  3VK6 A;  3BPF A;  2UZG A;  1Z2Q A;  1MM3 A;  3BOW A;  4C9Z A;  2F42 A;  4L7X A;  1YK8 A;  2DZZ A;  1PCI A;  1QOL A;  3B79 A;  3P5U A;  1F29 A;  4QF2 A;  3L1X A;  5H9M A;  3U5N A;  2AYO A;  4GNF A;  2LDR A;  4ZDT A;  1XKG A;  2DCA A;  1WFK A;  2RI7 A;  2FQ9 A;  2I50 A;  1RMD A;  2YJ8 A;  5LKT A;  5B8D A;  3O70 A;  5H1V A;  1Z6U A;  1GCB A;  1E4U A;  1TU6 A;  3IHP A;  3ZUA A;  2IBI A;  3U5O A;  4WZ3 B;  1QDQ A;  2VP7 A;  3ZNI A;  1AIM A;  2AVW A;  3QSD A;  2F7D A;  5CHV A;  5J94 A;  4PPE A;  5KH3 A;  2KGG A;  4Q8G A;  2QJ0 A;  1MEG A;  1V87 A;  3HTK C;  2AU1 A;  5G0F A;  1VSN A;  1MIR A;  4QBB A;  1HYJ A;  5TDR A;  4X6I A;  5H1T A;  3NHE A;  3WXF A;  2KR4 A;  4MZS A;  4CDF B;  2F6N A;  3KW9 A;  4OEL A;  2E02 A;  4PAD A;  2FSA A;  1Y08 A;  2QIC A;  2M3H A;  5AIU A;  5PAD A;  3K24 A;  5LKX A;  2WBF X;  1U9V A;  2L80 A;  1YVB A;  4N4Z A;  3PW3 A;  3LQI A;  2F1G A;  3O1G A;  3GL6 A;  1YT7 A;  4I7B A;  2Y43 A;  4I04 A;  1IYM A;  2H0D A;  4YYS A;  2CSZ A;  2QIZ A;  4QRV A;  4GNE A;  3RVX A;  4CCG X;  2YW8 A;  4ZUX U;  3OF8 A;  1NQC A;  1QXP A;  2R9C A;  2MA6 A;  3KX1 A;  5FPW A;  3V6E A;  3MOR A;  4YVA A;  4YYU A;  5B78 A;  3HD3 A;  2YJ9 A;  2IDA A;  3O36 A;  1POP A;  4BS6 A;  2MNY A;  3O34 A;  2K1J A;  4IC3 A;  2XU3 A;  4YYV A;  5JH3 A;  3I2D A;  1FBV A;  3N9M A;  4XI1 A;  5EYA F;  2FUI A;  3U8E A;  4FO9 A;  2FO5 A;  2PBH A;  3WXG A;  4XR7 A;  1KHP A;  2JMI A;  3RPG B;  2AIM A;  2HXZ A;  4N79 A;  3S3R A;  4UP0 A;  4CZW A;  1DEU A;  2VPG A;  4KLB A;  2HDP A;  2KWN A; 
#chains in the Genus database with same CATH topology
 2FT2 A;  2B1M A;  1PPO A;  3GCB A;  4BOU A;  4QRX A;  3RNV A;  2FUD A;  4YC9 A;  3KKU A;  3E1Z B;  2H0D B;  3QJ3 A;  2AYN A;  1BOR A;  2RSD A;  2G6D A;  4X6H A;  2CRR A;  3N9L A;  3DWD A;  3OVZ A;  4YYQ A;  4MZO A;  2ECG A;  3LRQ A;  2GFO A;  2ECT A;  4A5U A;  4BOQ A;  3PRM A;  4IUM A;  4K7C A;  4REZ A;  2Y1N A;  2MD8 C;  4W5C A;  2VPB A;  1PXV A;  2MUM A;  2LXH C;  2E00 A;  1Q6K A;  1WEP A;  3N9Q A;  3ZNH A;  4PP1 A;  2MT5 A;  4V3K C;  2LAU A;  4L58 A;  3T6R A;  4PP2 E;  5EZQ A;  2VPD A;  1MS6 