4FJCA

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
472
structure length
447
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 126
structure length 447
sequence length 472
chains with identical sequence E
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fjcA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fjcA02
1VJVA 3OVZA 4I05A 2DX8A 1POPA 1AYUA 2FUUA 2YJ9A 3N9MA 1WGMA 5PADA 1U9XA 2JMIA 3PHDA 3OISA 2DJGB 4YATA 1ZCMA 5J94A 3BC3A 5LCWB 2B1NA 2ECGA 3LQIA 9PAPA 2ZETC 4CDFB 4QRGA 2R9NA 1Z6UA 2XU1A 2JRJA 1NB5A 3LRQA 5LKZA 2FUIA 4PP2E 2FYEA 4N3WA 1GMYA 1PE6A 4BSQA 2YYRA 4A0CD 1HYIA 4X6HA 1PPDA 2YJCA 1V87A 3QSDA 2ECIA 2GHUA 2MUMA 2R9FA 5K16A 4C9ZA 3GCBA 5F02A 5TDWA 3KWBX 4LK9A 2FQ9A 1F2BA 5KH7A 2VJFB 4AXLA 2H0DA 2XB1A 1PPOA 4N8WA 2HHNA 2VHSA 3QJ3A 4XUIA 3AI8A 4L58A 1PBHA 2KWKA 3U5PA 4I04A 1PIPA 2YQMA 1NQCA 1U9WA 3CH3X 3KFQA 4BPVA 4Q8HA 3L11A 3N3GA 2K4DA 5FEYA 3D6SA 4AXMA 3O35A 4S3OB 4AYCA 2AN6A 2MT5A 2GFOA 2JQFR 4YBTA 4YAXA 3O37A 5I3LA 4FO9A 4QBBA 5LKUA 5CVOB 2M85A 1PPPA 5G05B 3E1ZB 3ASLA 1AU0A 3P5VA 3PDFA 3ZUAA 2G6DA 1MHWA 1WEVA 4A4BA 1F29A 1QOLA 4QRVA 3N3KA 5LKXA 2Y1NA 2P86A 2G43A 4GNFA 1JOCA 5G04B 4KLBA 3KWZA 6PADA 1EWMA 5DKAA 1MM3A 2CB5A 3O33A 3K24A 3KNVA 4YYWA 4RY2A 3N9OA 5AITA 2HH5A 5D1LB 1RMDA 2PNSA 3V6EA 4WA6A 1BP4A 2FSAA 1WILA 5DINA 5JH3A 3N9LA 4YABA 5H9MA 2FTDA 4DMXA 2VHFA 2CT2A 1CPJA 2JQGR 4CA1A 2XU4A 3BWKA 3P5WA 5H1TA 2DZYA 5EYAF 5TRBA 4FIPA 4CDCB 3ZTGA 2VPBA 2CKLA 4QF3A 3T7LA 2AUZA 4Q8GA 1FH0A 2DC7A 4LADB 2UZGA 1E4UA 1TU6A 3MORA 2VPEA 1DEUA 2E00A 4GNGA 3HTKC 4AUQB 2G8EA 3IMAA 2YW8A 1TLOA 4N79A 2G45A 4MSXA 5CVNB 1AU3A 2DCAA 2RSDA 3DQVR 1WENA 5C13A 2D8SA 2MNYA 4Q6FA 3N9NA 4YYVA 1N87A 3PURA 4W5CA 2BAYA 1KFUL 3MTNA 1LDJB 2LGLA 2O6XA 3ERVA 2L75A 2PUYA 4LJNA 4YC9A 2Y43A 1KXRA 4X6JA 2XU5A 5FERA 3HCUA 2ACTA 3L1XA 4IC3A 1ITOA 3P5UA 2ATOA 3OF8A 2K16A 3USVA 2FO5A 4CDEB 4O64A 1SP4B 2KGIA 4LLBA 2KWOA 1PCIA 4LKAA 1MM2A 3ZYQA 2Y6EA 2CIOA 3KV5A 5G0FA 2YREA 4W4UA 5KH9A 1WEUA 2H7JA 1U9VA 5B78A 3KQIA 1XWHA 4BS6A 5JG6A 1A6RA 3GV4A 4B7YC 4P5OB 3U5OA 5B8DA 1HUCB 3H8BA 4QRXA 2BDLA 2KIZA 3O36A 3PBHA 2DC6A 2NQDB 1YT7A 1U9QX 7PCKA 4V3LC 2EA6A 4YYUA 4CDDB 1JM7B 2VP7A 2YJ2A 4ZDTA 1CSBB 2QICA 2K1JA 2FT2A 4F52B 1WEPA 3MHSA 2Y5BA 2LGGA 3F75A 2YJBA 3IV2A 1M6DA 1WEWA 3KSEA 4UP0A 3ZVZB 3H89A 3C5KA 5J3XA 3U5MA 3OVXA 2XEUA 1WEQA 4GB0A 4UP5A 3WXEA 5D1KB 2ARYA 3KX1A 3C6WA 5FB1A 5H1VA 1ME4A 3RVVA 4YYRA 1ME3A 2LRIC 5AIUA 4W5BA 4WZ3B 4A4CA 2MA6A 2HDPA 1BQIA 2M1RA 2K17A 4YVAA 1XKGA 1MEGA 2NQGA 4BS5A 2YHNA 4A49A 1X9YA 3S3QA 4YYSA 2JMJA 1YK8A 2AS8A 3HWNA 2JMDA 2AVWA 1IYMA 2PNXA 2BDZA 2QJ0A 1WEOA 2AU1A 3O70A 3N9QA 1MEMA 1ICFA 1IWDA 2YUCA 1LDKC 5TBNA 3SOWA 2ECVA 5C11A 3I3TA 2YURA 1K2FA 1PPNA 1CQDA 3PNRA 4HWYA 2YHOA 2C2LA 1AYWA 5A24A 1Y4HA 3KW9A 3DPLR 3LXSA 1K3BB 3N9PA 5CHTA 3RPGC 2CSYA 3SHBA 1GLOA 1VFYA 1CB5A 5EF4A 2M3HA 4WZ0A 2E02A 2DCCA 3DF0A 2KYUA 1GECE 2LV9A 2H0DB 2C2VS 4R7EA 2L5UA 3MHHA 1Z60A 4PTBA 1NL6A 4XI1A 1EWPA 2F6JA 4QH6A 3M99A 2DCDA 2LDRA 2EODA 2L80A 5LKTA 3QT4A 4I7CA 2F6NA 1CTEA 2P7UA 3WXGA 4TKPB 4NN2A 4YBMA 4PI3A 4OEMA 3EB5A 3F5VA 1WFKA 4I7DA 1NPZA 4CZWA 2VPDA 2KR4A 2FUDA 3C9EA 1YVBA 2B1MA 2PADA 2KGGA 1KHQA 2E6SA 3O0UA 1MS6A 1JM7A 2KWNA 1DVPA 2EGPA 1YALA 2FRQA 4FK5A 2PREA 4QF2A 4K7CA 2NQIA 1O0EA 2OULA 2ECNA 4YV8A 2RI7A 1AU2A 3U5NA 1X4IA 2IDAA 4BQVA 2VNFA 2MNZA 2L0BA 1BY8A 2AIMA 3BCNA 1EF7A 1DF0A 2VJFA 3VK6A 2YU4A 1S4VA 3HD3A 2I50A 3M62A 4YBSA 1U6GB 2KWJA 2LGKA 1F2CA 2CKLB 1Q6KA 2G7YA 4G54A 3H8CA 2VJEB 2AYNA 2ECWA 1Z2QA 1F2AA 1VD4A 1T1HA 1GCBA 3EB6A 3I2DA 4MVTA 1PXVA 2P0RA 1CVZA 1Y08A 2DC8A 3O34A 1ATKA 4DMYA 3KKUA 3CBKA 3IHPA 3NHEA 4ZQLA 4I7BA 1AYVA 2HD5A 3IEJA 4X6IA 4GNDA 3HCTA 2HXZA 3NG2A 5FPWA 2LXHC 3KV6A 3WXFA 3V43A 3H7DA 3B79A 3IUTA 3ZVYA 1QMYA 2E6RA 5B76A 1U5IA 3O1GA 2OXQC 3RPGB 3P5XA 2NAAA 1QDQA 2AYOA 2DZZA 2R9MA 4YADA 5B77A 1WE9A 2G8JA 2OP3A 3HCSA 3L1ZB 4X3GA 4BHWA 3S3RA 3TNXA 3FL2A 1CHCA 2CSZA 3M63A 2PBHA 1BGOA 2IBIA 5H1UA 1WESA 3H6SA 3ZPV1 3PUQA 2E01A 2G6QA 3RTRB 2LN0A 5B75A 4AP4A 1HYJA 4FJCA 3I06A 4L7XA 4P6GA 4XR7A 4MZOA 3LFYA 2XU3A 4MZSA 3LQJA 2ECJA 4OELA 1X4JA 1WIMA 1BORA 3ZNIA 3SOUA 3HHIA 4BBQA 1JQPA 1TL9A 1QXPA 1AU4A 4CCGX 3BOWA 3PW3A 4IC2A 3SOXA 3BPFA 5TDRA 2LGVA 3RVXA 2M6MA 1NB3A 2R6NA 4R2YA 2LXPC 2F7DA 2IPPB 1NLJA 2KE1A 1WEMA 2R9OA 5FB0A 1FBVA 2ECTA 2MD8C 4PADA 3T6RA 3QZVA 2AUXA 1CV8A 2C0YA 3OF9A 3BPMA 2NQAA 2WBFX 2F42A 4AYCB 2E03A 2MIQA 2YT5A 2YSMA 1ZBDB 2L43A 4I07A 2R9CA 1FP0A 4S3OC 1KHPA 3K9MA 3N4CA 3V6CA 1KFXL 4AVXA 4UI9B 1G25A 1ZIVA 2VJEA 2OZ2A 1YK7A 5JA7A 5TABA 2DJFB 8PCHA 5B79A 4N4FA 4N4ZA 5EGWA 1VYXA 3GL6A 3CH2X 1CJLA 4GNEA 3O7AA 5CVMA 1SNKA 2YJ8A 2Y1MA 1F62A 3CBJA 3RVWA 2MA5A 1AECA 1MDWA 3ZPVE 2DCBA 2QIZA 1WEEA 2LQ6A 3LQHA 4V3KC 2YQLA 4PPEA 1MIRA 1X4UA 2VPGA 1EWOA 4B86C 4WZ2A 2FRAA 2MD7B 2DC9A 1EWLA 3U8EA 5D1MB 1VSNA 3HHAA 1THEA 2KFTA 5CHVA 2F1GA 2HYED 1PADA 1STFE 1AIMA 4P6EA 3IOQA 4ZUXU 2YSJA 3K8UA 5KH3A 2KREA 2KU3A 4PP1A 4R8PK 4YYQA 1CS8A
