4FJCA

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
472
structure length
447
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 126
structure length 447
sequence length 472
chains with identical sequence E
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fjcA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fjcA02
3MORA 1MM3A 3CH2X 5D1LB 2FUUA 2R9MA 2M1RA 2KWKA 3H8CA 2Y6EA 1Z6UA 4YABA 3QT4A 3ERVA 2FRAA 2XU4A 3RVVA 1CVZA 4YYQA 4CDDB 2F6NA 2BDZA 3L1ZB 2YYRA 2P86A 3N4CA 3EB5A 4YATA 4QF3A 1E4UA 4LJNA 1F62A 2I50A 4A0CD 4AXLA 2XEUA 1DEUA 2K16A 1V87A 2HYED 4AYCB 2KFTA 4IC2A 5CVOB 2BDLA 1MDWA 2O6XA 1WEOA 3PHDA 2OXQC 5LKTA 3BC3A 3NG2A 3ZPVE 2ACTA 2E6RA 2DC6A 3LQJA 2YT5A 3N9MA 2E01A 5JG6A 4PP2E 3KQIA 1XKGA 3HCTA 4KLBA 1NB3A 4XI1A 3C9EA 3IV2A 4ZUXU 3LRQA 4AYCA 2YURA 1WEUA 1ME4A 2FTDA 3WXGA 1FH0A 4P6GA 4AVXA 1LDJB 1NPZA 2AIMA 1YALA 1X4JA 2YREA 2MD8C 1PPDA 4CA1A 4I05A 4N79A 3LXSA 2ECJA 5F02A 2LV9A 3DF0A 1AIMA 4CDCB 2VPBA 2DC8A 2LXPC 1NL6A 5D1KB 4PP1A 2PREA 3K24A 5PADA 2ECGA 2YJ2A 2KGGA 2DC7A 1DVPA 1AU3A 5EF4A 2JMDA 3GCBA 1BQIA 3P5XA 3PURA 2L80A 3DPLR 3QJ3A 2KIZA 3RTRB 1ZBDB 2E00A 2C0YA 2DCAA 2PADA 2G45A 1VSNA 2FUIA 2VP7A 1Z60A 2NQAA 2VPDA 1MEMA 3O34A 4LKAA 2LRIC 2G6DA 3HCSA 4N4ZA 3LFYA 4C9ZA 4LADB 1THEA 1HUCB 4CZWA 2YQMA 3U5NA 3BPFA 3KX1A 3KW9A 1NB5A 2OZ2A 3SOXA 3ASLA 3O35A 4LK9A 2L75A 3N9NA 2Y43A 2WBFX 4OEMA 1U9VA 3M62A 2ECTA 3C5KA 3KV5A 2IPPB 1WIMA 3PDFA 1PIPA 2Y1MA 4UI9B 5B77A 4UP5A 4I04A 2MA5A 3IUTA 3O33A 2DCDA 2PNXA 2L0BA 3V43A 3HHIA 4RY2A 4AXMA 2XU3A 4WZ0A 3P5WA 3BCNA 3L11A 4PADA 2AYOA 4CDFB 2YHOA 2NAAA 4V3LC 4I7BA 3I2DA 2ECNA 2B1NA 3KFQA 5AIUA 2G8EA 1M6DA 3CH3X 4MZSA 2F1GA 5FEYA 2JMJA 1TLOA 2R9NA 4YYWA 1IYMA 1PPPA 2VHSA 4Q6FA 2YJCA 5TDRA 2P0RA 3MTNA 3V6EA 2MA6A 1A6RA 4UP0A 3BOWA 3MHHA 4YC9A 3S3RA 1KFXL 2FO5A 2KE1A 3P5VA 3V6CA 1AECA 4P6EA 2F6JA 4BS6A 4V3KC 2YHNA 3IMAA 1JM7B 4R2YA 4GNEA 4F52B 3N3KA 1DF0A 3N9PA 3ZNIA 5FPWA 1SP4B 3QZVA 5H1UA 4G54A 1CTEA 1PCIA 4S3OC 3LQHA 5KH3A 2YJ8A 4X6IA 1MIRA 2LGLA 6PADA 2E03A 5B76A 3IOQA 5EGWA 1BP4A 2KWNA 5A24A 3FL2A 4N8WA 3IEJA 4DMYA 3KWZA 4BBQA 2FYEA 2DZYA 1TU6A 4XUIA 5TABA 2QIZA 1F29A 1WFKA 2HHNA 1IWDA 1GECE 4MZOA 4L7XA 1K2FA 4BHWA 2KYUA 3PUQA 3O36A 3M99A 5TRBA 2LN0A 1VD4A 1XWHA 3OVZA 4YBMA 1ICFA 1U9XA 4CCGX 1X9YA 2CSZA 4AUQB 3ZTGA 4LLBA 1RMDA 2VHFA 4QH6A 3S3QA 1KHQA 1POPA 4IC3A 2K17A 2AYNA 3KKUA 2Y1NA 3SHBA 5I3LA 1BY8A 2ATOA 2JQFR 2XU1A 5B8DA 4R8PK 2MIQA 1AYWA 3N9OA 1NLJA 4XR7A 4X6HA 1U9QX 4GNFA 3O1GA 3KV6A 4BS5A 3F5VA 2VJEB 2K1JA 3BWKA 1CHCA 3O37A 1CV8A 1U5IA 4NN2A 3RPGC 1O0EA 5CVNB 1U9WA 1AYUA 2MUMA 4YAXA 1YVBA 2IDAA 4GB0A 2G43A 3DQVR 3WXFA 2LDRA 1QDQA 2QJ0A 4YVAA 4L58A 1CJLA 2CB5A 5CHVA 4BQVA 4YYVA 2EODA 2PUYA 5KH7A 1FBVA 2OP3A 4QRVA 5G0FA 3OF8A 4FK5A 4YYUA 2R9FA 2AVWA 2BAYA 3K9MA 3PBHA 2LGGA 9PAPA 2XU5A 2EGPA 1N87A 4A4BA 3H89A 1AU0A 2B1MA 3N3GA 3KNVA 5DKAA 3HD3A 1KXRA 3L1XA 1FP0A 2YW8A 5G05B 2F7DA 2D8SA 1MEGA 4QBBA 5FERA 2NQGA 2HD5A 1F2BA 1S4VA 1AU4A 2IBIA 1JM7A 2CT2A 5H1VA 2H7JA 2PNSA 1CS8A 1WEWA 1CQDA 2VPEA 1WEMA 1PPNA 2JMIA 3M63A 1Y4HA 4P5OB 4WA6A 2KGIA 1CB5A 2DJGB 1EWMA 5AITA 3B79A 4Q8HA 5D1MB 1PXVA 2R9OA 5JA7A 4BSQA 1VJVA 3HTKC 4MVTA 3D6SA 4AP4A 5B78A 2KWJA 2EA6A 2L43A 3USVA 3H7DA 3AI8A 1VFYA 1G25A 1WESA 1EWPA 3EB6A 2RI7A 2FQ9A 2H0DB 2VJEA 1WEVA 3OF9A 4R7EA 1TL9A 4WZ3B 4MSXA 3C6WA 2HDPA 5B75A 1CPJA 2CKLA 1GMYA 4A49A 4ZQLA 3HWNA 3LQIA 1WENA 1GLOA 1Y08A 3ZYQA 4B7YC 1JOCA 5H1TA 1MHWA 1K3BB 2XB1A 2M3HA 5FB1A 1PBHA 2NQIA 3KSEA 2KR4A 1JQPA 2AN6A 2LXHC 5LKUA 4HWYA 2H0DA 3PNRA 2KWOA 2G8JA 1ME3A 2YJ9A 2ECVA 4Q8GA 1WEQA 4FO9A 4I7CA 4O64A 1F2AA 2DJFB 3H6SA 1WILA 5CHTA 2ZETC 2YQLA 1CSBB 2R6NA 5K16A 4BPVA 4X6JA 3RVXA 2DZZA 1LDKC 3ZVYA 2MNZA 4OELA 4YYRA 4FIPA 2OULA 2YUCA 4S3OB 1EWLA 3U5PA 1EWOA 1Q6KA 4N4FA 3F75A 2M85A 4W4UA 2KREA 5LKZA 3VK6A 3RPGB 1QMYA 3T6RA 2AS8A 2AUZA 1STFE 3H8BA 2VPGA 4PI3A 2PBHA 2MD7B 4A4CA 2C2VS 4B86C 1NQCA 3N9LA 3RVWA 4QRGA 2AUXA 3CBKA 1X4UA 2ARYA 3TNXA 2F42A 2NQDB 3T7LA 5C11A 2JQGR 4N3WA 3QSDA 2HXZA 2VJFA 1QXPA 3NHEA 2DC9A 4W5BA 2ECIA 1PE6A 2LGVA 1VYXA 2DX8A 2YSMA 1YK7A 3U5MA 4PPEA 1MS6A 3OISA 2FRQA 2G6QA 2MNYA 2RSDA 4K7CA 4GNGA 1ZIVA 2K4DA 1WEPA 1HYJA 1WGMA 1SNKA 3ZUAA 1KHPA 5TDWA 5KH9A 1U6GB 5J94A 3HCUA 8PCHA 2HH5A 3O70A 2R9CA 2YSJA 1YK8A 3O0UA 1BORA 1F2CA 2CKLB 4YADA 2FUDA 3U8EA 1Z2QA 1AYVA 1WE9A 1WEEA 1GCBA 4WZ2A 4DMXA 2CIOA 5LCWB 1PADA 1T1HA 2P7UA 2DCCA 2M6MA 2KU3A 4I7DA 5JH3A 4TKPB 4X3GA 3U5OA 2LGKA 4QRXA 2FT2A 4ZDTA 2G7YA 4I07A 2VJFB 4PTBA 5C13A 3E1ZB 2YU4A 1YT7A 1BGOA 2Y5BA 3P5UA 2FSAA 3I06A 1X4IA 2YJBA 3SOUA 3I3TA 4FJCA 2L5UA 3K8UA 1PPOA 3WXEA 4GNDA 1HYIA 1ATKA 2AU1A 4QF2A 1AU2A 1MM2A 4YBSA 3CBJA 5J3XA 2CSYA 3PW3A 3ZPV1 5G04B 1ZCMA 4YV8A 2E6SA 3O7AA 1KFUL 3IHPA 3GL6A 2E02A 2ECWA 5B79A 2VNFA 5H9MA 3SOWA 3MHSA 3BPMA 2DCBA 3OVXA 5EYAF 4W5CA 2LQ6A 4YYSA 4CDEB 2GFOA 5DINA 1EF7A 3HHAA 2JRJA 1ITOA 2UZGA 2C2LA 3GV4A 4YBTA 2GHUA 5LKXA 3ZVZB 5FB0A 3N9QA 2QICA 5TBNA 3KWBX 7PCKA 1QOLA 2MT5A 5CVMA