A;  4F52 B;  3HCT A;  5EF4 A;  3FJU B;  2G43 A;  2DCD A;  1WEO A;  1SP4 B;  5G05 B;  5CVN B;  4AP4 A;  3N9O A;  4OVZ A;  3PUR A;  5B79 A;  2C0Y A;  3W31 A;  4AYC B;  2KFT A;  5I3L A;  3AI8 A;  4OW0 A;  4CDD B;  2ATO A;  4Q6F A;  5K16 A;  2FTD A;  1WEQ A;  3C5K A;  3JUE A;  2R9N A;  1PIP A;  2F6J A;  2Y5B A;  2DX8 A;  2VJF A;  1G25 A;  5A24 A;  2E61 A;  4DMY A;  3K9M A;  3ASL A;  2K17 A;  1VD4 A;  3MTN A;  3FM8 C;  1FH0 A;  4WZ2 A;  5C11 A;  4YAT A;  1O0E A;  2R6N A;  5K3Q A;  4HXD B;  2EGM A;  4YAB A;  2JQF R;  1NLJ A;  4R3D A;  3BCN A;  2YSJ A;  1MBM A;  2YUR A;  3ZPV 1;  1VJV A;  2FRQ A;  1NB5 A;  3RVV A;  4OEM A;  3M99 A;  3IFU A;  4ZQL A;  4Z0R A;  3T9K A;  3RPG C;  2IQJ A;  2G6Q A;  4LLB A;  1NB3 A;  3RVW A;  2O6X A;  3KV5 A;  1X9Y A;  5H1U A;  4OVZ B;  3BPM A;  1PPD A;  2XU5 A;  3F5V A;  2Y1M A;  3PHW A;  4M0W A;  4QF3 A;  1KFU L;  3O0U A;  2UZJ A;  3FL2 A;  2NQG A;  1LDK C;  2MIQ A;  1N87 A;  1DCQ A;  1BP4 A;  2CB5 A;  2VJF B;  5KH7 A;  5FER A;  3IMA A;  3MJ5 A;  1WEV A;  3C9E A;  2JRI A;  2G8J A;  4WZ0 A;  3FAN A;  2LXP C;  4IC2 A;  1KXR A;  2GHU A;  2PNS A;  4HWY A;  2P57 A;  2CON A;  2IPP B;  3I06 A;  4CDE B;  2HHN A;  2FFW A;  4RF0 A;  2YUC A;  2LRI C;  1CS8 A;  4CDC B;  3LQJ A;  5B76 A;  2DOS A;  5DIN A;  1FP0 A;  2YYR A;  1Z60 A;  2MD7 B;  1JQP A;  1MM2 A;  4I07 A;  3IEJ A;  3H7D A;  1VFY A;  4BHW A;  2R9F A;  2VNF A;  3T7L A;  1X4U A;  2XOY A;  1WIL A;  5EGW A;  4O64 A;  1EWL A;  4BOS A;  2D8U A;  1BGO A;  3U5M A;  2OZ2 A;  3SOU A;  1U9Q X;  5FB0 A;  5F02 A;  2YU4 A;  3MHH A;  2NAA A;  2L5U A;  4S3O B;  4RF1 A;  1F2A A;  1GMY A;  3HCU A;  1Y4H A;  1TLO A;  2P7U A;  2BAY A;  4MSX A;  3TRK A;  2XOZ A;  4R8P K;  3LDY A;  4FK5 A;  1ZBD B;  4YBS A;  1T1H A;  2MNZ A;  2AS8 A;  2CIO A;  2E01 A;  3IUT A;  1AU3 A;  3NG2 A;  1EWM A;  3QT4 A;  4AYC A;  4I05 A;  4D8B A;  5TDW A;  3EB5 A;  2EGP A;  3LQH A;  1ME4 A;  2L43 A;  3BB7 A;  2E03 A;  4BBQ A;  3EB6 A;  3CBJ A;  2KIZ A;  4MI7 A;  4BS5 A;  2FE8 A;  1JOC A;  3CH3 X;  5G04 B;  4RKX A;  4Q8H A;  1LDJ B;  2G45 A;  1A6R A;  2BDZ A;  1WEU A;  4YAD A;  2XEU