4FJCA

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
472
structure length
447
Chain Sequence
AMSICPHIQQVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGLLFCFKCEDYIGNIDLINDAILAKYWDDVCTKTMVPSMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGATNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFNYHCECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIRQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 126
structure length 447
sequence length 472
chains with identical sequence E
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4fjcA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4fjcA02
4GNFA 1K2FA 1VYXA 2C0YA 4AYCA 2ACTA 1MHWA 2YT5A 1VD4A 1CHCA 3CBKA 2EODA 5B76A 1WEEA 5C11A 2YU4A 2M6MA 2XU5A 1N87A 3MTNA 2LDRA 2PREA 1AU4A 2I50A 1VJVA 2IBIA 4YBSA 2JMDA 1EWMA 2DCDA 2KU3A 4GB0A 3N9QA 1NQCA 2DC9A 3EB6A 3N9MA 4V3KC 2VJFB 4QRVA 1Z2QA 2ATOA 1E4UA 1PE6A 3KW9A 5H1VA 1MEGA 4W5CA 2CKLB 3ERVA 2AUZA 2CSYA 2HH5A 2Y5BA 5KH9A 2R9CA 3AI8A 2MA5A 1VSNA 3ASLA 2CSZA 3KV6A 1F29A 5EYAF 2QICA 2L43A 3CBJA 3QSDA 2CT2A 2YJ2A 3KFQA 4I7CA 2NQIA 4YBMA 1MIRA 3N9PA 1CTEA 3CH3X 4K7CA 3V43A 2F42A 1X9YA 2ECGA 4QF3A 3SOUA 4N79A 3WXEA 3M63A 1WGMA 4YV8A 4PP2E 4R7EA 2VHFA 3BWKA 3T6RA 3IHPA 2VPDA 2XU4A 1WESA 3I3TA 2MNYA 1PPNA 3RTRB 2YREA 5FERA 3GL6A 1WILA 4N4FA 1NL6A 2VNFA 4TKPB 3U5NA 1AYUA 1NPZA 1ZBDB 3BOWA 5D1KB 2ARYA 4LADB 3N9OA 1FH0A 9PAPA 3O70A 5G04B 3MHSA 3PHDA 5TABA 2HHNA 1CVZA 1F2CA 2E00A 3P5VA 4AYCB 4C9ZA 2MD7B 3HHAA 1GECE 4CDCB 2E02A 7PCKA 2AUXA 2L5UA 2FYEA 3KNVA 2KGIA 2YSJA 3KSEA 1F62A 2KWOA 1CJLA 1HYJA 4FJCA 1A6RA 3ZVZB 5FEYA 4WZ2A 2G45A 1MM3A 2IPPB 4YYWA 1FP0A 3N9LA 1DF0A 1RMDA 4A4BA 2Y6EA 1MS6A 1O0EA 1LDKC 2JMIA 4Q8GA 3DPLR 5DINA 2H0DA 3O33A 1Z60A 2DC8A 1MM2A 2LGVA 2QIZA 4XUIA 3N3KA 4QF2A 2AN6A 1AYVA 1U9VA 3KWZA 5AIUA 4WZ0A 3M99A 2AIMA 3LRQA 4LLBA 4P5OB 2R9NA 1S4VA 2DZZA 5JH3A 4A0CD 5LKUA 1WFKA 2NQGA 2G6QA 1HYIA 2KIZA 4X6JA 1ZCMA 3N4CA 3U5OA 3O34A 2CB5A 1CPJA 2XB1A 1EWLA 1ATKA 2RI7A 4NN2A 1KHPA 1G25A 2PNSA 1WIMA 3SOXA 3BCNA 4YABA 1TL9A 3USVA 2ZETC 3MORA 1EWOA 3GCBA 1GLOA 4P6GA 4GNEA 1STFE 2FT2A 4MVTA 1DVPA 2R9MA 4HWYA 1PIPA 4PI3A 4LK9A 4LKAA 1YT7A 3ZNIA 4BQVA 1U9XA 2G43A 2YW8A 5KH3A 3KQIA 4B86C 1WEOA 2KE1A 3KV5A 2B1NA 5I3LA 2GHUA 3H8BA 5B77A 5D1MB 1V87A 3ZYQA 2JQGR 4BSQA 5B75A 3WXGA 2KWJA 4MZSA 4CZWA 1TU6A 4ZUXU 1NLJA 2YJBA 4FO9A 4AXMA 3IEJA 4OELA 2H0DB 3RVVA 4G54A 2LGGA 1AYWA 3QT4A 3OISA 4LJNA 2LXPC 2DC6A 3P5UA 3PW3A 3OF9A 2YURA 4Q8HA 2HYED 4F52B 2MIQA 4YATA 2G8JA 4XR7A 2D8SA 2OZ2A 3D6SA 1Q6KA 4P6EA 2MT5A 1THEA 5CVOB 1WENA 2C2VS 4AP4A 2VPGA 1PPPA 2AYOA 5TRBA 4A4CA 3HTKC 1DEUA 2ECJA 3SHBA 4V3LC 1CB5A 1PBHA 1ME4A 2OULA 3P5XA 2K17A 2AVWA 2FUDA 2YSMA 4X6HA 