chains in the Genus database with same CATH superfamily
3MORA 1MM3A 3CH2X 5D1LB 2FUUA 1DKIA 2R9MA 4R3DA 2M1RA 2KWKA 3H8CA 2Y6EA 1Z6UA 4YABA 3QT4A 3ERVA 2FRAA 2XU4A 3RVVA 1CVZA 4YYQA 4CDDB 2F6NA 2XOZA 2BDZA 3L1ZB 2YYRA 1DCQA 2P86A 3EB5A 4YATA 3N4CA 4ZTBA 4QF3A 1E4UA 4LJNA 1F62A 2I50A 4A0CD 4AXLA 2XEUA 1DEUA 2K16A 1PVJA 1V87A 2HYED 4AYCB 2KFTA 4IC2A 5CVOB 2BDLA 1MDWA 3MP2A 2O6XA 1WEOA 3PHDA 2OXQC 5LKTA 3BC3A 3NG2A 3ZPVE 2ACTA 3PHXA 2E6RA 5SVIA 2DC6A 3LQJA 2YT5A 3ZNHA 3N9MA 2E01A 5JG6A 4PP2E 3KQIA 1XKGA 3HCTA 4KLBA 1NB3A 3FANA 4XI1A 2DOSA 3C9EA 3IV2A 4ZUXU 3LRQA 4AYCA 2YURA 1WEUA 1ME4A 2FTDA 3WXGA 1FH0A 4P6GA 5KO3A 4AVXA 1LDJB 1NPZA 2AIMA 1YALA 1X4JA 2YREA 2MD8C 1PPDA 3BY4A 4CA1A 4I05A 4N79A 2OWAA 3LXSA 4BOZA 2ECJA 5F02A 5E6JA 4GUAA 2LV9A 3DF0A 1AIMA 2BU3A 4CDCB 2VPBA 2DC8A 2LXPC 1NL6A 5D1KB 4PP1A 2PREA 3K24A 5PADA 2ECGA 2YJ2A 2KGGA 2DC7A 1DVPA 1AU3A 5EF4A 3W31A 2JMDA 3GCBA 1BQIA 3P5XA 3PURA 2L80A 3DPLR 3QJ3A 2KIZA 3RTRB 1ZBDB 2E00A 2C0YA 2DCAA 2J7QA 2PADA 3OQCA 2G45A 1VSNA 2FUIA 4OW0A 3DDTA 2VP7A 1Z60A 4BOUA 2NQAA 2VPDA 1MEMA 1UKFA 3O34A 2KKXA 4LKAA 3PRMA 2LRIC 4RNAA 2G6DA 3HCSA 4N4ZA 3LFYA 4C9ZA 4LADB 1THEA 1HUCB 4CZWA 2YQMA 3U5NA 3BPFA 3KX1A 3KW9A 1NB5A 2OZ2A 3ASLA 4LK9A 3O35A 3SOXA 2L75A 3N9NA 2Y43A 2WBFX 4OEMA 1U9VA 3M62A 2ECTA 3C5KA 3KV5A 2IPPB 1WIMA 3PDFA 1PIPA 2Y1MA 4UI9B 5B77A 4UP5A 4I04A 2MA5A 3IUTA 3T9KA 3O33A 3FM8C 2DCDA 2PNXA 2L0BA 3V43A 3HHIA 4RY2A 4AXMA 4BOQA 3M7KA 2XU3A 4WZ0A 3P5WA 3BCNA 3L11A 4PADA 2AYOA 3PHWA 4CDFB 2YHOA 2NAAA 4V3LC 4I7BA 3I2DA 2ECNA 2B1NA 3KFQA 5AIUA 1MBMA 2G8EA 1M6DA 3CH3X 4MZSA 2F1GA 4IUMA 5FEYA 2JMJA 1TLOA 2R9NA 4P16A 3MJ5A 4YYWA 1YZBA 4RKXA 1IYMA 1PPPA 2VHSA 4Q6FA 2YJCA 5TDRA 2P0RA 3MTNA 3V6EA 2MA6A 1A6RA 3W30A 4UP0A 3BOWA 3MHHA 4YC9A 3S3RA 1KFXL 2FO5A 2KE1A 3P5VA 3V6CA 1AECA 4P6EA 2F6JA 4BS6A 4V3KC 2YHNA 3IMAA 1JM7B 4R2YA 4GNEA 4F52B 3N3KA 1DF0A 3N9PA 3ZNIA 5FPWA 1SP4B 3QZVA 5H1UA 2CRRA 1CTEA 1PCIA 4S3OC 4G54A 3LQHA 5KH3A 3Q1DA 2YJ8A 4X6IA 5EZSA 1MIRA 2LGLA 6PADA 2E03A 5B76A 3IOQA 5EGWA 1BP4A 2KWNA 2EGMA 5A24A 3FL2A 4N8WA 3IEJA 4DMYA 3KWZA 4BBQA 2FYEA 3JUEA 2L7PA 3SUBA 2DSMA 1TU6A 2DZYA 4XUIA 5TABA 2QIZA 1F29A 1WFKA 2HHNA 4OGEA 1IWDA 1GECE 4MZOA 4L7XA 1K2FA 4BHWA 2KYUA 3PUQA 3O36A 3M99A 5TRBA 2LN0A 1VD4A 2XOCA 1XWHA 3OVZA 4YBMA 1ICFA 1U9XA 4CCGX 1X9YA 2CSZA 4AUQB 3ZTGA 4LLBA 2CONA 1RMDA 2VHFA 4QH6A 3S3QA 1KHQA 1POPA 4IC3A 2K17A 2AYNA 3KKUA 2Y1NA 3SHBA 5I3LA 1BY8A 2FE8A 2ATOA 2JQFR 2XU1A 5B8DA 4R8PK 2MIQA 1AYWA 3N9OA 2HWKA 1NLJA 4XR7A 4X6HA 1U9QX 4GNFA 3O1GA 3KV6A 4F1PA 4BS5A 3F5VA 2VJEB 2K1JA 3BWKA 4Z0RA 1CHCA 3O37A 1CV8A 1U5IA 4NN2A 3RPGC 1O0EA 5CVNB 1U9WA 1AYUA 2MUMA 4MM3B 4YAXA 1YVBA 4D8BA 2IDAA 4GB0A 3BB7A 2G43A 3DQVR 3WXFA 2LDRA 1QDQA 2P57A 2QJ0A 4YVAA 3C0RA 4L58A 1CJLA 2CB5A 5CHVA 4BQVA 4YYVA 4QQ4A 2EODA 2PUYA 5KH7A 1FBVA 2OP3A 4QRVA 5G0FA 3OF8A 4FK5A 4YYUA 2R9FA 2AVWA 2BAYA 3K9MA 3PBHA 2LGGA 5SVXA 9PAPA 2XU5A 2EGPA 1N87A 4A4BA 3H89A 1AU0A 4Z0OA 2B1MA 3N3GA 2XP0A 3KNVA 5DKAA 3HD3A 1KXRA 3L1XA 1FP0A 2YW8A 5G05B 2F7DA 2D8SA 1MEGA 4QBBA 5FERA 2NQGA 2HD5A 1F2BA 1S4VA 1AU4A 2IBIA 2DJAA 1JM7A 2CT2A 5H1VA 2H7JA 3H7HA 2PNSA 1CS8A 2Z84A 1WEWA 3LVQE 2VPEA 1CQDA 1WEMA 2FD4A 1PPNA 2JMIA 3M63A 1Y4HA 4P5OB 4WA6A 2KGIA 1CB5A 2DJGB 1EWMA 5AITA 5SVYA 3B79A 5D1MB 4Q8HA 3O47A 1PXVA 2JTCA 2R9OA 5JA7A 4BSQA 1VJVA 3HTKC 4MVTA 3D6SA 4AP4A 5B78A 2KWJA 2EA6A 2L43A 4WURA 3H7DA 3AI8A 3O65A 1VFYA 1G25A 3USVA 1WESA 1EWPA 3EB6A 2RI7A 2FQ9A 2H0DB 2VJEA 1WEVA 3OF9A 4R7EA 1TL9A 4OGCA 4WZ3B 5JZEA 2MKEA 2LAUA 4MSXA 3C6WA 2HDPA 5B75A 1CPJA 2CKLA 3PT2A 1GMYA 4A49A 4ZQLA 2BTWA 3HWNA 3LQIA 1WENA 1GLOA 1Y08A 3ZYQA 4B7YC 1JOCA 5H1TA 1MHWA 1K3BB 2XB1A 2M3HA 5FB1A 1PBHA 2NQIA 3KSEA 2KR4A 1JQPA 2AN6A 2LXHC 5LKUA 4HWYA 3BBAA 2H0DA 3PNRA 4RF1A 2KWOA 2IQJA 4H9DA 2G8JA 1ME3A 2YJ9A 2ECVA 4Q8GA 1WEQA 3MDBC 4FO9A 4I7CA 4O64A 3E2DA 1F2AA 3MTVA 3FJUB 5EZQA 2DJFB 3H6SA 1WILA 3FEHA 4PT5A 5CHTA 3TMPA 5K3QA 2ZETC 2YQLA 4XZXA 1CSBB 2R6NA 5K16A 4BPVA 2M13A 4X6JA 3RVXA 2DZZA 4OVZA 1LDKC 3ZVYA 2MNZA 4OELA 2CSVA 4YYRA 4IP3A 2KKYA 4FIPA 2J7QC 2OULA 2YUCA 4S3OB 1EWLA 3U5PA 1EWOA 3LDYA 1Q6KA 4N4FA 3F75A 2M85A 4W4UA 2KREA 5LKZA 3TRKA 3VK6A 3RPGB 1QMYA 3T6RA 2AS8A 2AUZA 1STFE 3H8BA 2VPGA 4PI3A 2PBHA 2MD7B 2C2VS 4A4CA 4B86C 1NQCA 3N9LA 3RVWA 4QRGA 2AUXA 4MI7A 3CBKA 3IFUA 1X4UA 2ARYA 3TNXA 2F42A 2NQDB 3T7LA 5C11A 4BOSA 2JQGR 4N3WA 3QSDA 2HXZA 2VJFA 4HXDB 1QXPA 3NHEA 3LJUX 2DC9A 4W5BA 2ECIA 1PE6A 4O62A 4M0WA 2LGVA 1VYXA 2DX8A 2UZJA 3B21A 