A;  1K2F A;  1EF7 A;  3N3K A;  2YSM A;  1EWO A;  4BOP A;  3DF0 A;  4BSQ A;  3H7H A;  2XP0 A;  2C2V S;  2YHN A;  2ZET C;  1BY8 A;  1BQI A;  3KQI A;  2P86 A;  3B21 A;  1WEE A;  3KV6 A;  4O62 A;  3H8C A;  2BU3 A;  3TMP A;  3L11 A;  3DPL R;  2KWK A;  3KWZ A;  2JM3 A;  2LGG A;  4AXM A;  5C13 A;  4P6G A;  3U5P A;  5LKU A;  3LVQ E;  4WA6 A;  1U9X A;  2LQ6 A;  2K16 A;  3BWK A;  2YHO A;  4AVX A;  2VJE A;  3O65 A;  2DCC A;  1X4I A;  3V6C A;  1WEM A;  4QH6 A;  3O33 A;  3M7K A;  1X4J A;  3MDB C;  2LN0 A;  4YBM A;  2C2L A;  3IV2 A;  1STF E;  5SVI A;  1WGM A;  3LVR E;  4N3W A;  3PHD A;  4LK9 A;  2YJB A;  5JG6 A;  3ERV A;  4LJN A;  1QMY A;  4X3G A;  3P5V A;  5LKZ A;  3CH2 X;  2VPG A;  4Z0O A;  1ZCM A;  3CBK A;  4R7E A;  4GB0 A;  1AU2 A;  4P5O B;  2B1N A;  2Y6E A;  3H6S A;  4BOZ A;  2CSY A;  9PAP A;  3F75 A;  2AUZ A;  2PAD A;  3PBH A;  2DC9 A;  1AYW A;  3SOX A;  3ZTG A;  3PDF A;  4YBT A;  4YAX A;  1JM7 A;  3HHI A;  3SOW A;  2Z84 A;  3PRP A;  1TL9 A;  2ECI A;  2KKY A;  4A4C A;  2L75 A;  3ZPV E;  5KH9 A;  1GEC E;  3ZYQ A;  1GLO A;  4CA1 A;  5CVO B;  3ZVY A;  4P16 A;  3MP2 A;  2PNX A;  1WES A;  1XWH A;  1AYU A;  3DDT A;  5CVM A;  2KE1 A;  4ZTB A;  3P5X A;  2VJE B;  2OUL A;  2KRE A;  2EXU A;  4X6J A;  3I3T A;  3PHU A;  2H7J A;  3KSE A;  5SVI B;  1F2C A;  5TRB A;  4GUA A;  2YJ2 A;  2LGK A;  3O37 A;  1IWD A;  2AUX A;  2FYE A;  2VHF A;  4YYR A;  2LGL A;  1CTE A;  1CVZ A;  3OIS A;  4MM3 B;  2MA5 A;  2CKL A;  2DJA A;  4FIP A;  3MHS A;  5JA7 A;  1DF0 A;  1U6G B;  3KWB X;  1AU4 A;  1WIM A;  2FUU A;  2XU4 A;  2ARY A;  3KDE C;  2L0B A;  2MKE A;  4GND A;  1HYI A;  2LGV A;  1DKI A;  2ECJ A;  5TAB A;  2M1R A;  5B75 A;  1WEW A;  1ZIV A;  3BC3 A;  1DVP A;  2PUY A;  6PAD A;  2EOD A;  3O35 A;  2FRA A;  3GV4 A;  1JM7 B;  1U5I A;  2YRE A;  1AEC A;  5FEY A;  4UI9 B;  1HUC B;  3BBA A;  3PUQ A;  2DSM A;  2RR4 A;  4DMX A;  4B7Y C;  5B77 A;  1ICF A;  3PSE A;  2DC8 A;  1MHW A;  2JMJ A;  1SNK A;  2LV9 A;  4QQ4 A;  2E6S A;  4I7D A;  2ECN A;  1CB5 A;  3KFQ A;  4QRG A;  2XU1 A;  4PT5 A;  3WXE A;  2KWJ A;  4YV8 A;  4BQV A;  1WE9 A;  4IP3 A;  3C0R A;  2JQG