5TBNA 2VPEA 2H7JA 1BQIA 2ECIA 4WA6A 2Y1MA 2BAYA 5AITA 1AU3A 2DX8A 3LFYA 3PBHA 2BDZA 2DC7A 1QDQA 4W5BA 2FRAA 4A49A 2KYUA 3ZTGA 3GV4A 3ZPVE 1QXPA 1X4JA 5FB1A 4KLBA 2HD5A 2DJGB 4X3GA 4YYVA 5CVMA 4AXLA 2VP7A 2QJ0A 2M85A 1KHQA 4OEMA 2YJ8A 3N3GA 3O35A 1PPDA 2OXQC 1JOCA 1SP4B 1MEMA 2R6NA 4CCGX 2F1GA 2DCAA 1FBVA 1QOLA 2EA6A 4Q6FA 3OVXA 3RPGC 1WEPA 4FIPA 4CDFB 1QMYA 4I04A 1ME3A 4WZ3B 3I2DA 1KXRA 2FO5A 3C6WA 3HWNA 4YYQA 2C2LA 3LQJA 4CDDB 3IMAA 3U8EA 2YQLA 1TLOA 3IV2A 2LXHC 2L75A 2AU1A 3QZVA 5H1UA 1WEWA 2E01A 2R9FA 4BPVA 3C9EA 2G6DA 5B79A 2KREA 2GFOA 5A24A 2AS8A 3H8CA 5CHTA 2E6SA 1EWPA 2E03A 2KWKA 2G7YA 4L58A 3SOWA 2HXZA 2P86A 2VJFA 3VK6A 5LKXA 4YADA 5FPWA 3PDFA 3RPGB 3NHEA 3EB5A 1BP4A 5DKAA 1PADA 4YYSA 2CKLA 5FB0A 4N8WA 4PPEA 1BY8A 2ECTA 3O37A 3PURA 4MZOA 5EF4A 3H7DA 1PXVA 2M3HA 1GMYA 2BDLA 2WBFX 2Y43A 5JG6A 2LGKA 2MNZA 1CS8A 1YK8A 2KWNA 1X4IA 3B79A 3I06A 5LKTA 5KH7A 2FRQA 3WXFA 3T7LA 4BHWA 5TDWA 1PPOA 1WEVA 3O36A 3U5MA 2ECWA 2L80A 5J3XA 4QBBA 1Y08A 3L1ZB 4R8PK 2HDPA 4N3WA 4UP5A 1WE9A 3ZUAA 2YHNA 1NB3A 1U6GB 4QRXA 1Z6UA 3CH2X 3PNRA 5G0FA 2ECNA 4ZDTA 1IWDA 5D1LB 4YYRA 4ZQLA 1Y4HA 1U9QX 2KR4A 3LQIA 4S3OC 5B8DA 2CIOA 3H89A 3TNXA 4YBTA 1POPA 1CSBB 2LGLA 1SNKA 3ZVYA 2LRIC 2OP3A 8PCHA 4O64A 2LV9A 4XI1A 4I7BA 5K16A 2XEUA 1K3BB 3BPMA 1F2BA 3DF0A 1NB5A 1M6DA 4B7YC 1BORA 3O7AA 2DJFB 3S3RA 4MSXA 2P0RA 4UI9B 4CA1A 2PUYA 4CDEB 2DCBA 1ZIVA 5LCWB 1JM7A 2F6NA 2VJEA 2NAAA 4AUQB 4W4UA 2UZGA 5CVNB 2YUCA 3KX1A 2YJCA 4S3OB 2MA6A 3E1ZB 3F75A 3FL2A 3LXSA 2NQAA 4X6IA 2KFTA 3HD3A 2L0BA 4I7DA 4IC2A 1XKGA 2K16A 1X4UA 2DCCA 5CHVA 4BBQA 1T1HA 2M1RA 5TDRA 2JQFR 2LQ6A 3M62A 1LDJB 3RVWA 4BS6A 5PADA 2NQDB 2K4DA 4I05A 4FK5A 2VPBA 4PADA 2K1JA 2KGGA 1KFUL 3BPFA 1GCBA 1ITOA 2JMJA 1JQPA 5C13A 2YJ9A 2LN0A 3K9MA 1EF7A 3BC3A 4PP1A 2PNXA 2YHOA 5G05B 4RY2A 5EGWA 1AU0A 3ZPV1 5H9MA 2O6XA 3H6SA 2RSDA 2YQMA 1WEMA 5H1TA 3HHIA 3IUTA 4GNDA 2Y1NA 4YYUA 2PBHA 2XU3A 2FSAA 3L11A 3HCUA 1CQDA 3K24A 1AECA 2FUUA 2YYRA 2R9OA 3OF8A 4YC9A 3IOQA 2MD8C 2IDAA 1YVBA 1JM7B 1XWHA 2VJEB 1BGOA 5J94A 1WEUA 3U5PA 3F5VA 4N4ZA 2JRJA 3L1XA 2XU1A 4R2YA 3OVZA 1YALA 3HCTA 1CV8A 1ICFA 2AYNA 4L7XA 1PCIA 2B1MA 2PADA 3O0UA 6PADA 5JA7A 5F02A 2MUMA 1U5IA 1F2AA 2DZYA 2G8EA 4I07A 1MDWA 3LQHA 3V6EA 2P7UA 4DMYA 5B78A 1VFYA 4PTBA 3MHHA 4QRGA 2FTDA 3RVXA 3V6CA 3NG2A 4GNGA 1U9WA 1AU2A 1HUCB 4UP0A 3K8UA 4QH6A 2E6RA 4DMXA 2ECVA 3HCSA 4BS5A 2EGPA 4AVXA 4YVAA 3DQVR 2F7DA 1AIMA 2VHSA 1IYMA 3KKUA 3KWBX 1WEQA 2FQ9A 5LKZA 3O1GA 4IC3A 3P5WA 2F6JA 3N9NA 4YAXA 3C5KA 3QJ3A 1KFXL 2FUIA 1YK7A 3S3QA 3PUQA
chains in the Genus database with same CATH superfamily