chains in the Genus database with same CATH superfamily
1VJVA 3OVZA 4I05A 2DX8A 1POPA 2DJAA 1AYUA 2EGMA 2FUUA 2YJ9A 3N9MA 1WGMA 5K3QA 5PADA 1U9XA 2JMIA 3PHDA 3OISA 2DJGB 4YATA 1ZCMA 5J94A 3PRMA 3BC3A 5LCWB 2B1NA 2ECGA 3LQIA 5SVIB 4ZTBA 9PAPA 2ZETC 4CDFB 4QRGA 2J7QA 2R9NA 1Z6UA 2XU1A 2JRJA 1NB5A 3LRQA 5LKZA 2OWAA 2FUIA 4RNAA 3BBAA 4PP2E 2FYEA 4N3WA 1GMYA 1PE6A 3ZNHA 4BSQA 2YYRA 4A0CD 1HYIA 4X6HA 1PPDA 2YJCA 1V87A 3O65A 3QSDA 2ECIA 2GHUA 2MUMA 2R9FA 5K16A 4C9ZA 3GCBA 5F02A 5TDWA 3KWBX 4LK9A 2JM3A 2FQ9A 2Z84A 1F2BA 5KH7A 2VJFB 4AXLA 2H0DA 2XB1A 1PPOA 4N8WA 2HHNA 2VHSA 3QJ3A 4XUIA 3AI8A 4L58A 1PBHA 2KWKA 3U5PA 4I04A 1PIPA 2YQMA 1NQCA 1U9WA 3CH3X 3KFQA 4BPVA 4Q8HA 3L11A 3N3GA 2K4DA 5FEYA 3D6SA 4AXMA 3O35A 4S3OB 4AYCA 2AN6A 2MT5A 2GFOA 2JQFR 4YBTA 3RNVA 4YAXA 3O37A 5I3LA 4FO9A 3IFUA 4QBBA 5LKUA 5CVOB 2M85A 1PPPA 5G05B 3E1ZB 3ASLA 1AU0A 2JTCA 3P5VA 3PDFA 3ZUAA 2G6DA 1MHWA 1WEVA 4A4BA 1F29A 1QOLA 4QRVA 3N3KA 5LKXA 2Y1NA 2P86A 2G43A 4GNFA 1JOCA 5G04B 4KLBA 3KWZA 4RKXA 1EWMA 6PADA 5DKAA 1MM3A 2CB5A 3O33A 3K24A 3KNVA 4YYWA 4RY2A 3N9OA 5AITA 2HH5A 5D1LB 1RMDA 2PNSA 3V6EA 4WA6A 1BP4A 2FSAA 2FD4A 1WILA 5DINA 5JH3A 3N9LA 4YABA 5H9MA 2FTDA 4DMXA 2VHFA 2CT2A 1CPJA 2JQGR 4CA1A 2XU4A 4BOSA 3BWKA 3P5WA 5H1TA 3MP2A 2DZYA 5EYAF 5TRBA 4FIPA 4CDCB 3ZTGA 2VPBA 2CKLA 4QF3A 3T7LA 2AUZA 4Q8GA 3DWDA 1FH0A 2DC7A 4LADB 2UZGA 1E4UA 1TU6A 4M0WA 3MORA 2VPEA 1DEUA 3Q1DA 2E00A 3TRKA 4GNGA 1DCQA 3HTKC 2DSMA 3FAOA 2YW8A 4AUQB 2G8EA 2J7QC 3IMAA 1TLOA 4N79A 2G45A 4MSXA 5CVNB 1AU3A 2DCAA 4OVZA 2RSDA 3DQVR 1WENA 5C13A 2M13A 2D8SA 2MKEA 2MNYA 4Q6FA 4RF0A 3N9NA 4YYVA 3FEHA 1N87A 3PURA 1PVJA 3LDYA 3PHXA 4REZA 4W5CA 2BAYA 1KFUL 3MTNA 1LDJB 2LGLA 5SVYA 2O6XA 3ERVA 2DOSA 2L75A 2PUYA 4LJNA 4YC9A 2Y43A 1KXRA 4X6JA 2XU5A 4BOZA 5FERA 3HCUA 2ACTA 3L1XA 4IC3A 1ITOA 3P5UA 2ATOA 2EXUA 2K16A 3OF8A 2FO5A 3USVA 2XP0A 4CDEB 4O64A 1SP4B 2KGIA 4LLBA 2KWOA 1PCIA 4LKAA 1MM2A 3ZYQA 2Y6EA 2CIOA 3KV5A 5G0FA 2YREA 4W4UA 5KH9A 1WEUA 2H7JA 2AGAA 1U9VA 5B78A 3KQIA 1XWHA 4BS6A 5JG6A 2JRIA 2BTWA 1A6RA 3GV4A 4B7YC 4P5OB 3U5OA 5B8DA 1HUCB 3H8BA 4QRXA 2BDLA 2KIZA 3O36A 3PBHA 2DC6A 2NQDB 1YT7A 3E9SA 1U9QX 7PCKA 4MM3B 4V3LC 2EA6A 4YYUA 4CDDB 4H9DA 4F1PA 1JM7B 3TMPA 2VP7A 2YJ2A 2CRWA 3E2DA 4ZDTA 1CSBB 2CSVA 2QICA 2K1JA 2FT2A 4F52B 1WEPA 2L7PA 3MHSA 2Y5BA 2LGGA 3F75A 2YJBA 4PT5A 3IV2A 1M6DA 1WEWA 3KSEA 4UP0A 3ZVZB 3H89A 3C5KA 5J3XA 3U5MA 4OGEA 3M7KA 3OVXA 2XEUA 4GB0A 1WEQA 4O62A 4UP5A 4GUAA 3WXEA 5D1KB 2ARYA 4D8BA 3PLWA 4R3DA 3KX1A 3C6WA 5FB1A 5H1VA 1ME4A 3RVVA 4YYRA 4IUMA 1ME3A 2LRIC 5AIUA 4W5BA 4WZ3B 4A4CA 2MA6A 2HDPA 1BQIA 2M1RA 2K17A 4BOPA 4YVAA 1XKGA 1MEGA 4Z0OA 2NQGA 4BS5A 2LAUA 2YHNA 4A49A 1X9YA 3S3QA 4YYSA 2YVRA 2JMJA 1YK8A 2AS8A 3HWNA 2JMDA 2AVWA 1IYMA 2PNXA 2BDZA 2QJ0A 1WEOA 2AU1A 3O70A 3N9QA 1MEMA 1ICFA 5EZQA 1IWDA 2YUCA 1LDKC 5TBNA 3SOWA 2ECVA 5C11A 3I3TA 2YURA 1K2FA 1PPNA 1CQDA 3PNRA 3PT2A 4HWYA 4XZXA 2YHOA 2C2LA 1AYWA 5A24A 1Y4HA 3KW9A 3DPLR 3LXSA 1K3BB 3N9PA 5CHTA 3RPGC 2CSYA 3SHBA 1GLOA 1VFYA 1CB5A 5EF4A 2M3HA 4WZ0A 2E02A 2DCCA 3DF0A 2KYUA 1GECE 2JUNA 2LV9A 1UKFA 2H0DB 3O47A 3FM8C 2C2VS 4R7EA 2L5UA 3MHHA 1Z60A 4PTBA 1NL6A 4XI1A 1EWPA 3FJUB 2F6JA 3BY4A 4QH6A 3M99A 2DCDA 3B21A 5JZEA 2LDRA 2EODA 4A5UA 2L80A 5LKTA 3QT4A 4I7CA 2F6NA 1CTEA 2P7UA 3WXGA 4TKPB 4NN2A 4YBMA 3BB7A 2XOYA 4PI3A 4OEMA 3EB5A 3F5VA 1WFKA 4I7DA 5SVIA 1NPZA 4CZWA 2VPDA 3W30A 2FE8A 2KR4A 2FUDA 3C9EA 1YVBA 2B1MA 2PADA 2KGGA 4WURA 1KHQA 2E6SA 3O0UA 1MS6A 1JM7A 2KWNA 1DVPA 2EGPA 1YALA 2FRQA 4FK5A 2PREA 4QF2A 3MJ5A 3PHWA 4K7CA 4BOUA 2NQIA 1O0EA 2OULA 2ECNA 4YV8A 2RI7A 1AU2A 3U5NA 1X4IA 2IDAA 4BQVA 2VNFA 3LVQE 2MNZA 2L0BA 1BY8A 2AIMA 3BCNA 1EF7A 1DF0A 3PHUA 4Z0RA 2VJFA 3VK6A 2YU4A 1S4VA 3HD3A 4HXDB 2I50A 3M62A 4YBSA 1U6GB 2KWJA 2LGKA 1F2CA 2CKLB 1Q6KA 2G7YA 2E61A 4G54A 3KDEC 3H8CA 2VJEB 3PRPA 2AYNA 2ECWA 1Z2QA 1F2AA 4IP3A 1VD4A 1T1HA 1GCBA 3EB6A 2CONA 3I2DA 4MVTA 1PXVA 2P0RA 1CVZA 2P57A 1Y08A 2DC8A 3O34A 1ATKA 4DMYA 3KKUA 3CBKA 4OVZB 3IHPA 3NHEA 4ZQLA 5KO3A 5EZSA 4I7BA 1AYVA 2HD5A 3IEJA 2D8UA 4X6IA 4GNDA 3HCTA 2HXZA 3NG2A 4OW0A 5FPWA 2LXHC 3KV6A 3WXFA 3V43A 3H7DA 3B79A 3IUTA 3ZVYA 1QMYA 2E6RA 2HWKA 5B76A 1U5IA 3O1GA 2OXQC 5E6JA 3RPGB 3P5XA 2NAAA 1QDQA 2AYOA 2DZZA 2R9MA 4YADA 5B77A 1WE9A 2G8JA 2OP3A 3HCSA 4MI7A 3L1ZB 4X3GA 4BHWA 3LJUX 3S3RA 3TNXA 4BOQA 3PSEA 3FL2A 3MTVA 1CHCA 2CSZA 3M63A 4P16A 2PBHA 4D8IA 1BGOA 2IBIA 5H1UA 1WESA 3H6SA 3ZPV1 3PUQA 2E01A 2G6QA 2CRRA 3RTRB 2LN0A 5B75A 4AP4A 1HYJA 4FJCA 2BTWB 4L7XA 3I06A 