R;  2AGA A;  3HWN A;  2OP3 A;  3N4C A;  5CHT A;  4V3L C;  2YJC A;  4PI3 A;  2HD5 A;  1ATK A;  2R9M A;  2KYU A;  2CKL B;  3HCS A;  4D8I A;  4NN2 A;  4W4U A;  1K3B B;  5AIT A;  2J7Q A;  4N8W A;  2DC7 A;  4W5B A;  4OGE A;  1F2B A;  2R9O A;  4BPV A;  1YK7 A;  2AN6 A;  2DCB A;  1MEM A;  3OF9 A;  5D1M B;  4B86 C;  2KKX A;  2XB1 A;  2M6M A;  3K8U A;  2JRJ A;  1CPJ A;  4N4F A;  1PPN A;  1U9W A;  4G54 A;  1EWP A;  2JMD A;  3M62 A;  2M85 A;  3O7A A;  3FAO A;  4A0C D;  3LXS A;  3OQC A;  4P6E A;  2KU3 A;  1CSB B;  2NQI A;  1THE A;  3N9N A;  5FB1 A;  2VPE A;  4I7C A;  4AUQ B;  1PPP A;  2G8E A;  3N3G A;  4H9D A;  3N9P A;  3PNR A;  3E2D A;  4FJC A;  4PTB A;  2DJF B;  3KNV A;  3D6S A;  2EA6 A;  2VHS A;  3ZVZ B;  1KHQ A;  2ACT A;  4TKP B;  2NQD B;  1ME3 A;  3OVX A;  1YAL A;  4D8E A;  1KFX L;  2D8S A;  3H8B A;  3RTR B;  4GNG A;  5J3X A;  3E9S A;  1CV8 A;  2KGI A;  2DC6 A;  3P5W A;  3QZV A;  1PVJ A;  4RY2 A;  2KWO A;  2ECV A;  1F62 A;  1AYV A;  2HYE D;  1WEN A;  3LJU X;  4RNA A;  4LAD B;  5DKA A;  1MDW A;  1NL6 A;  3PHX A;  1CQD A;  1CJL A;  5E6J A;  2BDL A;  2ECW A;  3M63 A;  2NQA A;  3USV A;  2PRE A;  3IOQ A;  4YYW A;  5TBN A;  5D1K B;  4A4B A;  4R2Y A;  3SUB A;  4A49 A;  1AU0 A;  3HHA A;  1S4V A;  3TNX A;  4XUI A;  3H89 A;  2CT2 A;  3LFY A;  2K4D A;  7PCK A;  1M6D A;  3V43 A;  2FD4 A;  3S3Q A;  4MVT A;  1ITO A;  1PAD A;  2G7Y A;  2P0R A;  1PE6 A;  4AXL A;  2L7P A;  3PT2 A;  1CHC A;  2CRW A;  2HH5 A;  4UP5 A;  1YZB A;  4S3O C;  3L1Z B;  1NPZ A;  5LCW B;  1VYX A;  3C6W A;  3DQV R;  2DJG B;  8PCH A;  2OXQ C;  5SVY A;  4LKA A;  5D1L B;  3SHB A;  2YQL A;  2E6R A;  2YQM A;  1PBH A;  2YT5 A;  2DZY A;  3VK6 A;  4F1P A;  3BPF A;  2UZG A;  1Z2Q A;  1MM3 A;  3BOW A;  4C9Z A;  2F42 A;  4L7X A;  1YK8 A;  2DZZ A;  2YVR A;  1PCI A;  1QOL A;  3B79 A;  3P5U A;  1F29 A;  4QF2 A;  3L1X A;  5H9M A;  3U5N A;  2HWK A;  2AYO A;  4GNF A;  2LDR A;  4ZDT A;  1XKG A;  4WUR A;  2DCA A;  1WFK A;  2RI7 A;  2FQ9 A;  2I50 A;  4XZX A;  1RMD A;  2YJ8 A;  5LKT A;  5B8D A;  3O70 A;  5H1V A;  1Z6U A;  1GCB A;  1E4U A;  1TU6 A;  3IHP A;  3ZUA A;  5SVX A;  