4GNFA 1K2FA 2KKXA 2P57A 1VYXA 2C0YA 4AYCA 2ACTA 1MHWA 2YT5A 1VD4A 1CHCA 3W31A 3CBKA 2EODA 5B76A 1WEEA 5C11A 2RR4A 2M6MA 2YU4A 2XU5A 1N87A 3MTNA 2LDRA 4OGEA 1AU4A 2I50A 1VJVA 2IBIA 4YBSA 2JMDA 2PREA 2CSVA 1EWMA 2DCDA 2KU3A 4GB0A 3N9QA 3BBAA 1NQCA 2DC9A 3EB6A 3N9MA 4V3KC 2VJFB 4QRVA 1Z2QA 2ATOA 1E4UA 3M7KA 1PE6A 3KW9A 5H1VA 1MEGA 4W5CA 3PT2A 2CKLB 3ERVA 2AUZA 2CSYA 2HH5A 2Y5BA 5KH9A 2R9CA 3AI8A 3RVVA 2MA5A 1VSNA 3ASLA 2CSZA 3KV6A 1F29A 5EYAF 2QICA 2L43A 3CBJA 3QSDA 3DDTA 2CT2A 2YJ2A 3KFQA 4I7CA 2NQIA 4YBMA 1MIRA 3N9PA 1CTEA 3CH3X 4K7CA 3V43A 2F42A 1X9YA 3ZNHA 2ECGA 4QF3A 5JZEA 3SOUA 4N79A 4A5UA 3WXEA 2M13A 3M63A 1WGMA 4YV8A 4PP2E 4P16A 4WURA 4R7EA 2VHFA 3BWKA 3T6RA 3IHPA 2VPDA 2XU4A 1WESA 3I3TA 2MNYA 1PPNA 3RTRB 2YREA 5FERA 3GL6A 1WILA 4N4FA 1NL6A 2VNFA 4TKPB 3U5NA 1AYUA 1NPZA 1ZBDB 3BOWA 5D1KB 3LDYA 4LADB 3N9OA 2ARYA 2EGMA 1FH0A 5SVIA 9PAPA 3O70A 5G04B 3MHSA 3PHDA 5TABA 2HHNA 1CVZA 1F2CA 2E00A 3P5VA 4AYCB 4C9ZA 2DOSA 4IUMA 3FEHA 2XOCA 2MD7B 3HHAA 1GECE 4CDCB 2E02A 3PSEA 7PCKA 2AUXA 2L5UA 2FYEA 3KNVA 2KGIA 2YSJA 3KSEA 1F62A 2KWOA 1CJLA 1HYJA 4D8EA 4FJCA 2J7QC 1A6RA 3ZVZB 5FEYA 4WZ2A 2G45A 1MM3A 2IPPB 4YYWA 1FP0A 3N9LA 1DF0A 1RMDA 4A4BA 2OWAA 2Y6EA 3PHXA 1MS6A 1O0EA 1LDKC 2JMIA 1PVJA 4Q8GA 3DPLR 5DINA 2H0DA 3O33A 1Z60A 2DC8A 1MM2A 2LGVA 2QIZA 4H9DA 4XUIA 3N3KA 4QF2A 2AN6A 1AYVA 1U9VA 2Z84A 3KWZA 5AIUA 3H7HA 4WZ0A 3M99A 2AIMA 3LRQA 4LLBA 4P5OB 2JRIA 2R9NA 1S4VA 2DZZA 3PRMA 5JH3A 4A0CD 5LKUA 1WFKA 2NQGA 2G6QA 1HYIA 2KIZA 4X6JA 2CONA 2LAUA 1ZCMA 3N4CA 3U5OA 3O34A 2CB5A 1CPJA 2FFWA 2XB1A 1EWLA 1ATKA 2RI7A 4NN2A 1KHPA 1G25A 2PNSA 1WIMA 3SOXA 3BCNA 4YABA 1TL9A 3USVA 2ZETC 3BY4A 3MORA 1EWOA 3GCBA 1GLOA 4P6GA 4GNEA 1STFE 2FT2A 4MVTA 1DVPA 2R9MA 4HWYA 3TMPA 1PIPA 4PI3A 4LK9A 2BU3A 4LKAA 3FANA 3FJUB 1YT7A 3ZNIA 4BQVA 1U9XA 2G43A 2YW8A 5KH3A 3KQIA 2HWKA 4B86C 2XOZA 4BOQA 1WEOA 2KE1A 3KV5A 2B1NA 5I3LA 2GHUA 3H8BA 5B77A 3DWDA 5D1MB 1V87A 3ZYQA 2JQGR 4BSQA 5B75A 3WXGA 2KWJA 4MZSA 3MP2A 2MKEA 3Q1DA 4CZWA 1TU6A 2BTWB 4ZUXU 1NLJA 2YJBA 4FO9A 4AXMA 3IEJA 4OELA 2H0DB 3PHUA 4G54A 4XZXA 2LGGA 1AYWA 3QT4A 3OISA 4LJNA 2LXPC 2DC6A 3P5UA 3PW3A 4GUAA 3OF9A 2YURA 4Q8HA 2HYED 2KKYA 4F52B 2MIQA 4YATA 2B0OE 4BOUA 4OGCA 2G8JA 4XR7A 4ZTBA 2D8SA 2OZ2A 3D6SA 1Q6KA 4P6EA 2MT5A 3E2DA 1THEA 5CVOB 1WENA 2C2VS 4AP4A 2VPGA 1PPPA 2AYOA 4O62A 5TRBA 2DJAA 4A4CA 3HTKC 1DEUA 2ECJA 3SHBA 4V3LC 1CB5A 1PBHA 1ME4A 2OULA 3PRPA 3P5XA 2K17A 2AVWA 2FUDA 4OW0A 3O65A 2YSMA 4X6HA 5TBNA 2VPEA 2H7JA 1BQIA 2ECIA 4WA6A 2Y1MA 2BAYA 4MI7A 5AITA 5SVXA 1AU3A 2DX8A 3LFYA 3PBHA 2BDZA 2E61A 1DCQA 1QDQA 2DC7A 3PLWA 4PT5A 2FRAA 4A49A 4W5BA 2KYUA 3ZTGA 3GV4A 3ZPVE 1QXPA 1X4JA 5FB1A 1MBMA 2HD5A 4KLBA 2DJGB 4X3GA 5EZSA 2CRWA 4YYVA 2EXUA 5CVMA 4AXLA 2VP7A 2XP0A 2QJ0A 2L7PA 2D8UA 2M85A 1KHQA 4OEMA 2YJ8A 3N3GA 3O35A 1PPDA 2OXQC 1JOCA 1SP4B 1MEMA 2R6NA 