2YSMA 1YK7A 3U5MA 4PPEA 2YVRA 4A5UA 2JRIA 3PHUA 1MS6A 3OISA 2FRQA 2G6QA 2MNYA 2RSDA 4K7CA 4GNGA 1ZIVA 2K4DA 1WEPA 1HYJA 1WGMA 1SNKA 3PRPA 3ZUAA 1KHPA 5TDWA 5KH9A 1U6GB 5J94A 3HCUA 3DWDA 8PCHA 2HH5A 4RF0A 2D8UA 3O70A 2R9CA 4OVZB 2RR4A 2YSJA 1YK8A 3O0UA 1BORA 4D8IA 1F2CA 2CKLB 4YADA 2FUDA 3U8EA 1Z2QA 1AYVA 1WE9A 3RNVA 1WEEA 1GCBA 4WZ2A 4DMXA 2CIOA 5LCWB 1PADA 1T1HA 2P7UA 2DCCA 2M6MA 2FFWA 2KU3A 4I7DA 4REZA 5JH3A 4TKPB 4X3GA 3U5OA 2LGKA 4QRXA 2FT2A 4BOPA 2E61A 4ZDTA 2G7YA 4I07A 3PSEA 2VJFB 4PTBA 5C13A 3E1ZB 2YU4A 2JUNA 1YT7A 1BGOA 2Y5BA 3P5UA 2EXUA 2FSAA 3I06A 1X4IA 2YJBA 3SOUA 3I3TA 4FJCA 2L5UA 3K8UA 1PPOA 3WXEA 3LVRE 4GNDA 1HYIA 1ATKA 2AU1A 4QF2A 1AU2A 1MM2A 4YBSA 3CBJA 3PLWA 5J3XA 2CSYA 3PW3A 3ZPV1 5SVIB 5G04B 1ZCMA 4D8EA 4YV8A 2CRWA 2E6SA 2JM3A 3O7AA 1KFUL 3IHPA 3GL6A 2AGAA 2BTWB 2E02A 2ECWA 5B79A 2VNFA 2XOYA 5H9MA 3SOWA 3FAOA 3MHSA 3BPMA 2DCBA 3OVXA 5EYAF 4W5CA 2LQ6A 4YYSA 4CDEB 2GFOA 3E9SA 5DINA 1EF7A 3HHAA 2JRJA 1ITOA 2UZGA 2C2LA 3GV4A 4YBTA 2GHUA 5LKXA 3ZVZB 5FB0A 3N9QA 2QICA 5TBNA 2B0OE 3KWBX 1QOLA 7PCKA 3KDEC 2MT5A 5CVMA
chains in the Genus database with same CATH topology
3MORA 1MM3A 3CH2X 5D1LB 2FUUA 2R9MA 2M1RA 2KWKA 3H8CA 2Y6EA 1Z6UA 4YABA 3QT4A 3ERVA 2FRAA 2XU4A 3RVVA 1CVZA 4YYQA 4CDDB 2F6NA 2BDZA 3L1ZB 2YYRA 2P86A 3N4CA 3EB5A 4YATA 4QF3A 1E4UA 4LJNA 1F62A 2I50A 4A0CD 4AXLA 2XEUA 1DEUA 2K16A 1V87A 2HYED 4AYCB 2KFTA 4IC2A 5CVOB 2BDLA 1MDWA 2O6XA 1WEOA 3PHDA 2OXQC 5LKTA 3BC3A 3NG2A 3ZPVE 2ACTA 2E6RA 2DC6A 3LQJA 2YT5A 3N9MA 2E01A 5JG6A 4PP2E 3KQIA 1XKGA 3HCTA 4KLBA 1NB3A 4XI1A 3C9EA 3IV2A 4ZUXU 3LRQA 4AYCA 2YURA 1WEUA 1ME4A 2FTDA 3WXGA 1FH0A 4P6GA 4AVXA 1LDJB 1NPZA 2AIMA 1YALA 1X4JA 2YREA 2MD8C 1PPDA 4CA1A 4I05A 4N79A 3LXSA 2ECJA 5F02A 2LV9A 3DF0A 1AIMA 4CDCB 2VPBA 2DC8A 2LXPC 1NL6A 5D1KB 4PP1A 2PREA 3K24A 5PADA 2ECGA 2YJ2A 2KGGA 2DC7A 1DVPA 1AU3A 1E2TA 5EF4A 2JMDA 3GCBA 1BQIA 3P5XA 3PURA 2L80A 3DPLR 3QJ3A 2KIZA 3RTRB 1ZBDB 2E00A 2C0YA 2DCAA 2PADA 2G45A 1VSNA 2FUIA 2VP7A 1Z60A 2NQAA 2VPDA 1MEMA 3O34A 4LKAA 2LRIC 2G6DA 3HCSA 4N4ZA 3LFYA 4C9ZA 4LADB 1THEA 1HUCB 4BGFA 4CZWA 2YQMA 3U5NA 3BPFA 3KX1A 3KW9A 1NB5A 2OZ2A 3SOXA 3ASLA 3O35A 4LK9A 2L75A 3N9NA 2Y43A 2WBFX 4OEMA 1U9VA 3M62A 2ECTA 3C5KA 3KV5A 2IPPB 1WIMA 3PDFA 1PIPA 2Y1MA 4UI9B 5B77A 4UP5A 4I04A 2MA5A 3IUTA 3O33A 1W4TA 2DCDA 2PNXA 2L0BA 3V43A 3HHIA 4RY2A 4AXMA 2XU3A 4WZ0A 3P5WA 3BCNA 3L11A 4PADA 2AYOA 4CDFB 2YHOA 2NAAA 4V3LC 4I7BA 3I2DA 2ECNA 2B1NA 3KFQA 5AIUA 2G8EA 1M6DA 3CH3X 4MZSA 2F1GA 5FEYA 2JMJA 1TLOA 2R9NA 4YYWA 1IYMA 1PPPA 2VHSA 4Q6FA 2YJCA 5TDRA 4B55A 2P0RA 3MTNA 3V6EA 2MA6A 1A6RA 4UP0A 3BOWA 3MHHA 4YC9A 3S3RA 1KFXL 2FO5A 2KE1A 3P5VA 3V6CA 1AECA 4P6EA 2F6JA 4BS6A 4V3KC 2YHNA 3IMAA 1JM7B 4R2YA 4GNEA 4F52B 3N3KA 1DF0A 3N9PA 3ZNIA 5FPWA 1SP4B 3QZVA 5H1UA 4G54A 1CTEA 1PCIA 4S3OC 3LQHA 5KH3A 2YJ8A 4X6IA 1MIRA 2LGLA 6PADA 2E03A 5B76A 3IOQA 5EGWA 1BP4A 2KWNA 5A24A 3FL2A 4N8WA 3IEJA 4DMYA 3KWZA 4BBQA 2FYEA 2DZYA 1TU6A 4XUIA 5TABA 2QIZA 1F29A 1WFKA 2HHNA 1IWDA 3D9WA 1GECE 4GUZA 4MZOA 4L7XA 1K2FA 4BHWA 2KYUA 3PUQA 3O36A 3M99A 5TRBA 2LN0A 1VD4A 1XWHA 3OVZA 4YBMA 1ICFA 1U9XA 4CCGX 1X9YA 2CSZA 4AUQB 3ZTGA 4LLBA 1RMDA 2VHFA 4QH6A 3S3QA 1KHQA 1POPA 4IC3A 2K17A 2AYNA 3KKUA 2Y1NA 3SHBA 5I3LA 1BY8A 2ATOA 2JQFR 2XU1A 5B8DA 4R8PK 2MIQA 1AYWA 3N9OA 1NLJA 4XR7A 4X6HA 1U9QX 4GNFA 3O1GA 3KV6A 4BS5A 3F5VA 2VJEB 2K1JA 3BWKA 1CHCA 3O37A 1CV8A 1U5IA 4NN2A 3RPGC 1O0EA 5CVNB 1U9WA 1AYUA 2MUMA 4YAXA 1YVBA 2IDAA 4GB0A 2G43A 3DQVR 3WXFA 2LDRA 1QDQA 2QJ0A 4YVAA 4L58A 1CJLA 2CB5A 5CHVA 4BQVA 4YYVA 2EODA 2PUYA 5KH7A 1FBVA 2OP3A 4QRVA 5G0FA 3OF8A 4FK5A 4YYUA 2R9FA 2AVWA 2BAYA 3K9MA 3PBHA 2LGGA 9PAPA 2XU5A 2EGPA 1N87A 4A4BA 3H89A 1AU0A 2B1MA 3N3GA 3KNVA 5DKAA 3HD3A 1KXRA 3L1XA 1FP0A 2YW8A 5G05B 2F7DA 2D8SA 1MEGA 4QBBA 5FERA 2NQGA 2HD5A 1F2BA 1S4VA 1AU4A 2IBIA 1JM7A 2CT2A 5H1VA 2H7JA 2PNSA 1CS8A 1WEWA 1CQDA 2VPEA 1WEMA 1PPNA 2JMIA 3M63A 1Y4HA 4P5OB 4WA6A 2KGIA 1CB5A 2DJGB 1EWMA 5AITA 3B79A 4Q8HA 5D1MB 1PXVA 2R9OA 5JA7A 4BSQA 1VJVA 3HTKC 4MVTA 3D6SA 4AP4A 5B78A 2KWJA 2EA6A 2L43A 3USVA 3H7DA 3AI8A 1VFYA 1G25A 1WESA 1EWPA 3EB6A 2RI7A 2FQ9A 2H0DB 2VJEA 4NV8A 1WEVA 3OF9A 4R7EA 1TL9A 4WZ3B 4MSXA 3C6WA 2HDPA 1W5RA 5B75A 4NV7A 1CPJA 2CKLA 1GMYA 4A49A 4ZQLA 3HWNA 3LQIA 1WENA 1GLOA 1Y08A 3ZYQA 4B7YC 1JOCA 5H1TA 1MHWA 1K3BB 2XB1A 2M3HA 5FB1A 1PBHA 2NQIA 3KSEA 1W6FA 2KR4A 1JQPA 2AN6A 2LXHC 5LKUA 4HWYA 2H0DA 3PNRA 2KWOA 2G8JA 1ME3A 2YJ9A 2ECVA 4Q8GA 1WEQA 4FO9A 4I7CA 4O64A 1F2AA 2DJFB 3H6SA 1WILA 5CHTA 2ZETC 2YQLA 1CSBB 2R6NA 2VFCA 5K16A 4BPVA 4X6JA 3RVXA 2DZZA 1LDKC 3ZVYA 2MNZA 4OELA 4YYRA 4FIPA 2OULA 2YUCA 4S3OB 1EWLA 3U5PA 1EWOA 1Q6KA 4N4FA 3F75A 2M85A 4W4UA 2KREA 5LKZA 3VK6A 3RPGB 1QMYA 3T6RA 2AS8A 2AUZA 1GX3A 1STFE 