2IBI A;  3U5O A;  4WZ3 B;  2OWA A;  1QDQ A;  2VP7 A;  3ZNI A;  1AIM A;  2AVW A;  3QSD A;  2F7D A;  5CHV A;  5J94 A;  4PPE A;  5KH3 A;  2KGG A;  4Q8G A;  1UKF A;  2QJ0 A;  1MEG A;  1V87 A;  3HTK C;  2AU1 A;  5G0F A;  1VSN A;  1MIR A;  4QBB A;  1HYJ A;  3O47 A;  5TDR A;  5H1T A;  2BTW A;  3NHE A;  3MTV A;  4X6I A;  2KR4 A;  3WXF A;  4MZS A;  4CDF B;  2J7Q C;  2F6N A;  3KW9 A;  4OEL A;  2E02 A;  4PAD A;  2FSA A;  1Y08 A;  2QIC A;  2M3H A;  3PLW A;  5AIU A;  5PAD A;  3K24 A;  5LKX A;  2JUN A;  2WBF X;  1U9V A;  5KO3 A;  2L80 A;  2CSV A;  1YVB A;  4N4Z A;  3PW3 A;  5JZE A;  3LQI A;  2F1G A;  3O1G A;  3BY4 A;  3GL6 A;  1YT7 A;  4I7B A;  2Y43 A;  3W30 A;  4I04 A;  1IYM A;  3Q1D A;  2H0D A;  4YYS A;  2CSZ A;  2M13 A;  2QIZ A;  4QRV A;  4GNE A;  5EZS A;  3RVX A;  2JTC A;  4CCG X;  2YW8 A;  2XOC A;  4ZUX U;  3OF8 A;  1NQC A;  1QXP A;  2R9C A;  2MA6 A;  3KX1 A;  5FPW A;  3V6E A;  3MOR A;  4YVA A;  4YYU A;  5B78 A;  3HD3 A;  2YJ9 A;  2IDA A;  3O36 A;  1POP A;  4BS6 A;  2MNY A;  3O34 A;  4OGC A;  2BTW B;  2K1J A;  4IC3 A;  2XU3 A;  2B0O E;  4YYV A;  5JH3 A;  3I2D A;  1FBV A;  3N9M A;  4XI1 A;  5EYA F;  2FUI A;  3U8E A;  4FO9 A;  2FO5 A;  2PBH A;  3WXG A;  4XR7 A;  1KHP A;  2JMI A;  3RPG B;  2AIM A;  2HXZ A;  4N79 A;  3S3R A;  4UP0 A;  4CZW A;  1DEU A;  3FEH A;  4KLB A;  2HDP A;  2KWN A; 
#chains in the Genus database with same CATH homology
 2FT2 A;  2B1M A;  1PPO A;  3GCB A;  4QRX A;  2FUD A;  4YC9 A;  3KKU A;  3E1Z B;  2H0D B;  3QJ3 A;  2AYN A;  1BOR A;  2RSD A;  2G6D A;  4X6H A;  3N9L A;  4YYQ A;  3OVZ A;  4MZO A;  2ECG A;  3LRQ A;  2GFO A;  2ECT A;  4K7C A;  2Y1N A;  2MD8 C;  4W5C A;  2VPB A;  1PXV A;  2MUM A;  1W4T A;  2LXH C;  2E00 A;  1Q6K A;  1WEP A;  3N9Q A;  4PP1 A;  2MT5 A;  4V3K C;  4L58 A;  3T6R A;  4PP2 E;  2VPD A;  1MS6 A;  4F52 B;  3HCT A;  5EF4 A;  2G43 A;  2DCD A;  1WEO A;  1SP4 B;  5G05 B;  5CVN B;  4AP4 A;  3N9O A;  3PUR A;  5B79 A;  2C0Y A;  4AYC B;  2KFT A;  5I3L A;  3AI8 A;  4CDD B;  2ATO A;  4Q6F A;  5K16 A;  2FTD A;  1WEQ A;  3C5K A;  2R9N A;  1PIP A;  2F6J A;  2Y5B A;  2DX8 A;  2VJF A;  1G25 A;  