4P6GA 4XR7A 2XOCA 4MZOA 3LVRE 3LFYA 2XU3A 4MZSA 3LQJA 3JUEA 3H7HA 2ECJA 4OELA 2XOZA 1X4JA 1WIMA 1BORA 3ZNIA 3SOUA 3T9KA 3HHIA 3DDTA 4BBQA 1JQPA 1TL9A 1QXPA 1AU4A 4CCGX 3BOWA 3PW3A 4IC2A 3SOXA 3BPFA 5TDRA 1MBMA 2LGVA 3RVXA 2M6MA 2KKYA 1NB3A 2R6NA 4R2YA 2LXPC 2F7DA 2IPPB 1NLJA 2KE1A 1WEMA 2R9OA 5FB0A 1FBVA 2ECTA 2MD8C 3OQCA 3MDBC 3T6RA 4PADA 3QZVA 2AUXA 1CV8A 2C0YA 3OF9A 3BPMA 2NQAA 2WBFX 2F42A 4QQ4A 4AYCB 2E03A 2MIQA 2YT5A 2YSMA 1ZBDB 2L43A 1YZBA 3C0RA 2UZJA 2R9CA 4I07A 1FP0A 4S3OC 1KHPA 3K9MA 3N4CA 4OGCA 1KFXL 3V6CA 4AVXA 4UI9B 4D8EA 1G25A 1ZIVA 2VJEA 2OZ2A 1YK7A 5JA7A 5TABA 2DJFB 8PCHA 5B79A 4N4FA 4N4ZA 4RF1A 5EGWA 1VYXA 2RR4A 3GL6A 3CH2X 1CJLA 4GNEA 3O7AA 5CVMA 1SNKA 2YJ8A 2Y1MA 1F62A 3CBJA 3RVWA 3W31A 2MA5A 1AECA 1MDWA 2B0OE 2KKXA 3ZPVE 2DCBA 2QIZA 1WEEA 2LQ6A 3LQHA 4V3KC 2YQLA 4PPEA 1MIRA 1X4UA 2VPGA 1EWOA 4B86C 4WZ2A 2FRAA 2MD7B 2DC9A 1EWLA 3U8EA 5D1MB 1DKIA 1VSNA 3HHAA 1THEA 2KFTA 5CHVA 2F1GA 2HYED 5SVXA 3FANA 1PADA 1STFE 1AIMA 4P6EA 2BU3A 3IOQA 2FFWA 4ZUXU 2IQJA 2YSJA 3K8UA 5KH3A 3SUBA 2KREA 2KU3A 4PP1A 4R8PK 4YYQA 1CS8A
chains in the Genus database with same CATH topology
1VJVA 3OVZA 4I05A 2DX8A 1POPA 1AYUA 2FUUA 2YJ9A 3N9MA 1WGMA 5PADA 1U9XA 2JMIA 3PHDA 3OISA 2DJGB 4YATA 1ZCMA 5J94A 3BC3A 5LCWB 2B1NA 2ECGA 3LQIA 9PAPA 2ZETC 4CDFB 4QRGA 2R9NA 1Z6UA 2XU1A 2JRJA 1NB5A 3LRQA 5LKZA 2FUIA 4PP2E 2FYEA 4N3WA 1GMYA 1PE6A 4BSQA 2YYRA 4A0CD 1HYIA 4X6HA 1PPDA 4NV7A 2YJCA 1V87A 3QSDA 2ECIA 2GHUA 2MUMA 2R9FA 5K16A 4C9ZA 3GCBA 5F02A 5TDWA 3KWBX 4LK9A 2FQ9A 1F2BA 5KH7A 2VJFB 4AXLA 2H0DA 2XB1A 1PPOA 4N8WA 2HHNA 2VHSA 3QJ3A 4XUIA 3AI8A 4L58A 1PBHA 2KWKA 3U5PA 4I04A 1PIPA 2YQMA 1NQCA 1U9WA 3CH3X 3KFQA 4BPVA 4Q8HA 3L11A 3N3GA 2K4DA 5FEYA 3D6SA 4AXMA 3O35A 4S3OB 4AYCA 2AN6A 2MT5A 2GFOA 2JQFR 4YBTA 4YAXA 3O37A 5I3LA 4FO9A 4QBBA 5LKUA 5CVOB 2M85A 1PPPA 5G05B 3E1ZB 3ASLA 1AU0A 3P5VA 3PDFA 3ZUAA 2G6DA 1MHWA 1WEVA 4A4BA 1F29A 1QOLA 4QRVA 3N3KA 5LKXA 2Y1NA 2P86A 2G43A 4GNFA 1JOCA 5G04B 4KLBA 3KWZA 6PADA 1EWMA 5DKAA 1MM3A 2CB5A 3O33A 3K24A 3KNVA 4YYWA 4RY2A 3N9OA 5AITA 2HH5A 5D1LB 1RMDA 2PNSA 3V6EA 4WA6A 1BP4A 2FSAA 1WILA 5DINA 5JH3A 3N9LA 4BGFA 4YABA 5H9MA 2FTDA 4DMXA 2VHFA 2CT2A 1CPJA 2JQGR 4CA1A 2XU4A 3BWKA 3P5WA 5H1TA 2DZYA 5EYAF 5TRBA 4FIPA 4CDCB 3ZTGA 2VPBA 2CKLA 4QF3A 3T7LA 2AUZA 4Q8GA 1FH0A 2DC7A 4LADB 2UZGA 1E4UA 1TU6A 3MORA 2VPEA 1DEUA 2E00A 4GNGA 3HTKC 4AUQB 2G8EA 3IMAA 2YW8A 1TLOA 4N79A 2G45A 4MSXA 5CVNB 1AU3A 2DCAA 2RSDA 3DQVR 1WENA 5C13A 2D8SA 2MNYA 4Q6FA 3N9NA 4YYVA 1N87A 3PURA 4W5CA 2BAYA 1KFUL 3MTNA 1LDJB 2LGLA 2O6XA 3ERVA 2L75A 2PUYA 4LJNA 4YC9A 2Y43A 1KXRA 4X6JA 2XU5A 5FERA 3HCUA 2ACTA 3L1XA 4IC3A 1ITOA 3P5UA 2ATOA 3OF8A 2K16A 3D9WA 2FO5A 3USVA 4CDEB 4O64A 1SP4B 2KGIA 4LLBA 2KWOA 1PCIA 4LKAA 1MM2A 3ZYQA 2Y6EA 2CIOA 3KV5A 5G0FA 2YREA 4W4UA 5KH9A 1WEUA 2H7JA 1U9VA 5B78A 3KQIA 1XWHA 4BS6A 5JG6A 1A6RA 3GV4A 4B7YC 4P5OB 3U5OA 5B8DA 1HUCB 3H8BA 4QRXA 2BDLA 2KIZA 3O36A 3PBHA 2DC6A 2NQDB 1YT7A 1U9QX 7PCKA 4V3LC 2EA6A 4YYUA 4CDDB 1JM7B 2VP7A 2YJ2A 4ZDTA 1CSBB 1W4TA 2QICA 2K1JA 2FT2A 4F52B 1WEPA 3MHSA 2Y5BA 2LGGA 3F75A 2YJBA 3IV2A 1M6DA 1WEWA 1E2TA 3KSEA 4UP0A 3ZVZB 3H89A 3C5KA 5J3XA 3U5MA 3OVXA 2XEUA 1WEQA 4GB0A 4UP5A 3WXEA 5D1KB 2ARYA 3KX1A 3C6WA 5FB1A 5H1VA 1ME4A 3RVVA 4YYRA 1ME3A 2LRIC 5AIUA 4W5BA 4WZ3B 4A4CA 2MA6A 2HDPA 1BQIA 2M1RA 2K17A 4YVAA 1XKGA 1MEGA 2NQGA 4BS5A 2YHNA 4A49A 1X9YA 3S3QA 4YYSA 2JMJA 1YK8A 2AS8A 3HWNA 2JMDA 2AVWA 1IYMA 2PNXA 2BDZA 2QJ0A 1WEOA 2AU1A 3O70A 3N9QA 1MEMA 1ICFA 1IWDA 2YUCA 1LDKC 5TBNA 3SOWA 2ECVA 5C11A 3I3TA 2YURA 1K2FA 1PPNA 1CQDA 3PNRA 4HWYA 2YHOA 2C2LA 1AYWA 5A24A 1Y4HA 3KW9A 3DPLR 3LXSA 1K3BB 3N9PA 5CHTA 3RPGC 2CSYA 3SHBA 1GLOA 1VFYA 1CB5A 5EF4A 2M3HA 4WZ0A 2E02A 2DCCA 3DF0A 3LTWA 2KYUA 1GECE 2LV9A 4C5PA 2H0DB 2C2VS 4R7EA 2L5UA 3MHHA 1Z60A 4PTBA 1NL6A 4XI1A 1EWPA 2F6JA 4QH6A 3M99A 2DCDA 2LDRA 2EODA 4NV8A 2L80A 5LKTA 3QT4A 4I7CA 2F6NA 1CTEA 2P7UA 3WXGA 4TKPB 4NN2A 4YBMA 4PI3A 4OEMA 3EB5A 3F5VA 1WFKA 4I7DA 1NPZA 4CZWA 2VPDA 2KR4A 2FUDA 3C9EA 1YVBA 2B1MA 2PADA 2KGGA 1KHQA 2E6SA 3O0UA 1MS6A 1JM7A 2KWNA 1DVPA 2EGPA 1YALA 2FRQA 4FK5A 2PREA 4QF2A 1GX3A 1W5RA 4K7CA 2NQIA 1O0EA 2OULA 2ECNA 4YV8A 2RI7A 1AU2A 3U5NA 1X4IA 2IDAA 4BQVA 2VNFA 2MNZA 2VFCA 2L0BA 1BY8A 2AIMA 3BCNA 1EF7A 1DF0A 2VJFA 3VK6A 2YU4A 1S4VA 3HD3A 2I50A 3M62A 4YBSA 1U6GB 2KWJA 2LGKA 1F2CA 2CKLB 1Q6KA 2G7YA 4G54A 3H8CA 2VJEB 2AYNA 2ECWA 1Z2QA 1F2AA 1VD4A 1T1HA 1GCBA 3EB6A 3I2DA 4MVTA 1PXVA 2P0RA 1CVZA 1Y08A 2DC8A 3O34A 1ATKA 4DMYA 3KKUA 3CBKA 3IHPA 3NHEA 4ZQLA 4I7BA 1AYVA 2HD5A 3IEJA 4X6IA 4GNDA 3HCTA 2HXZA 3NG2A 5FPWA 2LXHC 3KV6A 3WXFA 3V43A 3H7DA 4B55A 3B79A 3IUTA 3ZVYA 1QMYA 2E6RA 2BSZA 5B76A 1U5IA 3O1GA 2OXQC 3RPGB 3P5XA 2NAAA 1QDQA 2AYOA 2DZZA 2R9MA 