4CCGX 2F1GA 2DCAA 1FBVA 1QOLA 4BOSA 2EA6A 4Q6FA 1DKIA 3OVXA 3RPGC 1WEPA 4FIPA 4CDFB 1QMYA 4I04A 1ME3A 3MDBC 4RKXA 4WZ3B 3I2DA 1KXRA 2FO5A 3C6WA 3HWNA 5E6JA 4YYQA 2C2LA 3LQJA 4CDDB 3IMAA 3U8EA 2YQLA 1TLOA 3IV2A 4R3DA 3FAOA 2LXHC 2L75A 2AU1A 3QZVA 5H1UA 1WEWA 2E01A 2R9FA 4BPVA 3C9EA 4QQ4A 3W30A 2G6DA 5B79A 2KREA 2FD4A 2GFOA 2AS8A 3H8CA 4IP3A 5A24A 5CHTA 2E6SA 1EWPA 2E03A 2KWKA 2G7YA 4L58A 3SOWA 2HXZA 2P86A 2VJFA 3VK6A 5LKXA 4YADA 5FPWA 2JTCA 3PDFA 3RPGB 3NHEA 3EB5A 1BP4A 5DKAA 1PADA 4YYSA 2CKLA 5FB0A 4N8WA 4PPEA 1BY8A 2ECTA 3O37A 3PURA 4MZOA 5EF4A 3H7DA 1PXVA 2M3HA 3LJUX 1GMYA 2BDLA 2WBFX 2Y43A 3E9SA 4OVZA 4F1PA 5SVIB 4BOPA 3TRKA 5JG6A 4Z0RA 2LGKA 4RNAA 2MNZA 1CS8A 1YK8A 2KWNA 1X4IA 3B79A 3I06A 5LKTA 5KH7A 3LVQE 2FRQA 3T7LA 4BHWA 3WXFA 5TDWA 2JUNA 1PPOA 3BB7A 1WEVA 3O36A 3U5MA 2ECWA 2L80A 5J3XA 4QBBA 1Y08A 3L1ZB 4R8PK 2HDPA 4N3WA 4UP5A 1WE9A 3ZUAA 2YHNA 1NB3A 1U6GB 4QRXA 1Z6UA 3CH2X 3PNRA 5G0FA 2ECNA 4ZDTA 1IWDA 5D1LB 4YYRA 4ZQLA 3LVRE 1Y4HA 4BOZA 1U9QX 2KR4A 3LQIA 4S3OC 5B8DA 2CIOA 3H89A 2UZJA 3TNXA 4REZA 4YBTA 1POPA 1CSBB 2LGLA 1SNKA 2XOYA 2LRIC 3ZVYA 2OP3A 8PCHA 4O64A 2LV9A 4XI1A 4I7BA 5K16A 2XEUA 1K3BB 3BPMA 1F2BA 3DF0A 1NB5A 1M6DA 4B7YC 1BORA 3O7AA 2DJFB 3S3RA 4MSXA 4RF0A 2P0RA 5EZQA 4UI9B 4CA1A 3JUEA 2PUYA 4CDEB 2DCBA 1ZIVA 3MTVA 5LCWB 1JM7A 2F6NA 2DSMA 2VJEA 2NAAA 4AUQB 4W4UA 2UZGA 5CVNB 2YUCA 3KX1A 2YJCA 4S3OB 2MA6A 3E1ZB 4OVZB 3F75A 3FL2A 5K3QA 3LXSA 3SUBA 2NQAA 2KFTA 4X6IA 3KDEC 3HD3A 2L0BA 4I7DA 4IC2A 1XKGA 5SVYA 2K16A 1X4UA 2DCCA 5CHVA 4BBQA 1T1HA 2M1RA 2J7QA 5TDRA 2JQFR 2LQ6A 3M62A 1LDJB 3RVWA 4BS6A 5PADA 2NQDB 2K4DA 4I05A 4FK5A 2VPBA 4PADA 2K1JA 2KGGA 4M0WA 2AGAA 1KFUL 3BPFA 1GCBA 4D8IA 1ITOA 2JMJA 1JQPA 3FM8C 5C13A 3T9KA 2YJ9A 3RNVA 2LN0A 1YZBA 3K9MA 1EF7A 3BC3A 4PP1A 2PNXA 2YHOA 5G05B 4RY2A 3IFUA 5EGWA 1AU0A 3ZPV1 5H9MA 2O6XA 3H6SA 2RSDA 2YQMA 1WEMA 5H1TA 3HHIA 3IUTA 3O47A 2Y1NA 4GNDA 2PBHA 2XU3A 4D8BA 4YYUA 2FSAA 3L11A 4MM3B 4RF1A 3HCUA 1CQDA 3K24A 1AECA 2FUUA 2YYRA 2R9OA 3OF8A 4YC9A 3IOQA 2YVRA 2MD8C 2IDAA 1YVBA 2IQJA 1JM7B 1XWHA 2VJEB 1BGOA 5J94A 1WEUA 3U5PA 3B21A 3F5VA 3OQCA 4N4ZA 2JRJA 3L1XA 2BTWA 3PHWA 5KO3A 2XU1A 4R2YA 3OVZA 1YALA 3HCTA 1CV8A 1ICFA 2AYNA 4L7XA 1PCIA 2B1MA 2PADA 3O0UA 6PADA 5JA7A 5F02A 2MUMA 1U5IA 1F2AA 2DZYA 2G8EA 4Z0OA 3MJ5A 4I07A 1MDWA 3LQHA 3V6EA 2P7UA 4DMYA 2CRRA 5B78A 1VFYA 4PTBA 3MHHA 4QRGA 2FTDA 3RVXA 3V6CA 3NG2A 4GNGA 1U9WA 1AU2A 1HUCB 4UP0A 3K8UA 4QH6A 2E6RA 4DMXA 2ECVA 3HCSA 4BS5A 2EGPA 4AVXA 4YVAA 3DQVR 2F7DA 1AIMA 2VHSA 1IYMA 3KKUA 3KWBX 1WEQA 2FQ9A 5LKZA 3O1GA 4IC3A 3P5WA 2F6JA 3N9NA 4YAXA 1UKFA 3C0RA 4HXDB 3C5KA 2FE8A 3QJ3A 1KFXL 2FUIA 1YK7A 3S3QA 3PUQA 2JM3A
chains in the Genus database with same CATH topology