5A24 A;  4DMY A;  3K9M A;  3ASL A;  2K17 A;  1VD4 A;  3MTN A;  1FH0 A;  4WZ2 A;  5C11 A;  4YAT A;  1O0E A;  2R6N A;  4YAB A;  2JQF R;  1NLJ A;  3BCN A;  2YSJ A;  4NV7 A;  2YUR A;  3ZPV 1;  1VJV A;  2FRQ A;  1NB5 A;  3RVV A;  1W6F A;  4OEM A;  3M99 A;  4ZQL A;  3RPG C;  2G6Q A;  4LLB A;  1NB3 A;  3RVW A;  2O6X A;  3KV5 A;  1X9Y A;  5H1U A;  3BPM A;  1PPD A;  2XU5 A;  3F5V A;  2Y1M A;  4QF3 A;  1KFU L;  3O0U A;  3FL2 A;  2NQG A;  1LDK C;  2MIQ A;  1N87 A;  1BP4 A;  2CB5 A;  2VJF B;  5KH7 A;  5FER A;  3IMA A;  1WEV A;  3C9E A;  2G8J A;  4WZ0 A;  2LXP C;  4IC2 A;  1KXR A;  2GHU A;  2PNS A;  4HWY A;  1E2T A;  2IPP B;  3I06 A;  4CDE B;  2HHN A;  2YUC A;  2LRI C;  1CS8 A;  4CDC B;  3LQJ A;  5B76 A;  5DIN A;  1FP0 A;  2YYR A;  1Z60 A;  2MD7 B;  1JQP A;  1MM2 A;  4I07 A;  3IEJ A;  3H7D A;  1VFY A;  4BHW A;  2R9F A;  2VNF A;  3T7L A;  1X4U A;  1WIL A;  5EGW A;  4O64 A;  1EWL A;  1BGO A;  3U5M A;  2OZ2 A;  3SOU A;  1U9Q X;  5FB0 A;  5F02 A;  2YU4 A;  3MHH A;  2NAA A;  2L5U A;  4S3O B;  1F2A A;  1GMY A;  3HCU A;  1Y4H A;  1TLO A;  2P7U A;  2BAY A;  4MSX A;  4R8P K;  4FK5 A;  1ZBD B;  4YBS A;  1T1H A;  2MNZ A;  2AS8 A;  2CIO A;  2E01 A;  3IUT A;  1AU3 A;  3NG2 A;  1EWM A;  3QT4 A;  4AYC A;  4I05 A;  5TDW A;  3EB5 A;  2EGP A;  3LQH A;  1ME4 A;  2L43 A;  2E03 A;  4BBQ A;  3EB6 A;  3CBJ A;  2KIZ A;  4BS5 A;  3CH3 X;  1JOC A;  4Q8H A;  5G04 B;  1LDJ B;  2G45 A;  1A6R A;  2BDZ A;  1WEU A;  4YAD A;  2XEU A;  1K2F A;  1EF7 A;  3N3K A;  2YSM A;  1EWO A;  3DF0 A;  2VFC A;  4BSQ A;  2YHN A;  2C2V S;  2ZET C;  1BY8 A;  2P86 A;  1BQI A;  3KQI A;  1WEE A;  3KV6 A;  3H8C A;  3L11 A;  3DPL R;  2KWK A;  2VFB A;  3KWZ A;  2LGG A;  4AXM A;  5C13 A;  4P6G A;  3U5P A;  5LKU A;  4WA6 A;  1U9X A;  2LQ6 A;  2K16 A;  3BWK A;  2YHO A;  4AVX A;  2VJE A;  2DCC A;  1X4I A;  3V6C A;  1WEM A;  4QH6 A;  3O33 A;  1X4J A;  2LN0 A;  4YBM A;  2C2L A;  3IV2 A;  1STF E;  1WGM A;  4N3W A;  3PHD A;  4LK9 A;  2YJB A;  5JG6 A;  3ERV A;  4LJN A;  1QMY A;  4X3G A;  3P5V A;  5LKZ A;  3CH2 X;  1W5R A;  1ZCM A;  3CBK A;  4R7E A;  4GB0 A;  1AU2 A;  4P5O B;  2B1N A;  