4YADA 5B77A 1WE9A 2G8JA 2OP3A 3HCSA 3L1ZB 4X3GA 4BHWA 3S3RA 3TNXA 3FL2A 1CHCA 2CSZA 3M63A 2PBHA 1BGOA 2IBIA 5H1UA 1WESA 3H6SA 3ZPV1 3PUQA 2E01A 2G6QA 3RTRB 2LN0A 5B75A 4AP4A 1HYJA 4FJCA 3I06A 4L7XA 4P6GA 4XR7A 4MZOA 3LFYA 2XU3A 4MZSA 3LQJA 2ECJA 4OELA 1X4JA 1WIMA 1BORA 3ZNIA 3SOUA 3HHIA 4BBQA 1JQPA 1TL9A 1QXPA 1AU4A 4CCGX 3BOWA 3PW3A 4IC2A 3SOXA 3BPFA 5TDRA 2LGVA 3RVXA 2M6MA 1NB3A 4GUZA 2R6NA 4R2YA 2LXPC 2F7DA 2IPPB 1NLJA 2KE1A 1WEMA 2R9OA 5FB0A 1FBVA 2ECTA 2MD8C 4PADA 3T6RA 3QZVA 2AUXA 1CV8A 2C0YA 2VFBA 3OF9A 3BPMA 2NQAA 2WBFX 2F42A 4AYCB 2E03A 2MIQA 2YT5A 2YSMA 1ZBDB 2L43A 4I07A 2R9CA 1FP0A 4S3OC 1KHPA 3K9MA 3N4CA 3V6CA 1KFXL 4AVXA 4UI9B 1G25A 1ZIVA 2VJEA 2OZ2A 1YK7A 5JA7A 5TABA 2DJFB 8PCHA 5B79A 4N4FA 4N4ZA 5EGWA 1VYXA 3GL6A 3CH2X 1CJLA 4GNEA 3O7AA 5CVMA 1SNKA 2YJ8A 2Y1MA 1F62A 3CBJA 3RVWA 2MA5A 1AECA 1MDWA 3ZPVE 2DCBA 2QIZA 1WEEA 2LQ6A 3LQHA 4V3KC 2YQLA 4PPEA 1MIRA 1X4UA 2VPGA 1EWOA 4B86C 1W6FA 4WZ2A 2FRAA 2MD7B 2DC9A 1EWLA 3U8EA 5D1MB 1VSNA 3HHAA 1THEA 2KFTA 5CHVA 2F1GA 2HYED 1PADA 1STFE 1AIMA 4P6EA 3IOQA 4ZUXU 2YSJA 3K8UA 5KH3A 2KREA 2KU3A 4PP1A 4R8PK 4YYQA 1CS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJV A;  3OVZ A;  4I05 A;  2DX8 A;  1POP A;  1AYU A;  2FUU A;  2YJ9 A;  3N9M A;  1WGM A;  5PAD A;  1U9X A;  2JMI A;  3PHD A;  3OIS A;  2DJG B;  4YAT A;  1ZCM A;  5J94 A;  3BC3 A;  5LCW B;  2B1N A;  2ECG A;  3LQI A;  9PAP A;  2ZET C;  4CDF B;  4QRG A;  2R9N A;  1Z6U A;  2XU1 A;  2JRJ A;  1NB5 A;  3LRQ A;  5LKZ A;  2FUI A;  4PP2 E;  2FYE A;  4N3W A;  1GMY A;  1PE6 A;  4BSQ A;  2YYR A;  4A0C D;  1HYI A;  4X6H A;  1PPD A;  2YJC A;  1V87 A;  3QSD A;  2ECI A;  2GHU A;  2MUM A;  2R9F A;  5K16 A;  4C9Z A;  3GCB A;  5F02 A;  5TDW A;  3KWB X;  4LK9 A;  2FQ9 A;  1F2B A;  5KH7 A;  2VJF B;  4AXL A;  2H0D A;  2XB1 A;  1PPO A;  4N8W A;  2HHN A;  2VHS A;  3QJ3 A;  4XUI A;  3AI8 A;  4L58 A;  1PBH A;  2KWK A;  3U5P A;  4I04 A;  1PIP A;  2YQM A;  1NQC A;  1U9W A;  3CH3 X;  3KFQ A;  4BPV A;  4Q8H A;  3L11 A;  3N3G A;  2K4D A;  5FEY A;  3D6S A;  4AXM A;  3O35 A;  4S3O B;  4AYC A;  2AN6 A;  2MT5 A;  2GFO A;  2JQF R;  4YBT A;  4YAX A;  3O37 A;  5I3L A;  4FO9 A;  4QBB A;  5LKU A;  5CVO B;  2M85 A;  1PPP A;  5G05 B;  3E1Z B;  3ASL A;  1AU0 A;  3P5V A;  3PDF A;  3ZUA A;  2G6D A;  1MHW A;  1WEV A;  4A4B A;  1F29 A;  1QOL A;  4QRV A;  3N3K A;  5LKX A;  2Y1N A;  2P86 A;  2G43 A;  4GNF A;  1JOC A;  5G04 B;  4KLB A;  3KWZ A;  6PAD A;  1EWM A;  5DKA A;  1MM3 A;  2CB5 A;  3O33 A;  3K24 A;  3KNV A;  4YYW A;  4RY2 A;  3N9O A;  5AIT A;  2HH5 A;  5D1L B;  1RMD A;  2PNS A;  3V6E A;  4WA6 A;  1BP4 A;  2FSA A;  1WIL A;  5DIN A;  5JH3 A;  3N9L A;  4YAB A;  5H9M A;  2FTD A;  4DMX A;  2VHF A;  2CT2 A;  1CPJ A;  2JQG R;  4CA1 A;  2XU4 A;  3BWK A;  3P5W A;  5H1T A;  2DZY A;  5EYA F;  5TRB A;  4FIP A;  4CDC B;  3ZTG A;  2VPB A;  2CKL A;  4QF3 A;  3T7L A;  2AUZ A;  4Q8G A;  1FH0 A;  2DC7 A;  4LAD B;  2UZG A;  1E4U A;  1TU6 A;  3MOR A;  2VPE A;  1DEU A;  2E00 A;  4GNG A;  3HTK C;  4AUQ B;  2G8E A;  3IMA A;  2YW8 A;  1TLO A;  4N79 A;  2G45 A;  4MSX A;  5CVN B;  1AU3 A;  2DCA A;  2RSD A;  3DQV R;  1WEN A;  5C13 A;  2D8S A;  2MNY A;  4Q6F A;  3N9N A;  4YYV A;  1N87 A;  3PUR A;  4W5C A;  2BAY A;  1KFU L;  3MTN A;  1LDJ B;  2LGL A;  2O6X A;  3ERV A;  2L75 A;  2PUY A;  4LJN A;  4YC9 A;  2Y43 A;  1KXR A;  4X6J A;  2XU5 A;  5FER A;  3HCU A;  2ACT A;  3L1X A;  4IC3 A;  1ITO A;  3P5U A;  2ATO A;  3OF8 A;  2K16 A;  3USV A;  2FO5 A;  4CDE B;  4O64 A;  1SP4 B;  2KGI A;  4LLB A;  2KWO A;  1PCI A;  4LKA A;  1MM2 A;  3ZYQ A;  2Y6E A;  2CIO A;  3KV5 A;  5G0F A;  2YRE A;  4W4U A;  5KH9 A;  1WEU A;  2H7J A;  1U9V A;  5B78 A;  3KQI A;  1XWH A;  4BS6 A;  5JG6 A;  1A6R A;  3GV4 A;  4B7Y C;  4P5O B;  3U5O A;  5B8D A;  1HUC B;  3H8B A;  4QRX A;  2BDL A;  2KIZ A;  3O36 A;  3PBH A;  2DC6 A;  2NQD B;  1YT7 A;  1U9Q X;  7PCK A;  4V3L C;  2EA6 A;  4YYU A;  4CDD B;  1JM7 B;  2VP7 A;  2YJ2 A;  4ZDT A;  1CSB B;  2QIC A;  2K1J A;  2FT2 A;  4F52 B;  1WEP A;  3MHS A;  2Y5B A;  2LGG A;  3F75 A;  2YJB A;  3IV2 A;  1M6D A;  1WEW A;  3KSE A;  4UP0 A;  3ZVZ B;  3H89 A;  3C5K A;  5J3X A;  3U5M A;  3OVX A;  2XEU A;  1WEQ A;  4GB0 A;  4UP5 A;  3WXE A;  5D1K B;  2ARY A;  3KX1 A;  3C6W A;  5FB1 A;  5H1V A;  1ME4 A;  3RVV A;  4YYR A;  1ME3 A;  2LRI C;  5AIU A;  4W5B A;  4WZ3 B;  4A4C A;  2MA6 A;  2HDP A;  1BQI A;  2M1R A;  2K17 A;  4YVA A;  1XKG A;  1MEG A;  2NQG A;  4BS5 A;  2YHN A;  4A49 A;  1X9Y A;  3S3Q A;  4YYS A;  2JMJ A;  1YK8 A;  2AS8 A;  3HWN A;  2JMD A;  2AVW A;  1IYM A;  2PNX A;  2BDZ A;  2QJ0 A;  1WEO A;  2AU1 A;  3O70 A;  3N9Q A;  1MEM A;  1ICF A;  1IWD A;  2YUC A;  1LDK C;  5TBN A;  3SOW A;  2ECV A;  