3H8BA 2VPGA 4PI3A 2PBHA 2MD7B 4A4CA 2C2VS 4B86C 1NQCA 3N9LA 3RVWA 4QRGA 2AUXA 3CBKA 1X4UA 2ARYA 3TNXA 2F42A 2NQDB 3T7LA 5C11A 2JQGR 4N3WA 3QSDA 2HXZA 2VJFA 1QXPA 3NHEA 3LTWA 2DC9A 4W5BA 2ECIA 1PE6A 2LGVA 1VYXA 2DX8A 4C5PA 2YSMA 1YK7A 3U5MA 4PPEA 1MS6A 3OISA 2FRQA 2G6QA 2MNYA 2RSDA 4K7CA 4GNGA 1ZIVA 2K4DA 1WEPA 1HYJA 1WGMA 1SNKA 3ZUAA 1KHPA 5TDWA 5KH9A 1U6GB 5J94A 3HCUA 8PCHA 2HH5A 3O70A 2R9CA 2YSJA 1YK8A 3O0UA 1BORA 1F2CA 2CKLB 4YADA 2FUDA 3U8EA 1Z2QA 1AYVA 1WE9A 1WEEA 1GCBA 4WZ2A 4DMXA 2CIOA 5LCWB 1PADA 1T1HA 2P7UA 2DCCA 2M6MA 2KU3A 4I7DA 5JH3A 4TKPB 4X3GA 3U5OA 2VFBA 2LGKA 4QRXA 2FT2A 4ZDTA 2G7YA 4I07A 2VJFB 4PTBA 5C13A 3E1ZB 2YU4A 1YT7A 1BGOA 2Y5BA 3P5UA 2FSAA 3I06A 1X4IA 2YJBA 3SOUA 3I3TA 2BSZA 4FJCA 2L5UA 3K8UA 1PPOA 3WXEA 4GNDA 1HYIA 1ATKA 2AU1A 4QF2A 1AU2A 1MM2A 4YBSA 3CBJA 5J3XA 2CSYA 3PW3A 3ZPV1 5G04B 1ZCMA 4YV8A 2E6SA 3O7AA 1KFUL 3IHPA 3GL6A 2E02A 2ECWA 5B79A 2VNFA 5H9MA 3SOWA 3MHSA 3BPMA 2DCBA 3OVXA 5EYAF 4W5CA 2LQ6A 4YYSA 4CDEB 2GFOA 5DINA 1EF7A 3HHAA 2JRJA 1ITOA 2UZGA 2C2LA 3GV4A 4YBTA 2GHUA 5LKXA 3ZVZB 5FB0A 3N9QA 2QICA 5TBNA 3KWBX 7PCKA 1QOLA 2MT5A 5CVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MOR A;  1MM3 A;  3CH2 X;  5D1L B;  2FUU A;  2R9M A;  2M1R A;  2KWK A;  3H8C A;  2Y6E A;  1Z6U A;  4YAB A;  3QT4 A;  3ERV A;  2FRA A;  2XU4 A;  3RVV A;  1CVZ A;  4YYQ A;  4CDD B;  2F6N A;  2BDZ A;  3L1Z B;  2YYR A;  2P86 A;  3N4C A;  3EB5 A;  4YAT A;  4QF3 A;  1E4U A;  4LJN A;  1F62 A;  2I50 A;  4A0C D;  4AXL A;  2XEU A;  1DEU A;  2K16 A;  1V87 A;  2HYE D;  4AYC B;  2KFT A;  4IC2 A;  5CVO B;  2BDL A;  1MDW A;  2O6X A;  1WEO A;  3PHD A;  2OXQ C;  5LKT A;  3BC3 A;  3NG2 A;  3ZPV E;  2ACT A;  2E6R A;  2DC6 A;  3LQJ A;  2YT5 A;  3N9M A;  2E01 A;  5JG6 A;  4PP2 E;  3KQI A;  1XKG A;  3HCT A;  4KLB A;  1NB3 A;  4XI1 A;  3C9E A;  3IV2 A;  4ZUX U;  3LRQ A;  4AYC A;  2YUR A;  1WEU A;  1ME4 A;  2FTD A;  3WXG A;  1FH0 A;  4P6G A;  4AVX A;  1LDJ B;  1NPZ A;  2AIM A;  1YAL A;  1X4J A;  2YRE A;  2MD8 C;  1PPD A;  4CA1 A;  4I05 A;  4N79 A;  3LXS A;  2ECJ A;  5F02 A;  2LV9 A;  3DF0 A;  1AIM A;  4CDC B;  2VPB A;  2DC8 A;  2LXP C;  1NL6 A;  5D1K B;  4PP1 A;  2PRE A;  3K24 A;  5PAD A;  2ECG A;  2YJ2 A;  2KGG A;  2DC7 A;  1DVP A;  1AU3 A;  5EF4 A;  2JMD A;  3GCB A;  1BQI A;  3P5X A;  3PUR A;  2L80 A;  3DPL R;  3QJ3 A;  2KIZ A;  3RTR B;  1ZBD B;  2E00 A;  2C0Y A;  2DCA A;  2PAD A;  2G45 A;  1VSN A;  2FUI A;  2VP7 A;  1Z60 A;  2NQA A;  2VPD A;  1MEM A;  3O34 A;  4LKA A;  2LRI C;  2G6D A;  3HCS A;  4N4Z A;  3LFY A;  4C9Z A;  4LAD B;  1THE A;  1HUC B;  4CZW A;  2YQM A;  3U5N A;  3BPF A;  3KX1 A;  3KW9 A;  1NB5 A;  2OZ2 A;  3SOX A;  3ASL A;  3O35 A;  4LK9 A;  2L75 A;  3N9N A;  2Y43 A;  2WBF X;  4OEM A;  1U9V A;  3M62 A;  2ECT A;  3C5K A;  3KV5 A;  2IPP B;  1WIM A;  3PDF A;  1PIP A;  2Y1M A;  4UI9 B;  5B77 A;  4UP5 A;  4I04 A;  2MA5 A;  3IUT A;  3O33 A;  2DCD A;  2PNX A;  2L0B A;  3V43 A;  3HHI A;  4RY2 A;  4AXM A;  2XU3 A;  4WZ0 A;  3P5W A;  3BCN A;  3L11 A;  4PAD A;  2AYO A;  4CDF B;  2YHO A;  2NAA A;  4V3L C;  4I7B A;  3I2D A;  2ECN A;  2B1N A;  3KFQ A;  5AIU A;  2G8E A;  1M6D A;  3CH3 X;  4MZS A;  2F1G A;  5FEY A;  2JMJ A;  1TLO A;  2R9N A;  4YYW A;  1IYM A;  1PPP A;  2VHS A;  4Q6F A;  2YJC A;  5TDR A;  2P0R A;  3MTN A;  3V6E A;  2MA6 A;  1A6R A;  4UP0 A;  3BOW A;  3MHH A;  4YC9 A;  3S3R A;  1KFX L;  2FO5 A;  2KE1 A;  3P5V A;  3V6C A;  1AEC A;  4P6E A;  2F6J A;  4BS6 A;  4V3K C;  2YHN A;  3IMA A;  1JM7 B;  4R2Y A;  4GNE A;  4F52 B;  3N3K A;  1DF0 A;  3N9P A;  3ZNI A;  5FPW A;  1SP4 B;  3QZV A;  5H1U A;  4G54 A;  1CTE A;  1PCI A;  4S3O C;  3LQH A;  5KH3 A;  2YJ8 A;  4X6I A;  1MIR A;  2LGL A;  6PAD A;  2E03 A;  5B76 A;  3IOQ A;  5EGW A;  1BP4 A;  2KWN A;  5A24 A;  3FL2 A;  4N8W A;  3IEJ A;  4DMY A;  3KWZ A;  4BBQ A;  2FYE A;  2DZY A;  1TU6 A;  4XUI A;  5TAB A;  2QIZ A;  1F29 A;  1WFK A;  2HHN A;  1IWD A;  1GEC E;  4MZO A;  4L7X A;  1K2F A;  4BHW A;  2KYU A;  3PUQ A;  3O36 A;  3M99 A;  5TRB A;  2LN0 A;  1VD4 A;  1XWH A;  3OVZ A;  4YBM A;  1ICF A;  1U9X A;  4CCG X;  1X9Y A;  2CSZ A;  4AUQ B;  3ZTG A;  4LLB A;  1RMD A;  2VHF A;  4QH6 A;  3S3Q A;  1KHQ A;  1POP A;  4IC3 A;  2K17 A;  2AYN A;  3KKU A;  2Y1N A;  3SHB A;  5I3L A;  1BY8 A;  2ATO A;  2JQF R;  2XU1 A;  5B8D A;  4R8P K;  2MIQ A;  1AYW A;  3N9O A;  1NLJ A;  4XR7 A;  4X6H A;  1U9Q X;  4GNF A;  3O1G A;  3KV6 A;  4BS5 A;  3F5V A;  2VJE B;  2K1J A;  3BWK A;  1CHC A;  3O37 A;  1CV8 A;  1U5I A;  4NN2 A;  3RPG C;  1O0E A;  5CVN B;  1U9W A;  1AYU A;  2MUM A;  4YAX A;  1YVB A;  2IDA A;  4GB0 A;  2G43 A;  3DQV R;  3WXF A;  2LDR A;  1QDQ A;  2QJ0 A;  4YVA A;  4L58 A;  1CJL A;  2CB5 A;  5CHV A;  4BQV A;  