4GNFA 1K2FA 1VYXA 2C0YA 4AYCA 2ACTA 1MHWA 2YT5A 1VD4A 1CHCA 3CBKA 2EODA 5B76A 1WEEA 5C11A 2YU4A 2M6MA 2XU5A 1N87A 3MTNA 4NV7A 2LDRA 2PREA 1AU4A 2I50A 1VJVA 2IBIA 4YBSA 2JMDA 1EWMA 2DCDA 2KU3A 4GB0A 3N9QA 1NQCA 2DC9A 3EB6A 3N9MA 4V3KC 2VJFB 4QRVA 1Z2QA 2ATOA 1E4UA 1PE6A 3KW9A 5H1VA 1MEGA 4W5CA 4NV8A 2CKLB 3ERVA 2AUZA 2CSYA 2HH5A 2Y5BA 5KH9A 2R9CA 3AI8A 2MA5A 1VSNA 3ASLA 2CSZA 3KV6A 1F29A 5EYAF 2QICA 2L43A 3CBJA 3QSDA 2CT2A 2YJ2A 3KFQA 4I7CA 2NQIA 4YBMA 1MIRA 3N9PA 1CTEA 3CH3X 4K7CA 3V43A 2F42A 1X9YA 2ECGA 4QF3A 3SOUA 4N79A 3WXEA 3M63A 1WGMA 4C5PA 4YV8A 4PP2E 4R7EA 2VHFA 3BWKA 3T6RA 3IHPA 2VPDA 2XU4A 1WESA 3I3TA 2MNYA 1PPNA 3RTRB 2YREA 5FERA 3GL6A 1WILA 4N4FA 1NL6A 2VNFA 4TKPB 3U5NA 1AYUA 1NPZA 1ZBDB 3BOWA 5D1KB 2ARYA 4LADB 3N9OA 1FH0A 9PAPA 3O70A 5G04B 3MHSA 3PHDA 5TABA 2HHNA 1CVZA 1F2CA 2E00A 3P5VA 4AYCB 4C9ZA 2MD7B 3HHAA 1GECE 4CDCB 2E02A 7PCKA 2AUXA 2L5UA 2FYEA 3KNVA 2KGIA 2YSJA 3KSEA 1F62A 2KWOA 1CJLA 1HYJA 4FJCA 1A6RA 3ZVZB 5FEYA 4WZ2A 2G45A 1MM3A 2IPPB 4YYWA 1FP0A 3N9LA 1DF0A 1RMDA 4A4BA 2Y6EA 1MS6A 1O0EA 1LDKC 2JMIA 4Q8GA 3DPLR 5DINA 2H0DA 3O33A 1Z60A 2DC8A 1MM2A 2LGVA 2QIZA 4XUIA 3N3KA 4QF2A 2AN6A 1AYVA 1U9VA 3KWZA 5AIUA 4WZ0A 3M99A 2AIMA 3LRQA 4LLBA 4P5OB 2R9NA 1S4VA 2DZZA 5JH3A 4A0CD 5LKUA 1WFKA 2NQGA 2G6QA 1HYIA 2KIZA 4X6JA 1ZCMA 3N4CA 3U5OA 3O34A 2CB5A 1CPJA 2XB1A 1EWLA 1ATKA 2RI7A 4NN2A 1KHPA 1G25A 2PNSA 1WIMA 3SOXA 3BCNA 4YABA 1TL9A 3USVA 2ZETC 3MORA 1EWOA 3GCBA 1GLOA 4P6GA 4GNEA 1STFE 2FT2A 4MVTA 1DVPA 2R9MA 4HWYA 1W6FA 1PIPA 4PI3A 4LK9A 4LKAA 1YT7A 3ZNIA 4BQVA 1U9XA 2G43A 2YW8A 5KH3A 3KQIA 4B86C 1WEOA 2KE1A 3KV5A 2B1NA 5I3LA 2GHUA 3H8BA 5B77A 5D1MB 1V87A 3ZYQA 2JQGR 4BSQA 5B75A 3WXGA 2KWJA 4MZSA 4CZWA 1TU6A 1E2TA 4ZUXU 1NLJA 2YJBA 4FO9A 4AXMA 3IEJA 4OELA 2H0DB 3RVVA 4G54A 2LGGA 1AYWA 3QT4A 3OISA 4LJNA 2LXPC 2DC6A 3P5UA 3PW3A 3OF9A 2YURA 4Q8HA 2HYED 4F52B 2MIQA 4YATA 2VFBA 2G8JA 4XR7A 2D8SA 2OZ2A 3D6SA 1Q6KA 4P6EA 2MT5A 1THEA 5CVOB 1WENA 2C2VS 4AP4A 2VPGA 1PPPA 2AYOA 5TRBA 4A4CA 3HTKC 1DEUA 2ECJA 3SHBA 4V3LC 1CB5A 1PBHA 1ME4A 2OULA 3P5XA 2K17A 2AVWA 2FUDA 2YSMA 4X6HA 5TBNA 2VPEA 2H7JA 1BQIA 2ECIA 4WA6A 2Y1MA 2BAYA 5AITA 1AU3A 2DX8A 3LFYA 3PBHA 2BDZA 2DC7A 1QDQA 4W5BA 2FRAA 4A49A 2KYUA 3ZTGA 3GV4A 3ZPVE 1QXPA 1X4JA 5FB1A 4KLBA 2HD5A 2DJGB 4X3GA 4YYVA 5CVMA 4AXLA 2VP7A 2QJ0A 2M85A 1KHQA 4OEMA 2YJ8A 3N3GA 3O35A 1PPDA 2OXQC 1JOCA 1SP4B 1MEMA 2R6NA 4CCGX 2F1GA 2DCAA 1FBVA 1QOLA 2EA6A 4Q6FA 3OVXA 3RPGC 1WEPA 4FIPA 4CDFB 1QMYA 4I04A 1ME3A 4WZ3B 3I2DA 1KXRA 2FO5A 3C6WA 3HWNA 4YYQA 2C2LA 3LQJA 4CDDB 3IMAA 3U8EA 2YQLA 1TLOA 1W4TA 3IV2A 2LXHC 2L75A 2AU1A 3QZVA 5H1UA 1WEWA 2E01A 2R9FA 4BPVA 4B55A 3C9EA 2G6DA 5B79A 2KREA 2GFOA 5A24A 2AS8A 3H8CA 5CHTA 2E6SA 