5C11 A;  3I3T A;  2YUR A;  1K2F A;  1PPN A;  1CQD A;  3PNR A;  4HWY A;  2YHO A;  2C2L A;  1AYW A;  5A24 A;  1Y4H A;  3KW9 A;  3DPL R;  3LXS A;  1K3B B;  3N9P A;  5CHT A;  3RPG C;  2CSY A;  3SHB A;  1GLO A;  1VFY A;  1CB5 A;  5EF4 A;  2M3H A;  4WZ0 A;  2E02 A;  2DCC A;  3DF0 A;  2KYU A;  1GEC E;  2LV9 A;  2H0D B;  2C2V S;  4R7E A;  2L5U A;  3MHH A;  1Z60 A;  4PTB A;  1NL6 A;  4XI1 A;  1EWP A;  2F6J A;  4QH6 A;  3M99 A;  2DCD A;  2LDR A;  2EOD A;  2L80 A;  5LKT A;  3QT4 A;  4I7C A;  2F6N A;  1CTE A;  2P7U A;  3WXG A;  4TKP B;  4NN2 A;  4YBM A;  4PI3 A;  4OEM A;  3EB5 A;  3F5V A;  1WFK A;  4I7D A;  1NPZ A;  4CZW A;  2VPD A;  2KR4 A;  2FUD A;  3C9E A;  1YVB A;  2B1M A;  2PAD A;  2KGG A;  1KHQ A;  2E6S A;  3O0U A;  1MS6 A;  1JM7 A;  2KWN A;  1DVP A;  2EGP A;  1YAL A;  2FRQ A;  4FK5 A;  2PRE A;  4QF2 A;  4K7C A;  2NQI A;  1O0E A;  2OUL A;  2ECN A;  4YV8 A;  2RI7 A;  1AU2 A;  3U5N A;  1X4I A;  2IDA A;  4BQV A;  2VNF A;  2MNZ A;  2L0B A;  1BY8 A;  2AIM A;  3BCN A;  1EF7 A;  1DF0 A;  2VJF A;  3VK6 A;  2YU4 A;  1S4V A;  3HD3 A;  2I50 A;  3M62 A;  4YBS A;  1U6G B;  2KWJ A;  2LGK A;  1F2C A;  2CKL B;  1Q6K A;  2G7Y A;  4G54 A;  3H8C A;  2VJE B;  2AYN A;  2ECW A;  1Z2Q A;  1F2A A;  1VD4 A;  1T1H A;  1GCB A;  3EB6 A;  3I2D A;  4MVT A;  1PXV A;  2P0R A;  1CVZ A;  1Y08 A;  2DC8 A;  3O34 A;  1ATK A;  4DMY A;  3KKU A;  3CBK A;  3IHP A;  3NHE A;  4ZQL A;  4I7B A;  1AYV A;  2HD5 A;  3IEJ A;  4X6I A;  4GND A;  3HCT A;  2HXZ A;  3NG2 A;  5FPW A;  2LXH C;  3KV6 A;  3WXF A;  3V43 A;  3H7D A;  3B79 A;  3IUT A;  3ZVY A;  1QMY A;  2E6R A;  5B76 A;  1U5I A;  3O1G A;  2OXQ C;  3RPG B;  3P5X A;  2NAA A;  1QDQ A;  2AYO A;  2DZZ A;  2R9M A;  4YAD A;  5B77 A;  1WE9 A;  2G8J A;  2OP3 A;  3HCS A;  3L1Z B;  4X3G A;  4BHW A;  3S3R A;  3TNX A;  3FL2 A;  1CHC A;  2CSZ A;  3M63 A;  2PBH A;  1BGO A;  2IBI A;  5H1U A;  1WES A;  3H6S A;  3ZPV 1;  3PUQ A;  2E01 A;  2G6Q A;  3RTR B;  2LN0 A;  5B75 A;  4AP4 A;  1HYJ A;  4FJC A;  3I06 A;  4L7X A;  4P6G A;  4XR7 A;  4MZO A;  3LFY A;  2XU3 A;  4MZS A;  3LQJ A;  2ECJ A;  4OEL A;  1X4J A;  1WIM A;  1BOR A;  3ZNI A;  3SOU A;  3HHI A;  4BBQ A;  1JQP A;  1TL9 A;  1QXP A;  1AU4 A;  4CCG X;  3BOW A;  3PW3 A;  4IC2 A;  3SOX A;  3BPF A;  5TDR A;  2LGV A;  3RVX A;  2M6M A;  1NB3 A;  2R6N A;  4R2Y A;  2LXP C;  2F7D A;  2IPP B;  1NLJ A;  2KE1 A;  1WEM A;  2R9O A;  5FB0 A;  1FBV A;  2ECT A;  2MD8 C;  4PAD A;  3T6R A;  3QZV A;  2AUX A;  1CV8 A;  2C0Y A;  3OF9 A;  3BPM A;  2NQA A;  2WBF X;  2F42 A;  4AYC B;  2E03 A;  2MIQ A;  2YT5 A;  2YSM A;  1ZBD B;  2L43 A;  4I07 A;  2R9C A;  1FP0 A;  4S3O C;  1KHP A;  3K9M A;  3N4C A;  3V6C A;  1KFX L;  4AVX A;  4UI9 B;  1G25 A;  1ZIV A;  2VJE A;  2OZ2 A;  1YK7 A;  5JA7 A;  5TAB A;  2DJF B;  8PCH A;  5B79 A;  4N4F A;  4N4Z A;  5EGW A;  1VYX A;  3GL6 A;  3CH2 X;  1CJL A;  4GNE A;  3O7A A;  5CVM A;  1SNK A;  2YJ8 A;  2Y1M A;  1F62 A;  3CBJ A;  3RVW A;  2MA5 A;  1AEC A;  1MDW A;  3ZPV E;  2DCB A;  2QIZ A;  1WEE A;  2LQ6 A;  3LQH A;  4V3K C;  2YQL A;  4PPE A;  1MIR A;  1X4U A;  2VPG A;  1EWO A;  4B86 C;  4WZ2 A;  2FRA A;  2MD7 B;  2DC9 A;  1EWL A;  3U8E A;  5D1M B;  1VSN A;  3HHA A;  1THE A;  2KFT A;  5CHV A;  2F1G A;  2HYE D;  1PAD A;  1STF E;  1AIM A;  4P6E A;  3IOQ A;  4ZUX U;  2YSJ A;  3K8U A;  5KH3 A;  2KRE A;  2KU3 A;  4PP1 A;  4R8P K;  4YYQ A;  1CS8 A; 
#chains in the Genus database with same CATH topology
 1VJV A;  3OVZ A;  4I05 A;  2DX8 A;  1POP A;  2DJA A;  1AYU A;  2EGM A;  2FUU A;  2YJ9 A;  3N9M A;  1WGM A;  5K3Q A;  5PAD A;  1U9X A;  2JMI A;  3PHD A;  3OIS A;  2DJG B;  4YAT A;  1ZCM A;  5J94 A;  3PRM A;  3BC3 A;  5LCW B;  2B1N A;  2ECG A;  3LQI A;  5SVI B;  4ZTB A;  9PAP A;  2ZET C;  4CDF B;  4QRG A;  2J7Q A;  2R9N A;  1Z6U A;  2XU1 A;  2JRJ A;  1NB5 A;  3LRQ A;  5LKZ A;  2OWA A;  2FUI A;  4RNA A;  3BBA A;  4PP2 E;  2FYE A;  4N3W A;  1GMY A;  1PE6 A;  3ZNH A;  4BSQ A;  2YYR A;  4A0C D;  1HYI A;  4X6H A;  1PPD A;  2YJC A;  1V87 A;  3O65 A;  3QSD A;  2ECI A;  2GHU A;  2MUM A;  2R9F A;  5K16 A;  4C9Z A;  3GCB A;  5F02 A;  5TDW A;  3KWB X;  4LK9 A;  2JM3 A;  2FQ9 A;  2Z84 A;  1F2B A;  5KH7 A;  2VJF B;  4AXL A;  2H0D A;  2XB1 A;  1PPO A;  4N8W A;  2HHN A;  2VHS A;  3QJ3 A;  4XUI A;  3AI8 A;  4L58 A;  1PBH A;  2KWK A;  3U5P A;  4I04 A;  1PIP A;  2YQM A;  1NQC A;  1U9W A;  3CH3 X;  3KFQ A;  4BPV A;  4Q8H A;  3L11 A;  3N3G A;  2K4D A;  5FEY A;  3D6S A;  4AXM A;  3O35 A;  4S3O B;  4AYC A;  2AN6 A;  2MT5 A;  2GFO A;  2JQF R;  4YBT A;  3RNV A;  4YAX A;  3O37 A;  5I3L A;  4FO9 A;  3IFU A;  4QBB A;  5LKU A;  5CVO B;  2M85 A;  1PPP A;  5G05 B;  3E1Z B;  3ASL A;  1AU0 A;  2JTC A;  3P5V A;  3PDF A;  3ZUA A;  2G6D A;  1MHW