4YYV A;  2EOD A;  2PUY A;  5KH7 A;  1FBV A;  2OP3 A;  4QRV A;  5G0F A;  3OF8 A;  4FK5 A;  4YYU A;  2R9F A;  2AVW A;  2BAY A;  3K9M A;  3PBH A;  2LGG A;  9PAP A;  2XU5 A;  2EGP A;  1N87 A;  4A4B A;  3H89 A;  1AU0 A;  2B1M A;  3N3G A;  3KNV A;  5DKA A;  3HD3 A;  1KXR A;  3L1X A;  1FP0 A;  2YW8 A;  5G05 B;  2F7D A;  2D8S A;  1MEG A;  4QBB A;  5FER A;  2NQG A;  2HD5 A;  1F2B A;  1S4V A;  1AU4 A;  2IBI A;  1JM7 A;  2CT2 A;  5H1V A;  2H7J A;  2PNS A;  1CS8 A;  1WEW A;  1CQD A;  2VPE A;  1WEM A;  1PPN A;  2JMI A;  3M63 A;  1Y4H A;  4P5O B;  4WA6 A;  2KGI A;  1CB5 A;  2DJG B;  1EWM A;  5AIT A;  3B79 A;  4Q8H A;  5D1M B;  1PXV A;  2R9O A;  5JA7 A;  4BSQ A;  1VJV A;  3HTK C;  4MVT A;  3D6S A;  4AP4 A;  5B78 A;  2KWJ A;  2EA6 A;  2L43 A;  3USV A;  3H7D A;  3AI8 A;  1VFY A;  1G25 A;  1WES A;  1EWP A;  3EB6 A;  2RI7 A;  2FQ9 A;  2H0D B;  2VJE A;  1WEV A;  3OF9 A;  4R7E A;  1TL9 A;  4WZ3 B;  4MSX A;  3C6W A;  2HDP A;  5B75 A;  1CPJ A;  2CKL A;  1GMY A;  4A49 A;  4ZQL A;  3HWN A;  3LQI A;  1WEN A;  1GLO A;  1Y08 A;  3ZYQ A;  4B7Y C;  1JOC A;  5H1T A;  1MHW A;  1K3B B;  2XB1 A;  2M3H A;  5FB1 A;  1PBH A;  2NQI A;  3KSE A;  2KR4 A;  1JQP A;  2AN6 A;  2LXH C;  5LKU A;  4HWY A;  2H0D A;  3PNR A;  2KWO A;  2G8J A;  1ME3 A;  2YJ9 A;  2ECV A;  4Q8G A;  1WEQ A;  4FO9 A;  4I7C A;  4O64 A;  1F2A A;  2DJF B;  3H6S A;  1WIL A;  5CHT A;  2ZET C;  2YQL A;  1CSB B;  2R6N A;  5K16 A;  4BPV A;  4X6J A;  3RVX A;  2DZZ A;  1LDK C;  3ZVY A;  2MNZ A;  4OEL A;  4YYR A;  4FIP A;  2OUL A;  2YUC A;  4S3O B;  1EWL A;  3U5P A;  1EWO A;  1Q6K A;  4N4F A;  3F75 A;  2M85 A;  4W4U A;  2KRE A;  5LKZ A;  3VK6 A;  3RPG B;  1QMY A;  3T6R A;  2AS8 A;  2AUZ A;  1STF E;  3H8B A;  2VPG A;  4PI3 A;  2PBH A;  2MD7 B;  4A4C A;  2C2V S;  4B86 C;  1NQC A;  3N9L A;  3RVW A;  4QRG A;  2AUX A;  3CBK A;  1X4U A;  2ARY A;  3TNX A;  2F42 A;  2NQD B;  3T7L A;  5C11 A;  2JQG R;  4N3W A;  3QSD A;  2HXZ A;  2VJF A;  1QXP A;  3NHE A;  2DC9 A;  4W5B A;  2ECI A;  1PE6 A;  2LGV A;  1VYX A;  2DX8 A;  2YSM A;  1YK7 A;  3U5M A;  4PPE A;  1MS6 A;  3OIS A;  2FRQ A;  2G6Q A;  2MNY A;  2RSD A;  4K7C A;  4GNG A;  1ZIV A;  2K4D A;  1WEP A;  1HYJ A;  1WGM A;  1SNK A;  3ZUA A;  1KHP A;  5TDW A;  5KH9 A;  1U6G B;  5J94 A;  3HCU A;  8PCH A;  2HH5 A;  3O70 A;  2R9C A;  2YSJ A;  1YK8 A;  3O0U A;  1BOR A;  1F2C A;  2CKL B;  4YAD A;  2FUD A;  3U8E A;  1Z2Q A;  1AYV A;  1WE9 A;  1WEE A;  1GCB A;  4WZ2 A;  4DMX A;  2CIO A;  5LCW B;  1PAD A;  1T1H A;  2P7U A;  2DCC A;  2M6M A;  2KU3 A;  4I7D A;  5JH3 A;  4TKP B;  4X3G A;  3U5O A;  2LGK A;  4QRX A;  2FT2 A;  4ZDT A;  2G7Y A;  4I07 A;  2VJF B;  4PTB A;  5C13 A;  3E1Z B;  2YU4 A;  1YT7 A;  1BGO A;  2Y5B A;  3P5U A;  2FSA A;  3I06 A;  1X4I A;  2YJB A;  3SOU A;  3I3T A;  4FJC A;  2L5U A;  3K8U A;  1PPO A;  3WXE A;  4GND A;  1HYI A;  1ATK A;  2AU1 A;  4QF2 A;  1AU2 A;  1MM2 A;  4YBS A;  3CBJ A;  5J3X A;  2CSY A;  3PW3 A;  3ZPV 1;  5G04 B;  1ZCM A;  4YV8 A;  2E6S A;  3O7A A;  1KFU L;  3IHP A;  3GL6 A;  2E02 A;  2ECW A;  5B79 A;  2VNF A;  5H9M A;  3SOW A;  3MHS A;  3BPM A;  2DCB A;  3OVX A;  5EYA F;  4W5C A;  2LQ6 A;  4YYS A;  4CDE B;  2GFO A;  5DIN A;  1EF7 A;  3HHA A;  2JRJ A;  1ITO A;  2UZG A;  2C2L A;  3GV4 A;  4YBT A;  2GHU A;  5LKX A;  3ZVZ B;  5FB0 A;  3N9Q A;  2QIC A;  5TBN A;  3KWB X;  7PCK A;  1QOL A;  2MT5 A;  5CVM A; 
#chains in the Genus database with same CATH topology
 3MOR A;  1MM3 A;  3CH2 X;  5D1L B;  2FUU A;  1DKI A;  2R9M A;  4R3D A;  2M1R A;  2KWK A;  3H8C A;  2Y6E A;  1Z6U A;  4YAB A;  3QT4 A;  3ERV A;  2FRA A;  2XU4 A;  3RVV A;  1CVZ A;  4YYQ A;  4CDD B;  2F6N A;  2XOZ A;  2BDZ A;  3L1Z B;  2YYR A;  1DCQ A;  2P86 A;  3EB5 A;  4YAT A;  3N4C A;  4ZTB A;  4QF3 A;  1E4U A;  4LJN A;  1F62 A;  2I50 A;  4A0C D;  4AXL A;  2XEU A;  1DEU A;  2K16 A;  1PVJ A;  1V87 A;  2HYE D;  4AYC B;  2KFT A;  4IC2 A;  5CVO B;  2BDL A;  1MDW A;  3MP2 A;  2O6X A;  1WEO A;  3PHD A;  2OXQ C;  5LKT A;  3BC3 A;  3NG2 A;  3ZPV E;  2ACT A;  3PHX A;  2E6R A;  5SVI A;  2DC6 A;  3LQJ A;  2YT5 A;  3ZNH A;  3N9M A;  2E01 A;  5JG6 A;  4PP2 E;  3KQI A;  1XKG A;  3HCT A;  4KLB A;  1NB3 A;  3FAN A;  4XI1 A;  2DOS A;  3C9E A;  3IV2 A;  4ZUX U;  3LRQ A;  4AYC A;  2YUR A;  1WEU A;  1ME4 A;  2FTD A;  3WXG A;  1FH0 A;  4P6G A;  5KO3 A;  4AVX A;  1LDJ B;  1NPZ A;  2AIM A;  1YAL A;  1X4J A;  2YRE A;  2MD8 C;  1PPD A;  3BY4 A;  4CA1 A;  4I05 A;  4N79 A;  2OWA A;  3LXS A;  4BOZ A;  2ECJ A;  5F02 A;  5E6J A;  4GUA A;  2LV9 A;  3DF0 A;  1AIM A;  2BU3 A;  4CDC B;  2VPB A;  2DC8 A;  2LXP C;  1NL6 A;  5D1K B;  4PP1 A;  2PRE A;  3K24 A;  5PAD A;  2ECG A;  2YJ2 A;  2KGG A;  2DC7 A;  1DVP A;  1AU3 A;  5EF4 A;  3W31 A;  2JMD