1EWPA 2E03A 2KWKA 2G7YA 4L58A 3SOWA 2HXZA 2P86A 2VJFA 3VK6A 5LKXA 4YADA 5FPWA 3PDFA 3RPGB 3NHEA 3EB5A 1BP4A 5DKAA 1PADA 4YYSA 2CKLA 5FB0A 4N8WA 4PPEA 1BY8A 2ECTA 3O37A 3PURA 4MZOA 5EF4A 3H7DA 1PXVA 2M3HA 1GMYA 2BDLA 2WBFX 2Y43A 5JG6A 2LGKA 2MNZA 1CS8A 1YK8A 2KWNA 1X4IA 3B79A 3I06A 5LKTA 5KH7A 2FRQA 3WXFA 3T7LA 4BHWA 5TDWA 1PPOA 1WEVA 3O36A 3U5MA 2ECWA 2L80A 5J3XA 4QBBA 1Y08A 3L1ZB 4R8PK 2HDPA 4N3WA 4UP5A 1WE9A 3ZUAA 2YHNA 1NB3A 1U6GB 4QRXA 1Z6UA 3CH2X 3PNRA 5G0FA 2ECNA 4ZDTA 1IWDA 5D1LB 4YYRA 4ZQLA 1Y4HA 1U9QX 2KR4A 3LQIA 4S3OC 5B8DA 2CIOA 3H89A 3TNXA 4YBTA 1POPA 1CSBB 2LGLA 1SNKA 3ZVYA 2LRIC 2OP3A 8PCHA 4O64A 2LV9A 4XI1A 4I7BA 5K16A 2XEUA 1K3BB 3BPMA 1F2BA 3DF0A 1NB5A 1M6DA 4B7YC 1BORA 3O7AA 4BGFA 2DJFB 3S3RA 4MSXA 2P0RA 4UI9B 4CA1A 2PUYA 4CDEB 2DCBA 1ZIVA 5LCWB 1JM7A 2F6NA 2VJEA 2NAAA 4AUQB 4W4UA 2UZGA 5CVNB 2YUCA 3KX1A 2YJCA 4S3OB 2MA6A 3E1ZB 3F75A 3FL2A 3LXSA 2NQAA 4X6IA 2KFTA 3D9WA 3HD3A 2L0BA 4I7DA 4IC2A 1XKGA 2K16A 1X4UA 3LTWA 2DCCA 5CHVA 4BBQA 1T1HA 2M1RA 5TDRA 2JQFR 2LQ6A 3M62A 1LDJB 3RVWA 4BS6A 5PADA 2NQDB 2K4DA 4I05A 4FK5A 1GX3A 2VPBA 4PADA 2K1JA 2KGGA 1KFUL 3BPFA 1GCBA 1ITOA 2JMJA 1JQPA 5C13A 2YJ9A 2LN0A 3K9MA 1EF7A 3BC3A 4PP1A 2PNXA 2YHOA 5G05B 4RY2A 5EGWA 1AU0A 4GUZA 3ZPV1 5H9MA 2O6XA 3H6SA 2RSDA 2YQMA 1WEMA 5H1TA 3HHIA 3IUTA 4GNDA 2Y1NA 4YYUA 2PBHA 2XU3A 2FSAA 3L11A 3HCUA 1CQDA 3K24A 1AECA 2FUUA 2YYRA 2R9OA 3OF8A 4YC9A 3IOQA 2BSZA 2MD8C 2IDAA 1YVBA 1JM7B 1XWHA 2VJEB 1BGOA 5J94A 2VFCA 1WEUA 3U5PA 3F5VA 4N4ZA 2JRJA 3L1XA 2XU1A 4R2YA 3OVZA 1YALA 3HCTA 1CV8A 1ICFA 2AYNA 4L7XA 1PCIA 2B1MA 2PADA 3O0UA 6PADA 5JA7A 5F02A 2MUMA 1U5IA 1F2AA 2DZYA 2G8EA 4I07A 1MDWA 3LQHA 3V6EA 2P7UA 4DMYA 5B78A 1VFYA 4PTBA 3MHHA 4QRGA 2FTDA 3RVXA 3V6CA 1W5RA 3NG2A 4GNGA 1U9WA 1AU2A 1HUCB 4UP0A 3K8UA 4QH6A 2E6RA 4DMXA 2ECVA 3HCSA 4BS5A 2EGPA 4AVXA 4YVAA 3DQVR 2F7DA 1AIMA 2VHSA 1IYMA 3KKUA 3KWBX 1WEQA 2FQ9A 5LKZA 3O1GA 4IC3A 3P5WA 2F6JA 3N9NA 4YAXA 3C5KA 3QJ3A 1KFXL 2FUIA 1YK7A 3S3QA 3PUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNF A;  1K2F A;  1VYX A;  2C0Y A;  4AYC A;  2ACT A;  1MHW A;  2YT5 A;  1VD4 A;  1CHC A;  3CBK A;  2EOD A;  5B76 A;  1WEE A;  5C11 A;  2YU4 A;  2M6M A;  2XU5 A;  1N87 A;  3MTN A;  2LDR A;  2PRE A;  1AU4 A;  2I50 A;  1VJV A;  2IBI A;  4YBS A;  2JMD A;  1EWM A;  2DCD A;  2KU3 A;  4GB0 A;  3N9Q A;  1NQC A;  2DC9 A;  3EB6 A;  3N9M A;  4V3K C;  2VJF B;  4QRV A;  1Z2Q A;  2ATO A;  1E4U A;  1PE6 A;  3KW9 A;  5H1V A;  1MEG A;  4W5C A;  2CKL B;  3ERV A;  2AUZ A;  2CSY A;  2HH5 A;  2Y5B A;  5KH9 A;  2R9C A;  3AI8 A;  2MA5 A;  1VSN A;  3ASL A;  2CSZ A;  3KV6 A;  1F29 A;  5EYA F;  2QIC A;  2L43 A;  3CBJ A;  3QSD A;  2CT2 A;  2YJ2 A;  3KFQ A;  4I7C A;  2NQI