A;  1WEV A;  4A4B A;  1F29 A;  1QOL A;  4QRV A;  3N3K A;  5LKX A;  2Y1N A;  2P86 A;  2G43 A;  4GNF A;  1JOC A;  5G04 B;  4KLB A;  3KWZ A;  4RKX A;  1EWM A;  6PAD A;  5DKA A;  1MM3 A;  2CB5 A;  3O33 A;  3K24 A;  3KNV A;  4YYW A;  4RY2 A;  3N9O A;  5AIT A;  2HH5 A;  5D1L B;  1RMD A;  2PNS A;  3V6E A;  4WA6 A;  1BP4 A;  2FSA A;  2FD4 A;  1WIL A;  5DIN A;  5JH3 A;  3N9L A;  4YAB A;  5H9M A;  2FTD A;  4DMX A;  2VHF A;  2CT2 A;  1CPJ A;  2JQG R;  4CA1 A;  2XU4 A;  4BOS A;  3BWK A;  3P5W A;  5H1T A;  3MP2 A;  2DZY A;  5EYA F;  5TRB A;  4FIP A;  4CDC B;  3ZTG A;  2VPB A;  2CKL A;  4QF3 A;  3T7L A;  2AUZ A;  4Q8G A;  3DWD A;  1FH0 A;  2DC7 A;  4LAD B;  2UZG A;  1E4U A;  1TU6 A;  4M0W A;  3MOR A;  2VPE A;  1DEU A;  3Q1D A;  2E00 A;  3TRK A;  4GNG A;  1DCQ A;  3HTK C;  2DSM A;  3FAO A;  2YW8 A;  4AUQ B;  2G8E A;  2J7Q C;  3IMA A;  1TLO A;  4N79 A;  2G45 A;  4MSX A;  5CVN B;  1AU3 A;  2DCA A;  4OVZ A;  2RSD A;  3DQV R;  1WEN A;  5C13 A;  2M13 A;  2D8S A;  2MKE A;  2MNY A;  4Q6F A;  4RF0 A;  3N9N A;  4YYV A;  3FEH A;  1N87 A;  3PUR A;  1PVJ A;  3LDY A;  3PHX A;  4REZ A;  4W5C A;  2BAY A;  1KFU L;  3MTN A;  1LDJ B;  2LGL A;  5SVY A;  2O6X A;  3ERV A;  2DOS A;  2L75 A;  2PUY A;  4LJN A;  4YC9 A;  2Y43 A;  1KXR A;  4X6J A;  2XU5 A;  4BOZ A;  5FER A;  3HCU A;  2ACT A;  3L1X A;  4IC3 A;  1ITO A;  3P5U A;  2ATO A;  2EXU A;  2K16 A;  3OF8 A;  2FO5 A;  3USV A;  2XP0 A;  4CDE B;  4O64 A;  1SP4 B;  2KGI A;  4LLB A;  2KWO A;  1PCI A;  4LKA A;  1MM2 A;  3ZYQ A;  2Y6E A;  2CIO A;  3KV5 A;  5G0F A;  2YRE A;  4W4U A;  5KH9 A;  1WEU A;  2H7J A;  2AGA A;  1U9V A;  5B78 A;  3KQI A;  1XWH A;  4BS6 A;  5JG6 A;  2JRI A;  2BTW A;  1A6R A;  3GV4 A;  4B7Y C;  4P5O B;  3U5O A;  5B8D A;  1HUC B;  3H8B A;  4QRX A;  2BDL A;  2KIZ A;  3O36 A;  3PBH A;  2DC6 A;  2NQD B;  1YT7 A;  3E9S A;  1U9Q X;  7PCK A;  4MM3 B;  4V3L C;  2EA6 A;  4YYU A;  4CDD B;  4H9D A;  4F1P A;  1JM7 B;  3TMP A;  2VP7 A;  2YJ2 A;  2CRW A;  3E2D A;  4ZDT A;  1CSB B;  2CSV A;  2QIC A;  2K1J A;  2FT2 A;  4F52 B;  1WEP A;  2L7P A;  3MHS A;  2Y5B A;  2LGG A;  3F75 A;  2YJB A;  4PT5 A;  3IV2 A;  1M6D A;  1WEW A;  3KSE A;  4UP0 A;  3ZVZ B;  3H89 A;  3C5K A;  5J3X A;  3U5M A;  4OGE A;  3M7K A;  3OVX A;  2XEU A;  4GB0 A;  1WEQ A;  4O62 A;  4UP5 A;  4GUA A;  3WXE A;  5D1K B;  2ARY A;  4D8B A;  3PLW A;  4R3D A;  3KX1 A;  3C6W A;  5FB1 A;  5H1V A;  1ME4 A;  3RVV A;  4YYR A;  4IUM A;  1ME3 A;  2LRI C;  5AIU A;  4W5B A;  4WZ3 B;  4A4C A;  2MA6 A;  2HDP A;  1BQI A;  2M1R A;  2K17 A;  4BOP A;  4YVA A;  1XKG A;  1MEG A;  4Z0O A;  2NQG A;  4BS5 A;  2LAU A;  2YHN A;  4A49 A;  1X9Y A;  3S3Q A;  4YYS A;  2YVR A;  2JMJ A;  1YK8 A;  2AS8 A;  3HWN A;  2JMD A;  2AVW A;  1IYM A;  2PNX A;  2BDZ A;  2QJ0 A;  1WEO A;  2AU1 A;  3O70 A;  3N9Q A;  1MEM A;  1ICF A;  5EZQ A;  1IWD A;  2YUC A;  1LDK C;  5TBN A;  3SOW A;  2ECV A;  5C11 A;  3I3T A;  2YUR A;  1K2F A;  1PPN A;  1CQD A;  3PNR A;  3PT2 A;  4HWY A;  4XZX A;  2YHO A;  2C2L A;  1AYW A;  5A24 A;  1Y4H A;  3KW9 A;  3DPL R;  3LXS A;  1K3B B;  3N9P A;  5CHT A;  3RPG C;  2CSY A;  3SHB A;  1GLO A;  1VFY A;  1CB5 A;  5EF4 A;  2M3H A;  4WZ0 A;  2E02 A;  2DCC A;  3DF0 A;  2KYU A;  1GEC E;  2JUN A;  2LV9 A;  1UKF A;  2H0D B;  3O47 A;  3FM8 C;  2C2V S;  4R7E A;  2L5U A;  3MHH A;  1Z60 A;  4PTB A;  1NL6 A;  4XI1 A;  1EWP A;  3FJU B;  2F6J A;  3BY4 A;  4QH6 A;  3M99 A;  2DCD A;  3B21 A;  5JZE A;  2LDR A;  2EOD A;  4A5U A;  2L80 A;  5LKT A;  3QT4 A;  4I7C A;  2F6N A;  1CTE A;  2P7U A;  3WXG A;  4TKP B;  4NN2 A;  4YBM A;  3BB7 A;  2XOY A;  4PI3 A;  4OEM A;  3EB5 A;  3F5V A;  1WFK A;  4I7D A;  5SVI A;  1NPZ A;  4CZW A;  2VPD A;  3W30 A;  2FE8 A;  2KR4 A;  2FUD A;  3C9E A;  1YVB A;  2B1M A;  2PAD A;  2KGG A;  4WUR A;  1KHQ A;  2E6S A;  3O0U A;  1MS6 A;  1JM7 A;  2KWN A;  1DVP A;  2EGP A;  1YAL A;  2FRQ A;  4FK5 A;  2PRE A;  4QF2 A;  3MJ5 A;  3PHW A;  4K7C A;  4BOU A;  2NQI A;  1O0E A;  2OUL A;  2ECN A;  4YV8 A;  2RI7 A;  1AU2 A;  3U5N A;  1X4I A;  2IDA A;  4BQV A;  2VNF A;  3LVQ E;  2MNZ A;  2L0B A;  1BY8 A;  2AIM A;  3BCN A;  1EF7 A;  1DF0 A;  3PHU A;  4Z0R A;  2VJF A;  3VK6 A;  2YU4 A;  1S4V A;  3HD3 A;  4HXD B;  2I50 A;  3M62 A;  4YBS A;  1U6G B;  2KWJ A;  2LGK A;  1F2C A;  2CKL B;  1Q6K A;  2G7Y A;  2E61 A;  4G54 A;  3KDE C;  3H8C A;  2VJE B;  3PRP A;  2AYN A;  2ECW A;  1Z2Q A;  1F2A A;  4IP3 A;  1VD4 A;  1T1H A;  1GCB A;  3EB6 A;  2CON A;  3I2D A;  4MVT A;  1PXV A;  2P0R A;  1CVZ A;  2P57 A;  1Y08 A;  2DC8 A;  3O34 A;  1ATK A;  4DMY A;  3KKU A;  3CBK A;  4OVZ B;  3IHP A;  3NHE A;  4ZQL A;  5KO3 A;  5EZS A;  4I7B A;  1AYV A;  2HD5 A;  3IEJ A;  2D8U A;  4X6I A;  4GND A;  3HCT A;  2HXZ A;  3NG2 A;  