A;  3GCB A;  1BQI A;  3P5X A;  3PUR A;  2L80 A;  3DPL R;  3QJ3 A;  2KIZ A;  3RTR B;  1ZBD B;  2E00 A;  2C0Y A;  2DCA A;  2J7Q A;  2PAD A;  3OQC A;  2G45 A;  1VSN A;  2FUI A;  4OW0 A;  3DDT A;  2VP7 A;  1Z60 A;  4BOU A;  2NQA A;  2VPD A;  1MEM A;  1UKF A;  3O34 A;  2KKX A;  4LKA A;  3PRM A;  2LRI C;  4RNA A;  2G6D A;  3HCS A;  4N4Z A;  3LFY A;  4C9Z A;  4LAD B;  1THE A;  1HUC B;  4CZW A;  2YQM A;  3U5N A;  3BPF A;  3KX1 A;  3KW9 A;  1NB5 A;  2OZ2 A;  3ASL A;  4LK9 A;  3O35 A;  3SOX A;  2L75 A;  3N9N A;  2Y43 A;  2WBF X;  4OEM A;  1U9V A;  3M62 A;  2ECT A;  3C5K A;  3KV5 A;  2IPP B;  1WIM A;  3PDF A;  1PIP A;  2Y1M A;  4UI9 B;  5B77 A;  4UP5 A;  4I04 A;  2MA5 A;  3IUT A;  3T9K A;  3O33 A;  3FM8 C;  2DCD A;  2PNX A;  2L0B A;  3V43 A;  3HHI A;  4RY2 A;  4AXM A;  4BOQ A;  3M7K A;  2XU3 A;  4WZ0 A;  3P5W A;  3BCN A;  3L11 A;  4PAD A;  2AYO A;  3PHW A;  4CDF B;  2YHO A;  2NAA A;  4V3L C;  4I7B A;  3I2D A;  2ECN A;  2B1N A;  3KFQ A;  5AIU A;  1MBM A;  2G8E A;  1M6D A;  3CH3 X;  4MZS A;  2F1G A;  4IUM A;  5FEY A;  2JMJ A;  1TLO A;  2R9N A;  4P16 A;  3MJ5 A;  4YYW A;  1YZB A;  4RKX A;  1IYM A;  1PPP A;  2VHS A;  4Q6F A;  2YJC A;  5TDR A;  2P0R A;  3MTN A;  3V6E A;  2MA6 A;  1A6R A;  3W30 A;  4UP0 A;  3BOW A;  3MHH A;  4YC9 A;  3S3R A;  1KFX L;  2FO5 A;  2KE1 A;  3P5V A;  3V6C A;  1AEC A;  4P6E A;  2F6J A;  4BS6 A;  4V3K C;  2YHN A;  3IMA A;  1JM7 B;  4R2Y A;  4GNE A;  4F52 B;  3N3K A;  1DF0 A;  3N9P A;  3ZNI A;  5FPW A;  1SP4 B;  3QZV A;  5H1U A;  2CRR A;  1CTE A;  1PCI A;  4S3O C;  4G54 A;  3LQH A;  5KH3 A;  3Q1D A;  2YJ8 A;  4X6I A;  5EZS A;  1MIR A;  2LGL A;  6PAD A;  2E03 A;  5B76 A;  3IOQ A;  5EGW A;  1BP4 A;  2KWN A;  2EGM A;  5A24 A;  3FL2 A;  4N8W A;  3IEJ A;  4DMY A;  3KWZ A;  4BBQ A;  2FYE A;  3JUE A;  2L7P A;  3SUB A;  2DSM A;  1TU6 A;  2DZY A;  4XUI A;  5TAB A;  2QIZ A;  1F29 A;  1WFK A;  2HHN A;  4OGE A;  1IWD A;  1GEC E;  4MZO A;  4L7X A;  1K2F A;  4BHW A;  2KYU A;  3PUQ A;  3O36 A;  3M99 A;  5TRB A;  2LN0 A;  1VD4 A;  2XOC A;  1XWH A;  3OVZ A;  4YBM A;  1ICF A;  1U9X A;  4CCG X;  1X9Y A;  2CSZ A;  4AUQ B;  3ZTG A;  4LLB A;  2CON A;  1RMD A;  2VHF A;  4QH6 A;  3S3Q A;  1KHQ A;  1POP A;  4IC3 A;  2K17 A;  2AYN A;  3KKU A;  2Y1N A;  3SHB A;  5I3L A;  1BY8 A;  2FE8 A;  2ATO A;  2JQF R;  2XU1 A;  5B8D A;  4R8P K;  2MIQ A;  1AYW A;  3N9O A;  2HWK A;  1NLJ A;  4XR7 A;  4X6H A;  1U9Q X;  4GNF A;  3O1G A;  3KV6 A;  4F1P A;  4BS5 A;  3F5V A;  2VJE B;  2K1J A;  3BWK A;  4Z0R A;  1CHC A;  3O37 A;  1CV8 A;  1U5I A;  4NN2 A;  3RPG C;  1O0E A;  5CVN B;  1U9W A;  1AYU A;  2MUM A;  4MM3 B;  4YAX A;  1YVB A;  4D8B A;  2IDA A;  4GB0 A;  3BB7 A;  2G43 A;  3DQV R;  3WXF A;  2LDR A;  1QDQ A;  2P57 A;  2QJ0 A;  4YVA A;  3C0R A;  4L58 A;  1CJL A;  2CB5 A;  5CHV A;  4BQV A;  4YYV A;  4QQ4 A;  2EOD A;  2PUY A;  5KH7 A;  1FBV A;  2OP3 A;  4QRV A;  5G0F A;  3OF8 A;  4FK5 A;  4YYU A;  2R9F A;  2AVW A;  2BAY A;  3K9M A;  3PBH A;  2LGG A;  5SVX A;  9PAP A;  2XU5 A;  2EGP A;  1N87 A;  4A4B A;  3H89 A;  1AU0 A;  4Z0O A;  2B1M A;  3N3G A;  2XP0 A;  3KNV A;  5DKA A;  3HD3 A;  1KXR A;  3L1X A;  1FP0 A;  2YW8 A;  5G05 B;  2F7D A;  2D8S A;  1MEG A;  4QBB A;  5FER A;  2NQG A;  2HD5 A;  1F2B A;  1S4V A;  1AU4 A;  2IBI A;  2DJA A;  1JM7 A;  2CT2 A;  5H1V A;  2H7J A;  3H7H A;  2PNS A;  1CS8 A;  2Z84 A;  1WEW A;  3LVQ E;  2VPE A;  1CQD A;  1WEM A;  2FD4 A;  1PPN A;  2JMI A;  3M63 A;  1Y4H A;  4P5O B;  4WA6 A;  2KGI A;  1CB5 A;  2DJG B;  1EWM A;  5AIT A;  5SVY A;  3B79 A;  5D1M B;  4Q8H A;  3O47 A;  1PXV A;  2JTC A;  2R9O A;  5JA7 A;  4BSQ A;  1VJV A;  3HTK C;  4MVT A;  3D6S A;  4AP4 A;  5B78 A;  2KWJ A;  2EA6 A;  2L43 A;  4WUR A;  3H7D A;  3AI8 A;  3O65 A;  1VFY A;  1G25 A;  3USV A;  1WES A;  1EWP A;  3EB6 A;  2RI7 A;  2FQ9 A;  2H0D B;  2VJE A;  1WEV A;  3OF9 A;  4R7E A;  1TL9 A;  4OGC A;  4WZ3 B;  5JZE A;  2MKE A;  2LAU A;  4MSX A;  3C6W A;  2HDP A;  5B75 A;  1CPJ A;  2CKL A;  3PT2 A;  1GMY A;  4A49 A;  4ZQL A;  2BTW A;  3HWN A;  3LQI A;  1WEN A;  1GLO A;  1Y08 A;  3ZYQ A;  4B7Y C;  1JOC A;  5H1T A;  1MHW A;  1K3B B;  2XB1 A;  2M3H A;  5FB1 A;  1PBH A;  2NQI A;  3KSE A;  2KR4 A;  1JQP A;  2AN6 A;  2LXH C;  5LKU A;  4HWY A;  3BBA A;  2H0D A;  3PNR A;  4RF1 A;  2KWO A;  2IQJ A;  4H9D A;  2G8J A;  1ME3 A;  2YJ9 A;  2ECV A;  4Q8G A;  1WEQ A;  3MDB C;  4FO9 A;  4I7C A;  4O64 A;  3E2D A;  1F2A A;  3MTV A;  3FJU B;  5EZQ A;  2DJF B;  3H6S A;  1WIL A;  3FEH A;  4PT5 A;  5CHT A;  3TMP A;  5K3Q A;  2ZET C;  2YQL A;  4XZX A;  1CSB B;  2R6N A;  5K16 A;  4BPV A;  2M13 A;  4X6J A;  3RVX A;  2DZZ A;  4OVZ A;  1LDK C;  3ZVY A;  2MNZ A;  4OEL A;  2CSV A;  4YYR A;  4IP3 A;  2KKY A;  4FIP A;  