A;  4YBM A;  1MIR A;  3N9P A;  1CTE A;  3CH3 X;  4K7C A;  3V43 A;  2F42 A;  1X9Y A;  2ECG A;  4QF3 A;  3SOU A;  4N79 A;  3WXE A;  3M63 A;  1WGM A;  4YV8 A;  4PP2 E;  4R7E A;  2VHF A;  3BWK A;  3T6R A;  3IHP A;  2VPD A;  2XU4 A;  1WES A;  3I3T A;  2MNY A;  1PPN A;  3RTR B;  2YRE A;  5FER A;  3GL6 A;  1WIL A;  4N4F A;  1NL6 A;  2VNF A;  4TKP B;  3U5N A;  1AYU A;  1NPZ A;  1ZBD B;  3BOW A;  5D1K B;  2ARY A;  4LAD B;  3N9O A;  1FH0 A;  9PAP A;  3O70 A;  5G04 B;  3MHS A;  3PHD A;  5TAB A;  2HHN A;  1CVZ A;  1F2C A;  2E00 A;  3P5V A;  4AYC B;  4C9Z A;  2MD7 B;  3HHA A;  1GEC E;  4CDC B;  2E02 A;  7PCK A;  2AUX A;  2L5U A;  2FYE A;  3KNV A;  2KGI A;  2YSJ A;  3KSE A;  1F62 A;  2KWO A;  1CJL A;  1HYJ A;  4FJC A;  1A6R A;  3ZVZ B;  5FEY A;  4WZ2 A;  2G45 A;  1MM3 A;  2IPP B;  4YYW A;  1FP0 A;  3N9L A;  1DF0 A;  1RMD A;  4A4B A;  2Y6E A;  1MS6 A;  1O0E A;  1LDK C;  2JMI A;  4Q8G A;  3DPL R;  5DIN A;  2H0D A;  3O33 A;  1Z60 A;  2DC8 A;  1MM2 A;  2LGV A;  2QIZ A;  4XUI A;  3N3K A;  4QF2 A;  2AN6 A;  1AYV A;  1U9V A;  3KWZ A;  5AIU A;  4WZ0 A;  3M99 A;  2AIM A;  3LRQ A;  4LLB A;  4P5O B;  2R9N A;  1S4V A;  2DZZ A;  5JH3 A;  4A0C D;  5LKU A;  1WFK A;  2NQG A;  2G6Q A;  1HYI A;  2KIZ A;  4X6J A;  1ZCM A;  3N4C A;  3U5O A;  3O34 A;  2CB5 A;  1CPJ A;  2XB1 A;  1EWL A;  1ATK A;  2RI7 A;  4NN2 A;  1KHP A;  1G25 A;  2PNS A;  1WIM A;  3SOX A;  3BCN A;  4YAB A;  1TL9 A;  3USV A;  2ZET C;  3MOR A;  1EWO A;  3GCB A;  1GLO A;  4P6G A;  4GNE A;  1STF E;  2FT2 A;  4MVT A;  1DVP A;  2R9M A;  4HWY A;  1PIP A;  4PI3 A;  4LK9 A;  4LKA A;  1YT7 A;  3ZNI A;  4BQV A;  1U9X A;  2G43 A;  2YW8 A;  5KH3 A;  3KQI A;  4B86 C;  1WEO A;  2KE1 A;  3KV5 A;  2B1N A;  5I3L A;  2GHU A;  3H8B A;  5B77 A;  5D1M B;  1V87 A;  3ZYQ A;  2JQG R;  4BSQ A;  5B75 A;  3WXG A;  2KWJ A;  4MZS A;  4CZW A;  1TU6 A;  4ZUX U;  1NLJ A;  2YJB A;  4FO9 A;  4AXM A;  3IEJ A;  4OEL A;  2H0D B;  3RVV A;  4G54 A;  2LGG A;  1AYW A;  3QT4 A;  3OIS A;  4LJN A;  2LXP C;  2DC6 A;  3P5U A;  3PW3 A;  3OF9 A;  2YUR A;  4Q8H A;  2HYE D;  4F52 B;  2MIQ A;  4YAT A;  2G8J A;  4XR7 A;  2D8S A;  2OZ2 A;  3D6S A;  1Q6K A;  4P6E A;  2MT5 A;  1THE A;  5CVO B;  1WEN A;  2C2V S;  4AP4 A;  2VPG A;  1PPP A;  2AYO A;  5TRB A;  4A4C A;  3HTK C;  1DEU A;  2ECJ A;  3SHB A;  4V3L C;  1CB5 A;  1PBH A;  1ME4 A;  2OUL A;  3P5X A;  2K17 A;  2AVW A;  2FUD A;  2YSM A;  4X6H A;  5TBN A;  2VPE A;  2H7J A;  1BQI A;  2ECI A;  4WA6 A;  2Y1M A;  2BAY A;  5AIT A;  1AU3 A;  2DX8 A;  3LFY A;  3PBH A;  2BDZ A;  2DC7 A;  1QDQ A;  4W5B A;  2FRA A;  4A49 A;  2KYU A;  3ZTG A;  3GV4 A;  3ZPV E;  1QXP A;  1X4J A;  5FB1 A;  4KLB A;  2HD5 A;  2DJG B;  4X3G A;  4YYV A;  5CVM A;  