2Y6E A;  3H6S A;  2CSY A;  9PAP A;  3F75 A;  2AUZ A;  2PAD A;  3PBH A;  2DC9 A;  1AYW A;  3SOX A;  3ZTG A;  3PDF A;  4YBT A;  4YAX A;  1JM7 A;  3HHI A;  3SOW A;  1TL9 A;  2ECI A;  4A4C A;  2L75 A;  3ZPV E;  5KH9 A;  1GEC E;  3ZYQ A;  1GLO A;  4CA1 A;  5CVO B;  3ZVY A;  2PNX A;  1WES A;  1XWH A;  1AYU A;  5CVM A;  2KE1 A;  3P5X A;  2VJE B;  2OUL A;  2KRE A;  4X6J A;  3I3T A;  2H7J A;  3KSE A;  1F2C A;  5TRB A;  2YJ2 A;  2LGK A;  3O37 A;  1IWD A;  2AUX A;  2FYE A;  2VHF A;  4YYR A;  2LGL A;  1CTE A;  1CVZ A;  3OIS A;  2MA5 A;  2CKL A;  4FIP A;  3MHS A;  5JA7 A;  1DF0 A;  1U6G B;  3KWB X;  1AU4 A;  1WIM A;  2FUU A;  2XU4 A;  2ARY A;  2L0B A;  4GND A;  1HYI A;  2LGV A;  2ECJ A;  5TAB A;  2M1R A;  5B75 A;  1WEW A;  1ZIV A;  3BC3 A;  1DVP A;  2PUY A;  6PAD A;  2EOD A;  3O35 A;  2FRA A;  3GV4 A;  1JM7 B;  1U5I A;  2YRE A;  1AEC A;  5FEY A;  4UI9 B;  1HUC B;  3PUQ A;  4DMX A;  4B7Y C;  5B77 A;  1ICF A;  2DC8 A;  1MHW A;  2JMJ A;  1SNK A;  2LV9 A;  2E6S A;  4I7D A;  2ECN A;  1CB5 A;  3KFQ A;  4QRG A;  2XU1 A;  3WXE A;  2KWJ A;  4YV8 A;  4BQV A;  1WE9 A;  2BSZ A;  2JQG R;  3HWN A;  2OP3 A;  3N4C A;  5CHT A;  4V3L C;  2YJC A;  4PI3 A;  2HD5 A;  1ATK A;  2R9M A;  2KYU A;  2CKL B;  3HCS A;  4NN2 A;  4W4U A;  1K3B B;  5AIT A;  3LTW A;  4N8W A;  2DC7 A;  4W5B A;  1F2B A;  2R9O A;  4BPV A;  1YK7 A;  2AN6 A;  4B55 A;  2DCB A;  1MEM A;  3OF9 A;  5D1M B;  4B86 C;  2XB1 A;  2M6M A;  3K8U A;  2JRJ A;  1CPJ A;  4N4F A;  1PPN A;  1U9W A;  4G54 A;  1EWP A;  2JMD A;  3M62 A;  2M85 A;  3O7A A;  4A0C D;  3LXS A;  4P6E A;  2KU3 A;  1CSB B;  2NQI A;  1THE A;  3N9N A;  5FB1 A;  2VPE A;  4I7C A;  4AUQ B;  1PPP A;  2G8E A;  3N3G A;  3N9P A;  3PNR A;  4FJC A;  4PTB A;  2DJF B;  3KNV A;  3D6S A;  2EA6 A;  2VHS A;  3ZVZ B;  1KHQ A;  2ACT A;  4TKP B;  2NQD B;  1ME3 A;  3OVX A;  1YAL A;  1KFX L;  2D8S A;  3H8B A;  3RTR B;  4GNG A;  5J3X A;  4C5P A;  1CV8 A;  2KGI A;  2DC6 A;  3P5W A;  3QZV A;  4RY2 A;  2KWO A;  2ECV A;  1F62 A;  1AYV A;  2HYE D;  1WEN A;  4LAD B;  5DKA A;  1MDW A;  1NL6 A;  1CQD A;  1CJL A;  2BDL A;  2ECW A;  3M63 A;  2NQA