2J7Q C;  2OUL A;  2YUC A;  4S3O B;  1EWL A;  3U5P A;  1EWO A;  3LDY A;  1Q6K A;  4N4F A;  3F75 A;  2M85 A;  4W4U A;  2KRE A;  5LKZ A;  3TRK A;  3VK6 A;  3RPG B;  1QMY A;  3T6R A;  2AS8 A;  2AUZ A;  1STF E;  3H8B A;  2VPG A;  4PI3 A;  2PBH A;  2MD7 B;  2C2V S;  4A4C A;  4B86 C;  1NQC A;  3N9L A;  3RVW A;  4QRG A;  2AUX A;  4MI7 A;  3CBK A;  3IFU A;  1X4U A;  2ARY A;  3TNX A;  2F42 A;  2NQD B;  3T7L A;  5C11 A;  4BOS A;  2JQG R;  4N3W A;  3QSD A;  2HXZ A;  2VJF A;  4HXD B;  1QXP A;  3NHE A;  3LJU X;  2DC9 A;  4W5B A;  2ECI A;  1PE6 A;  4O62 A;  4M0W A;  2LGV A;  1VYX A;  2DX8 A;  2UZJ A;  3B21 A;  2YSM A;  1YK7 A;  3U5M A;  4PPE A;  2YVR A;  4A5U A;  2JRI A;  3PHU A;  1MS6 A;  3OIS A;  2FRQ A;  2G6Q A;  2MNY A;  2RSD A;  4K7C A;  4GNG A;  1ZIV A;  2K4D A;  1WEP A;  1HYJ A;  1WGM A;  1SNK A;  3PRP A;  3ZUA A;  1KHP A;  5TDW A;  5KH9 A;  1U6G B;  5J94 A;  3HCU A;  3DWD A;  8PCH A;  2HH5 A;  4RF0 A;  2D8U A;  3O70 A;  2R9C A;  4OVZ B;  2RR4 A;  2YSJ A;  1YK8 A;  3O0U A;  1BOR A;  4D8I A;  1F2C A;  2CKL B;  4YAD A;  2FUD A;  3U8E A;  1Z2Q A;  1AYV A;  1WE9 A;  3RNV A;  1WEE A;  1GCB A;  4WZ2 A;  4DMX A;  2CIO A;  5LCW B;  1PAD A;  1T1H A;  2P7U A;  2DCC A;  2M6M A;  2FFW A;  2KU3 A;  4I7D A;  4REZ A;  5JH3 A;  4TKP B;  4X3G A;  3U5O A;  2LGK A;  4QRX A;  2FT2 A;  4BOP A;  2E61 A;  4ZDT A;  2G7Y A;  4I07 A;  3PSE A;  2VJF B;  4PTB A;  5C13 A;  3E1Z B;  2YU4 A;  2JUN A;  1YT7 A;  1BGO A;  2Y5B A;  3P5U A;  2EXU A;  2FSA A;  3I06 A;  1X4I A;  2YJB A;  3SOU A;  3I3T A;  4FJC A;  2L5U A;  3K8U A;  1PPO A;  3WXE A;  3LVR E;  4GND A;  1HYI A;  1ATK A;  2AU1 A;  4QF2 A;  1AU2 A;  1MM2 A;  4YBS A;  3CBJ A;  3PLW A;  5J3X A;  2CSY A;  3PW3 A;  3ZPV 1;  5SVI B;  5G04 B;  1ZCM A;  4D8E A;  4YV8 A;  2CRW A;  2E6S A;  2JM3 A;  3O7A A;  1KFU L;  3IHP A;  3GL6 A;  2AGA A;  2BTW B;  2E02 A;  2ECW A;  5B79 A;  2VNF A;  2XOY A;  5H9M A;  3SOW A;  3FAO A;  3MHS A;  3BPM A;  2DCB A;  3OVX A;  5EYA F;  4W5C A;  2LQ6 A;  4YYS A;  4CDE B;  2GFO A;  3E9S A;  5DIN A;  1EF7 A;  3HHA A;  2JRJ A;  1ITO A;  2UZG A;  2C2L A;  3GV4 A;  4YBT A;  2GHU A;  5LKX A;  3ZVZ B;  5FB0 A;  3N9Q A;  2QIC A;  5TBN A;  2B0O E;  3KWB X;  1QOL A;  7PCK A;  3KDE C;  2MT5 A;  5CVM A; 
#chains in the Genus database with same CATH homology
 3MOR A;  1MM3 A;  3CH2 X;  5D1L B;  2FUU A;  2R9M A;  2M1R A;  2KWK A;  3H8C A;  2Y6E A;  1Z6U A;  4YAB A;  3QT4 A;  3ERV A;  2FRA A;  2XU4 A;  3RVV A;  1CVZ A;  4YYQ A;  4CDD B;  2F6N A;  2BDZ A;  3L1Z B;  2YYR A;  2P86 A;  3N4C A;  3EB5 A;  4YAT A;  4QF3 A;  1E4U A;  4LJN A;  1F62 A;  2I50 A;  4A0C D;  4AXL A;  2XEU A;  1DEU A;  2K16 A;  1V87 A;  2HYE D;  4AYC B;  2KFT A;  4IC2 A;  5CVO B;  2BDL A;  1MDW A;  2O6X A;  1WEO A;  3PHD A;  2OXQ C;  5LKT A;  3BC3 A;  3NG2 A;  3ZPV E;  2ACT A;  2E6R A;  2DC6 A;  3LQJ A;  2YT5 A;  3N9M A;  2E01 A;  5JG6 A;  4PP2 E;  3KQI A;  1XKG A;  3HCT A;  4KLB A;  1NB3 A;  4XI1 A;  3C9E A;  3IV2 A;  4ZUX U;  3LRQ A;  4AYC A;  2YUR A;  1WEU A;  1ME4 A;  2FTD A;  3WXG A;  1FH0 A;  4P6G A;  4AVX A;  1LDJ B;  1NPZ A;  2AIM A;  1YAL A;  1X4J A;  2YRE A;  2MD8 C;  1PPD A;  4CA1 A;  4I05 A;  4N79 A;  3LXS A;  2ECJ A;  5F02 A;  2LV9 A;  3DF0 A;  1AIM A;  4CDC B;  2VPB A;  2DC8 A;  2LXP C;  1NL6 A;  5D1K B;  4PP1 A;  2PRE A;  3K24 A;  5PAD A;  2ECG A;  2YJ2 A;  2KGG A;  2DC7 A;  1DVP A;  1AU3 A;  1E2T A;  5EF4 A;  2JMD A;  3GCB A;  1BQI A;  3P5X A;  3PUR A;  2L80 A;  3DPL R;  3QJ3 A;  2KIZ A;  3RTR B;  1ZBD B;  2E00 A;  2C0Y A;  2DCA A;  2PAD A;  2G45 A;  1VSN A;  2FUI A;  2VP7 A;  1Z60 A;  2NQA A;  2VPD A;  1MEM A;  3O34 A;  4LKA A;  2LRI C;  2G6D A;  3HCS A;  4N4Z A;  3LFY A;  4C9Z A;  4LAD B;  1THE A;  1HUC B;  4BGF A;  4CZW A;  2YQM A;  3U5N A;  3BPF A;  3KX1 A;  3KW9 A;  1NB5 A;  2OZ2 A;  3SOX A;  3ASL A;  3O35 A;  4LK9 A;  2L75 A;  3N9N A;  2Y43 A;  2WBF X;  4OEM A;  1U9V A;  3M62 A;  2ECT A;  3C5K A;  3KV5 A;  2IPP B;  1WIM A;  3PDF A;  1PIP A;  2Y1M A;  4UI9 B;  5B77 A;  4UP5 A;  4I04 A;  2MA5 A;  3IUT A;  3O33 A;  1W4T A;  2DCD A;  2PNX A;  2L0B A;  3V43 A;  3HHI A;  4RY2 A;  4AXM A;  2XU3 A;  4WZ0 A;  3P5W A;  3BCN A;  3L11 A;  4PAD A;  2AYO A;  4CDF B;  2YHO A;  2NAA A;  4V3L C;  4I7B A;  3I2D A;  2ECN A;  2B1N A;  3KFQ A;  5AIU A;  2G8E A;  1M6D A;  3CH3 X;  4MZS A;  2F1G A;  5FEY A;  2JMJ A;  1TLO A;  2R9N A;  4YYW A;  1IYM A;  1PPP A;  2VHS A;  4Q6F A;  2YJC A;  5TDR A;  4B55 A;  2P0R A;  3MTN A;  3V6E A;  2MA6 A;  1A6R A;  4UP0 A;  3BOW A;  3MHH A;  4YC9 A;  3S3R A;  1KFX L;  2FO5 A;  2KE1 A;  3P5V A;  3V6C A;  1AEC A;  4P6E A;  2F6J A;  4BS6 A;  4V3K C;  2YHN A;  3IMA A;  1JM7 B;  4R2Y A;  4GNE A;  4F52 B;  3N3K A;  