4OW0 A;  5FPW A;  2LXH C;  3KV6 A;  3WXF A;  3V43 A;  3H7D A;  3B79 A;  3IUT A;  3ZVY A;  1QMY A;  2E6R A;  2HWK A;  5B76 A;  1U5I A;  3O1G A;  2OXQ C;  5E6J A;  3RPG B;  3P5X A;  2NAA A;  1QDQ A;  2AYO A;  2DZZ A;  2R9M A;  4YAD A;  5B77 A;  1WE9 A;  2G8J A;  2OP3 A;  3HCS A;  4MI7 A;  3L1Z B;  4X3G A;  4BHW A;  3LJU X;  3S3R A;  3TNX A;  4BOQ A;  3PSE A;  3FL2 A;  3MTV A;  1CHC A;  2CSZ A;  3M63 A;  4P16 A;  2PBH A;  4D8I A;  1BGO A;  2IBI A;  5H1U A;  1WES A;  3H6S A;  3ZPV 1;  3PUQ A;  2E01 A;  2G6Q A;  2CRR A;  3RTR B;  2LN0 A;  5B75 A;  4AP4 A;  1HYJ A;  4FJC A;  2BTW B;  4L7X A;  3I06 A;  4P6G A;  4XR7 A;  2XOC A;  4MZO A;  3LVR E;  3LFY A;  2XU3 A;  4MZS A;  3LQJ A;  3JUE A;  3H7H A;  2ECJ A;  4OEL A;  2XOZ A;  1X4J A;  1WIM A;  1BOR A;  3ZNI A;  3SOU A;  3T9K A;  3HHI A;  3DDT A;  4BBQ A;  1JQP A;  1TL9 A;  1QXP A;  1AU4 A;  4CCG X;  3BOW A;  3PW3 A;  4IC2 A;  3SOX A;  3BPF A;  5TDR A;  1MBM A;  2LGV A;  3RVX A;  2M6M A;  2KKY A;  1NB3 A;  2R6N A;  4R2Y A;  2LXP C;  2F7D A;  2IPP B;  1NLJ A;  2KE1 A;  1WEM A;  2R9O A;  5FB0 A;  1FBV A;  2ECT A;  2MD8 C;  3OQC A;  3MDB C;  3T6R A;  4PAD A;  3QZV A;  2AUX A;  1CV8 A;  2C0Y A;  3OF9 A;  3BPM A;  2NQA A;  2WBF X;  2F42 A;  4QQ4 A;  4AYC B;  2E03 A;  2MIQ A;  2YT5 A;  2YSM A;  1ZBD B;  2L43 A;  1YZB A;  3C0R A;  2UZJ A;  2R9C A;  4I07 A;  1FP0 A;  4S3O C;  1KHP A;  3K9M A;  3N4C A;  4OGC A;  1KFX L;  3V6C A;  4AVX A;  4UI9 B;  4D8E A;  1G25 A;  1ZIV A;  2VJE A;  2OZ2 A;  1YK7 A;  5JA7 A;  5TAB A;  2DJF B;  8PCH A;  5B79 A;  4N4F A;  4N4Z A;  4RF1 A;  5EGW A;  1VYX A;  2RR4 A;  3GL6 A;  3CH2 X;  1CJL A;  4GNE A;  3O7A A;  5CVM A;  1SNK A;  2YJ8 A;  2Y1M A;  1F62 A;  3CBJ A;  3RVW A;  3W31 A;  2MA5 A;  1AEC A;  1MDW A;  2B0O E;  2KKX A;  3ZPV E;  2DCB A;  2QIZ A;  1WEE A;  2LQ6 A;  3LQH A;  4V3K C;  2YQL A;  4PPE A;  1MIR A;  1X4U A;  2VPG A;  1EWO A;  4B86 C;  4WZ2 A;  2FRA A;  2MD7 B;  2DC9 A;  1EWL A;  3U8E A;  5D1M B;  1DKI A;  1VSN A;  3HHA A;  1THE A;  2KFT A;  5CHV A;  2F1G A;  2HYE D;  5SVX A;  3FAN A;  1PAD A;  1STF E;  1AIM A;  4P6E A;  2BU3 A;  3IOQ A;  2FFW A;  4ZUX U;  2IQJ A;  2YSJ A;  3K8U A;  5KH3 A;  3SUB A;  2KRE A;  2KU3 A;  4PP1 A;  4R8P K;  4YYQ A;  1CS8 A; 
#chains in the Genus database with same CATH homology
 1VJV A;  3OVZ A;  4I05 A;  2DX8 A;  1POP A;  1AYU A;  2FUU A;  2YJ9 A;  3N9M A;  1WGM A;  5PAD A;  1U9X A;  2JMI A;  3PHD A;  3OIS A;  2DJG B;  4YAT A;  1ZCM A;  5J94 A;  3BC3 A;  5LCW B;  2B1N A;  2ECG A;  3LQI A;  9PAP A;  2ZET C;  4CDF B;  4QRG A;  2R9N A;  1Z6U A;  2XU1 A;  2JRJ A;  1NB5 A;  3LRQ A;  5LKZ A;  2FUI A;  4PP2 E;  2FYE A;  4N3W A;  1GMY A;  1PE6 A;  4BSQ A;  2YYR A;  4A0C D;  1HYI A;  4X6H A;  1PPD A;  4NV7 A;  2YJC A;  1V87 A;  3QSD A;  2ECI A;  2GHU A;  2MUM A;  2R9F A;  5K16 A;  4C9Z A;  3GCB A;  5F02 A;  5TDW A;  3KWB X;  4LK9 A;  2FQ9 A;  1F2B A;  5KH7 A;  2VJF B;  4AXL A;  2H0D A;  2XB1 A;  1PPO A;  4N8W A;  2HHN A;  2VHS A;  3QJ3 A;  4XUI A;  3AI8 A;  4L58 A;  1PBH A;  2KWK A;  3U5P A;  4I04 A;  1PIP A;  2YQM A;  1NQC A;  1U9W A;  3CH3 X;  3KFQ A;  4BPV A;  4Q8H A;  3L11 A;  3N3G A;  2K4D A;  5FEY A;  3D6S A;  4AXM A;  3O35 A;  4S3O B;  4AYC A;  2AN6 A;  2MT5 A;  2GFO A;  2JQF R;  4YBT A;  4YAX A;  3O37 A;  5I3L A;  4FO9 A;  4QBB A;  5LKU A;  5CVO B;  2M85 A;  1PPP A;  5G05 B;  3E1Z B;  3ASL A;  1AU0 A;  3P5V A;  3PDF A;  3ZUA A;  2G6D A;  1MHW A;  1WEV A;  4A4B A;  1F29 A;  1QOL A;  4QRV A;  3N3K A;  5LKX A;  2Y1N A;  2P86 A;  2G43 A;  4GNF A;  1JOC A;  5G04 B;  4KLB A;  3KWZ A;  6PAD A;  1EWM A;  5DKA A;  1MM3 A;  2CB5 A;  3O33 A;  3K24 A;  3KNV A;  4YYW A;  4RY2 A;  3N9O A;  5AIT A;  2HH5 A;  5D1L B;  1RMD A;  2PNS A;  3V6E A;  4WA6 A;  1BP4 A;  2FSA A;  1WIL A;  5DIN A;  5JH3 A;  3N9L A;  4BGF A;  4YAB A;  5H9M A;  2FTD A;  4DMX A;  2VHF A;  2CT2 A;  1CPJ A;  2JQG R;  4CA1 A;  2XU4 A;  3BWK A;  3P5W A;  5H1T A;  2DZY A;  5EYA F;  5TRB A;  4FIP A;  4CDC B;  3ZTG A;  2VPB A;  2CKL A;  4QF3 A;  3T7L A;  2AUZ A;  4Q8G A;  1FH0 A;  2DC7 A;  4LAD B;  2UZG A;  1E4U A;  1TU6 A;  3MOR A;  2VPE A;  1DEU A;  2E00 A;  4GNG A;  3HTK C;  4AUQ B;  2G8E A;  3IMA A;  2YW8 A;  1TLO A;  4N79 A;  2G45 A;  4MSX A;  5CVN B;  1AU3 A;  2DCA A;  2RSD A;  3DQV R;  1WEN A;  5C13 A;  2D8S A;  2MNY A;  4Q6F A;  3N9N A;  4YYV A;  1N87 A;  3PUR A;  4W5C A;  2BAY A;  1KFU L;  3MTN A;  1LDJ B;  2LGL A;  2O6X A;  3ERV A;  2L75 A;  2PUY A;  4LJN A;  4YC9 A;  2Y43 A;  1KXR A;  4X6J A;  2XU5 A;  5FER A;  3HCU A;  2ACT A;  3L1X A;  4IC3 A;  1ITO A;  3P5U A;  2ATO A;  3OF8 A;  2K16 A;  3D9W A;  2FO5 A;  3USV A;  4CDE B;  4O64 A;  1SP4 B;  2KGI A;  4LLB A;  2KWO A;  