A;  3USV A;  2PRE A;  3IOQ A;  4YYW A;  5TBN A;  5D1K B;  4A4B A;  4R2Y A;  4A49 A;  1AU0 A;  3HHA A;  1S4V A;  3TNX A;  4XUI A;  3H89 A;  2CT2 A;  3LFY A;  2K4D A;  7PCK A;  1M6D A;  3V43 A;  3S3Q A;  4MVT A;  1ITO A;  1PAD A;  2G7Y A;  2P0R A;  1PE6 A;  4AXL A;  1CHC A;  2HH5 A;  4UP5 A;  4S3O C;  3L1Z B;  1NPZ A;  5LCW B;  1VYX A;  3C6W A;  3DQV R;  2DJG B;  8PCH A;  2OXQ C;  4LKA A;  5D1L B;  3SHB A;  2YQL A;  2E6R A;  2YQM A;  1PBH A;  2YT5 A;  2DZY A;  3VK6 A;  3BPF A;  2UZG A;  1Z2Q A;  1MM3 A;  3BOW A;  4C9Z A;  2F42 A;  4L7X A;  1YK8 A;  2DZZ A;  1PCI A;  1QOL A;  3B79 A;  3P5U A;  1F29 A;  4QF2 A;  3L1X A;  5H9M A;  3U5N A;  2AYO A;  4GNF A;  2LDR A;  4ZDT A;  1XKG A;  2DCA A;  1WFK A;  2RI7 A;  2FQ9 A;  2I50 A;  1RMD A;  2YJ8 A;  5LKT A;  5B8D A;  3O70 A;  5H1V A;  1Z6U A;  1GCB A;  1E4U A;  1TU6 A;  3IHP A;  3ZUA A;  1GX3 A;  2IBI A;  3U5O A;  4BGF A;  4WZ3 B;  1QDQ A;  2VP7 A;  3ZNI A;  1AIM A;  2AVW A;  3QSD A;  2F7D A;  5CHV A;  5J94 A;  4PPE A;  5KH3 A;  2KGG A;  4Q8G A;  2QJ0 A;  1MEG A;  1V87 A;  3HTK C;  2AU1 A;  5G0F A;  1VSN A;  1MIR A;  4QBB A;  1HYJ A;  5TDR A;  4X6I A;  5H1T A;  3NHE A;  3WXF A;  2KR4 A;  4MZS A;  4CDF B;  2F6N A;  3KW9 A;  4OEL A;  2E02 A;  4PAD A;  2FSA A;  1Y08 A;  2QIC A;  2M3H A;  5AIU A;  5PAD A;  3K24 A;  5LKX A;  2WBF X;  1U9V A;  2L80 A;  1YVB A;  4N4Z A;  3PW3 A;  3LQI A;  2F1G A;  3O1G A;  3GL6 A;  1YT7 A;  4I7B A;  2Y43 A;  4I04 A;  1IYM A;  2H0D A;  4YYS A;  2CSZ A;  2QIZ A;  4QRV A;  4GNE A;  3RVX A;  3D9W A;  4CCG X;  2YW8 A;  4ZUX U;  3OF8 A;  1NQC A;  1QXP A;  2R9C A;  2MA6 A;  3KX1 A;  5FPW A;  3V6E A;  3MOR A;  4NV8 A;  4YVA A;  4YYU A;  5B78 A;  3HD3 A;  2YJ9 A;  2IDA A;  3O36 A;  1POP A;  4BS6 A;  2MNY A;  3O34 A;  4GUZ A;  2K1J A;  4IC3 A;  2XU3 A;  4YYV A;  5JH3 A;  3I2D A;  1FBV A;  3N9M A;  4XI1 A;  5EYA F;  2FUI A;  3U8E A;  4FO9 A;  2FO5 A;  2PBH A;  3WXG A;  4XR7 A;  1KHP A;  2JMI A;  3RPG B;  2AIM A;  2HXZ A;  4N79 A;  3S3R A;  4UP0 A;  4CZW A;  1DEU A;  2VPG A;  4KLB A;  2HDP A;  2KWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...