1DF0 A;  3N9P A;  3ZNI A;  5FPW A;  1SP4 B;  3QZV A;  5H1U A;  4G54 A;  1CTE A;  1PCI A;  4S3O C;  3LQH A;  5KH3 A;  2YJ8 A;  4X6I A;  1MIR A;  2LGL A;  6PAD A;  2E03 A;  5B76 A;  3IOQ A;  5EGW A;  1BP4 A;  2KWN A;  5A24 A;  3FL2 A;  4N8W A;  3IEJ A;  4DMY A;  3KWZ A;  4BBQ A;  2FYE A;  2DZY A;  1TU6 A;  4XUI A;  5TAB A;  2QIZ A;  1F29 A;  1WFK A;  2HHN A;  1IWD A;  3D9W A;  1GEC E;  4GUZ A;  4MZO A;  4L7X A;  1K2F A;  4BHW A;  2KYU A;  3PUQ A;  3O36 A;  3M99 A;  5TRB A;  2LN0 A;  1VD4 A;  1XWH A;  3OVZ A;  4YBM A;  1ICF A;  1U9X A;  4CCG X;  1X9Y A;  2CSZ A;  4AUQ B;  3ZTG A;  4LLB A;  1RMD A;  2VHF A;  4QH6 A;  3S3Q A;  1KHQ A;  1POP A;  4IC3 A;  2K17 A;  2AYN A;  3KKU A;  2Y1N A;  3SHB A;  5I3L A;  1BY8 A;  2ATO A;  2JQF R;  2XU1 A;  5B8D A;  4R8P K;  2MIQ A;  1AYW A;  3N9O A;  1NLJ A;  4XR7 A;  4X6H A;  1U9Q X;  4GNF A;  3O1G A;  3KV6 A;  4BS5 A;  3F5V A;  2VJE B;  2K1J A;  3BWK A;  1CHC A;  3O37 A;  1CV8 A;  1U5I A;  4NN2 A;  3RPG C;  1O0E A;  5CVN B;  1U9W A;  1AYU A;  2MUM A;  4YAX A;  1YVB A;  2IDA A;  4GB0 A;  2G43 A;  3DQV R;  3WXF A;  2LDR A;  1QDQ A;  2QJ0 A;  4YVA A;  4L58 A;  1CJL A;  2CB5 A;  5CHV A;  4BQV A;  4YYV A;  2EOD A;  2PUY A;  5KH7 A;  1FBV A;  2OP3 A;  4QRV A;  5G0F A;  3OF8 A;  4FK5 A;  4YYU A;  2R9F A;  2AVW A;  2BAY A;  3K9M A;  3PBH A;  2LGG A;  9PAP A;  2XU5 A;  2EGP A;  1N87 A;  4A4B A;  3H89 A;  1AU0 A;  2B1M A;  3N3G A;  3KNV A;  5DKA A;  3HD3 A;  1KXR A;  3L1X A;  1FP0 A;  2YW8 A;  5G05 B;  2F7D A;  2D8S A;  1MEG A;  4QBB A;  5FER A;  2NQG A;  2HD5 A;  1F2B A;  1S4V A;  1AU4 A;  2IBI A;  1JM7 A;  2CT2 A;  5H1V A;  2H7J A;  2PNS A;  1CS8 A;  1WEW A;  1CQD A;  2VPE A;  1WEM A;  1PPN A;  2JMI A;  3M63 A;  1Y4H A;  4P5O B;  4WA6 A;  2KGI A;  1CB5 A;  2DJG B;  1EWM A;  5AIT A;  3B79 A;  4Q8H A;  5D1M B;  1PXV A;  2R9O A;  5JA7 A;  4BSQ A;  1VJV A;  3HTK C;  4MVT A;  3D6S A;  4AP4 A;  5B78 A;  2KWJ A;  2EA6 A;  2L43 A;  3USV A;  3H7D A;  3AI8 A;  1VFY A;  1G25 A;  1WES A;  1EWP A;  3EB6 A;  2RI7 A;  2FQ9 A;  2H0D B;  2VJE A;  4NV8 A;  1WEV A;  3OF9 A;  4R7E A;  1TL9 A;  4WZ3 B;  4MSX A;  3C6W A;  2HDP A;  1W5R A;  5B75 A;  4NV7 A;  1CPJ A;  2CKL A;  1GMY A;  4A49 A;  4ZQL A;  3HWN A;  3LQI A;  1WEN A;  1GLO A;  1Y08 A;  3ZYQ A;  4B7Y C;  1JOC A;  5H1T A;  1MHW A;  1K3B B;  2XB1 A;  2M3H A;  5FB1 A;  1PBH A;  2NQI A;  3KSE A;  1W6F A;  2KR4 A;  1JQP A;  2AN6 A;  2LXH C;  5LKU A;  4HWY A;  2H0D A;  3PNR A;  2KWO A;  2G8J A;  1ME3 A;  2YJ9 A;  2ECV A;  4Q8G A;  1WEQ A;  4FO9 A;  4I7C A;  4O64 A;  1F2A A;  2DJF B;  3H6S A;  1WIL A;  5CHT A;  2ZET C;  2YQL A;  1CSB B;  2R6N A;  2VFC A;  5K16 A;  4BPV A;  4X6J A;  3RVX A;  2DZZ A;  1LDK C;  3ZVY A;  2MNZ A;  4OEL A;  4YYR A;  4FIP A;  2OUL A;  2YUC A;  4S3O B;  1EWL A;  3U5P A;  1EWO A;  1Q6K A;  4N4F A;  3F75 A;  2M85 A;  4W4U A;  2KRE A;  5LKZ A;  3VK6 A;  3RPG B;  1QMY A;  3T6R A;  2AS8 A;  2AUZ A;  1GX3 A;  1STF E;  3H8B A;  2VPG A;  4PI3 A;  2PBH A;  2MD7 B;  4A4C A;  2C2V S;  4B86 C;  1NQC A;  3N9L A;  3RVW A;  4QRG A;  2AUX A;  3CBK A;  1X4U A;  2ARY A;  3TNX A;  2F42 A;  2NQD B;  3T7L A;  5C11 A;  2JQG R;  4N3W A;  3QSD A;  2HXZ A;  2VJF A;  1QXP A;  3NHE A;  3LTW A;  2DC9 A;  4W5B A;  2ECI A;  1PE6 A;  2LGV A;  1VYX A;  2DX8 A;  4C5P A;  2YSM A;  1YK7 A;  3U5M A;  4PPE A;  1MS6 A;  3OIS A;  2FRQ A;  2G6Q A;  2MNY A;  2RSD A;  4K7C A;  4GNG A;  1ZIV A;  2K4D A;  1WEP A;  1HYJ A;  1WGM A;  1SNK A;  3ZUA A;  1KHP A;  5TDW A;  5KH9 A;  1U6G B;  5J94 A;  3HCU A;  8PCH A;  2HH5 A;  3O70 A;  2R9C A;  2YSJ A;  1YK8 A;  3O0U A;  1BOR A;  1F2C A;  2CKL B;  4YAD A;  2FUD A;  3U8E A;  1Z2Q A;  1AYV A;  1WE9 A;  1WEE A;  1GCB A;  4WZ2 A;  4DMX A;  2CIO A;  5LCW B;  1PAD A;  1T1H A;  2P7U A;  2DCC A;  2M6M A;  2KU3 A;  4I7D A;  5JH3 A;  4TKP B;  4X3G A;  3U5O A;  2VFB A;  2LGK A;  4QRX A;  2FT2 A;  4ZDT A;  2G7Y A;  4I07 A;  2VJF B;  4PTB A;  5C13 A;  3E1Z B;  2YU4 A;  1YT7 A;  1BGO A;  2Y5B A;  3P5U A;  2FSA A;  3I06 A;  1X4I A;  2YJB A;  3SOU A;  3I3T A;  2BSZ A;  4FJC A;  2L5U A;  3K8U A;  1PPO A;  3WXE A;  4GND A;  1HYI A;  1ATK A;  2AU1 A;  4QF2 A;  1AU2 A;  1MM2 A;  4YBS A;  3CBJ A;  5J3X A;  2CSY A;  3PW3 A;  3ZPV 1;  5G04 B;  1ZCM A;  4YV8 A;  2E6S A;  3O7A A;  1KFU L;  3IHP A;  3GL6 A;  2E02 A;  2ECW A;  5B79 A;  2VNF A;  5H9M A;  3SOW A;  3MHS A;  3BPM A;  2DCB A;  3OVX A;  5EYA F;  4W5C A;  2LQ6 A;  4YYS A;  4CDE B;  2GFO A;  5DIN A;  1EF7 A;  3HHA A;  2JRJ A;  1ITO A;  2UZG A;  2C2L A;  3GV4 A;  4YBT A;  2GHU A;  5LKX A;  3ZVZ B;  5FB0 A;  3N9Q A;  2QIC A;  5TBN A;  3KWB X;  7PCK A;  1QOL A;  2MT5 A;  5CVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...