1PCI A;  4LKA A;  1MM2 A;  3ZYQ A;  2Y6E A;  2CIO A;  3KV5 A;  5G0F A;  2YRE A;  4W4U A;  5KH9 A;  1WEU A;  2H7J A;  1U9V A;  5B78 A;  3KQI A;  1XWH A;  4BS6 A;  5JG6 A;  1A6R A;  3GV4 A;  4B7Y C;  4P5O B;  3U5O A;  5B8D A;  1HUC B;  3H8B A;  4QRX A;  2BDL A;  2KIZ A;  3O36 A;  3PBH A;  2DC6 A;  2NQD B;  1YT7 A;  1U9Q X;  7PCK A;  4V3L C;  2EA6 A;  4YYU A;  4CDD B;  1JM7 B;  2VP7 A;  2YJ2 A;  4ZDT A;  1CSB B;  1W4T A;  2QIC A;  2K1J A;  2FT2 A;  4F52 B;  1WEP A;  3MHS A;  2Y5B A;  2LGG A;  3F75 A;  2YJB A;  3IV2 A;  1M6D A;  1WEW A;  1E2T A;  3KSE A;  4UP0 A;  3ZVZ B;  3H89 A;  3C5K A;  5J3X A;  3U5M A;  3OVX A;  2XEU A;  1WEQ A;  4GB0 A;  4UP5 A;  3WXE A;  5D1K B;  2ARY A;  3KX1 A;  3C6W A;  5FB1 A;  5H1V A;  1ME4 A;  3RVV A;  4YYR A;  1ME3 A;  2LRI C;  5AIU A;  4W5B A;  4WZ3 B;  4A4C A;  2MA6 A;  2HDP A;  1BQI A;  2M1R A;  2K17 A;  4YVA A;  1XKG A;  1MEG A;  2NQG A;  4BS5 A;  2YHN A;  4A49 A;  1X9Y A;  3S3Q A;  4YYS A;  2JMJ A;  1YK8 A;  2AS8 A;  3HWN A;  2JMD A;  2AVW A;  1IYM A;  2PNX A;  2BDZ A;  2QJ0 A;  1WEO A;  2AU1 A;  3O70 A;  3N9Q A;  1MEM A;  1ICF A;  1IWD A;  2YUC A;  1LDK C;  5TBN A;  3SOW A;  2ECV A;  5C11 A;  3I3T A;  2YUR A;  1K2F A;  1PPN A;  1CQD A;  3PNR A;  4HWY A;  2YHO A;  2C2L A;  1AYW A;  5A24 A;  1Y4H A;  3KW9 A;  3DPL R;  3LXS A;  1K3B B;  3N9P A;  5CHT A;  3RPG C;  2CSY A;  3SHB A;  1GLO A;  1VFY A;  1CB5 A;  5EF4 A;  2M3H A;  4WZ0 A;  2E02 A;  2DCC A;  3DF0 A;  3LTW A;  2KYU A;  1GEC E;  2LV9 A;  4C5P A;  2H0D B;  2C2V S;  4R7E A;  2L5U A;  3MHH A;  1Z60 A;  4PTB A;  1NL6 A;  4XI1 A;  1EWP A;  2F6J A;  4QH6 A;  3M99 A;  2DCD A;  2LDR A;  2EOD A;  4NV8 A;  2L80 A;  5LKT A;  3QT4 A;  4I7C A;  2F6N A;  1CTE A;  2P7U A;  3WXG A;  4TKP B;  4NN2 A;  4YBM A;  4PI3 A;  4OEM A;  3EB5 A;  3F5V A;  1WFK A;  4I7D A;  1NPZ A;  4CZW A;  2VPD A;  2KR4 A;  2FUD A;  3C9E A;  1YVB A;  2B1M A;  2PAD A;  2KGG A;  1KHQ A;  2E6S A;  3O0U A;  1MS6 A;  1JM7 A;  2KWN A;  1DVP A;  2EGP A;  1YAL A;  2FRQ A;  4FK5 A;  2PRE A;  4QF2 A;  1GX3 A;  1W5R A;  4K7C A;  2NQI A;  1O0E A;  2OUL A;  2ECN A;  4YV8 A;  2RI7 A;  1AU2 A;  3U5N A;  1X4I A;  2IDA A;  4BQV A;  2VNF A;  2MNZ A;  2VFC A;  2L0B A;  1BY8 A;  2AIM A;  3BCN A;  1EF7 A;  1DF0 A;  2VJF A;  3VK6 A;  2YU4 A;  1S4V A;  3HD3 A;  2I50 A;  3M62 A;  4YBS A;  1U6G B;  2KWJ A;  2LGK A;  1F2C A;  2CKL B;  1Q6K A;  2G7Y A;  4G54 A;  3H8C A;  2VJE B;  2AYN A;  2ECW A;  1Z2Q A;  1F2A A;  1VD4 A;  1T1H A;  1GCB A;  3EB6 A;  3I2D A;  4MVT A;  1PXV A;  2P0R A;  1CVZ A;  1Y08 A;  2DC8 A;  3O34 A;  1ATK A;  4DMY A;  3KKU A;  3CBK A;  3IHP A;  3NHE A;  4ZQL A;  4I7B A;  1AYV A;  2HD5 A;  3IEJ A;  4X6I A;  4GND A;  3HCT A;  2HXZ A;  3NG2 A;  5FPW A;  2LXH C;  3KV6 A;  3WXF A;  3V43 A;  3H7D A;  4B55 A;  3B79 A;  3IUT A;  3ZVY A;  1QMY A;  2E6R A;  2BSZ A;  5B76 A;  1U5I A;  3O1G A;  2OXQ C;  3RPG B;  3P5X A;  2NAA A;  1QDQ A;  2AYO A;  2DZZ A;  2R9M A;  4YAD A;  5B77 A;  1WE9 A;  2G8J A;  2OP3 A;  3HCS A;  3L1Z B;  4X3G A;  4BHW A;  3S3R A;  3TNX A;  3FL2 A;  1CHC A;  2CSZ A;  3M63 A;  2PBH A;  1BGO A;  2IBI A;  5H1U A;  1WES A;  3H6S A;  3ZPV 1;  3PUQ A;  2E01 A;  2G6Q A;  3RTR B;  2LN0 A;  5B75 A;  4AP4 A;  1HYJ A;  4FJC A;  3I06 A;  4L7X A;  4P6G A;  4XR7 A;  4MZO A;  3LFY A;  2XU3 A;  4MZS A;  3LQJ A;  2ECJ A;  4OEL A;  1X4J A;  1WIM A;  1BOR A;  3ZNI A;  3SOU A;  3HHI A;  4BBQ A;  1JQP A;  1TL9 A;  1QXP A;  1AU4 A;  4CCG X;  3BOW A;  3PW3 A;  4IC2 A;  3SOX A;  3BPF A;  5TDR A;  2LGV A;  3RVX A;  2M6M A;  1NB3 A;  4GUZ A;  2R6N A;  4R2Y A;  2LXP C;  2F7D A;  2IPP B;  1NLJ A;  2KE1 A;  1WEM A;  2R9O A;  5FB0 A;  1FBV A;  2ECT A;  2MD8 C;  4PAD A;  3T6R A;  3QZV A;  2AUX A;  1CV8 A;  2C0Y A;  2VFB A;  3OF9 A;  3BPM A;  2NQA A;  2WBF X;  2F42 A;  4AYC B;  2E03 A;  2MIQ A;  2YT5 A;  2YSM A;  1ZBD B;  2L43 A;  4I07 A;  2R9C A;  1FP0 A;  4S3O C;  1KHP A;  3K9M A;  3N4C A;  3V6C A;  1KFX L;  4AVX A;  4UI9 B;  1G25 A;  1ZIV A;  2VJE A;  2OZ2 A;  1YK7 A;  5JA7 A;  5TAB A;  2DJF B;  8PCH A;  5B79 A;  4N4F A;  4N4Z A;  5EGW A;  1VYX A;  3GL6 A;  3CH2 X;  1CJL A;  4GNE A;  3O7A A;  5CVM A;  1SNK A;  2YJ8 A;  2Y1M A;  1F62 A;  3CBJ A;  3RVW A;  2MA5 A;  1AEC A;  1MDW A;  3ZPV E;  2DCB A;  2QIZ A;  1WEE A;  2LQ6 A;  3LQH A;  4V3K C;  2YQL A;  4PPE A;  1MIR A;  1X4U A;  2VPG A;  1EWO A;  4B86 C;  1W6F A;  4WZ2 A;  2FRA A;  2MD7 B;  2DC9 A;  1EWL A;  3U8E A;  5D1M B;  1VSN A;  3HHA A;  1THE A;  2KFT A;  5CHV A;  2F1G A;  2HYE D;  1PAD A;  1STF E;  1AIM A;  4P6E A;  3IOQ A;  4ZUX U;  2YSJ A;  3K8U A;  5KH3 A;  2KRE A;  2KU3 A;  4PP1 A;  4R8P K;  4YYQ A;  1CS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...