4AXL A;  2VP7 A;  2QJ0 A;  2M85 A;  1KHQ A;  4OEM A;  2YJ8 A;  3N3G A;  3O35 A;  1PPD A;  2OXQ C;  1JOC A;  1SP4 B;  1MEM A;  2R6N A;  4CCG X;  2F1G A;  2DCA A;  1FBV A;  1QOL A;  2EA6 A;  4Q6F A;  3OVX A;  3RPG C;  1WEP A;  4FIP A;  4CDF B;  1QMY A;  4I04 A;  1ME3 A;  4WZ3 B;  3I2D A;  1KXR A;  2FO5 A;  3C6W A;  3HWN A;  4YYQ A;  2C2L A;  3LQJ A;  4CDD B;  3IMA A;  3U8E A;  2YQL A;  1TLO A;  3IV2 A;  2LXH C;  2L75 A;  2AU1 A;  3QZV A;  5H1U A;  1WEW A;  2E01 A;  2R9F A;  4BPV A;  3C9E A;  2G6D A;  5B79 A;  2KRE A;  2GFO A;  5A24 A;  2AS8 A;  3H8C A;  5CHT A;  2E6S A;  1EWP A;  2E03 A;  2KWK A;  2G7Y A;  4L58 A;  3SOW A;  2HXZ A;  2P86 A;  2VJF A;  3VK6 A;  5LKX A;  4YAD A;  5FPW A;  3PDF A;  3RPG B;  3NHE A;  3EB5 A;  1BP4 A;  5DKA A;  1PAD A;  4YYS A;  2CKL A;  5FB0 A;  4N8W A;  4PPE A;  1BY8 A;  2ECT A;  3O37 A;  3PUR A;  4MZO A;  5EF4 A;  3H7D A;  1PXV A;  2M3H A;  1GMY A;  2BDL A;  2WBF X;  2Y43 A;  5JG6 A;  2LGK A;  2MNZ A;  1CS8 A;  1YK8 A;  2KWN A;  1X4I A;  3B79 A;  3I06 A;  5LKT A;  5KH7 A;  2FRQ A;  3WXF A;  3T7L A;  4BHW A;  5TDW A;  1PPO A;  1WEV A;  3O36 A;  3U5M A;  2ECW A;  2L80 A;  5J3X A;  4QBB A;  1Y08 A;  3L1Z B;  4R8P K;  2HDP A;  4N3W A;  4UP5 A;  1WE9 A;  3ZUA A;  2YHN A;  1NB3 A;  1U6G B;  4QRX A;  1Z6U A;  3CH2 X;  3PNR A;  5G0F A;  2ECN A;  4ZDT A;  1IWD A;  5D1L B;  4YYR A;  4ZQL A;  1Y4H A;  1U9Q X;  2KR4 A;  3LQI A;  4S3O C;  5B8D A;  2CIO A;  3H89 A;  3TNX A;  4YBT A;  1POP A;  1CSB B;  2LGL A;  1SNK A;  3ZVY A;  2LRI C;  2OP3 A;  8PCH A;  4O64 A;  2LV9 A;  4XI1 A;  4I7B A;  5K16 A;  2XEU A;  1K3B B;  3BPM A;  1F2B A;  3DF0 A;  1NB5 A;  1M6D A;  4B7Y C;  1BOR A;  3O7A A;  2DJF B;  3S3R A;  4MSX A;  2P0R A;  4UI9 B;  4CA1 A;  2PUY A;  4CDE B;  2DCB A;  1ZIV A;  5LCW B;  1JM7 A;  2F6N A;  2VJE A;  2NAA A;  4AUQ B;  4W4U A;  2UZG A;  5CVN B;  2YUC A;  3KX1 A;  2YJC A;  4S3O B;  2MA6 A;  3E1Z B;  3F75 A;  3FL2 A;  3LXS A;  2NQA A;  4X6I A;  2KFT A;  3HD3 A;  2L0B A;  4I7D A;  4IC2 A;  1XKG A;  2K16 A;  1X4U A;  2DCC A;  5CHV A;  4BBQ A;  1T1H A;  2M1R A;  5TDR A;  2JQF R;  2LQ6 A;  3M62 A;  1LDJ B;  3RVW A;  4BS6 A;  5PAD A;  2NQD B;  2K4D A;  4I05 A;  4FK5 A;  2VPB A;  4PAD A;  2K1J A;  2KGG A;  1KFU L;  3BPF A;  1GCB A;  1ITO A;  2JMJ A;  1JQP A;  5C13 A;  2YJ9 A;  2LN0 A;  3K9M A;  1EF7 A;  3BC3 A;  4PP1 A;  2PNX A;  2YHO A;  5G05 B;  4RY2 A;  5EGW A;  1AU0 A;  3ZPV 1;  5H9M A;  2O6X A;  3H6S A;  2RSD A;  2YQM A;  1WEM A;  5H1T A;  3HHI A;  3IUT A;  4GND A;  2Y1N A;  4YYU A;  2PBH A;  2XU3 A;  2FSA A;  3L11 A;  3HCU A;  1CQD A;  3K24 A;  1AEC A;  2FUU A;  2YYR A;  2R9O A;  3OF8 A;  4YC9 A;  3IOQ A;  2MD8 C;  2IDA A;  1YVB A;  1JM7 B;  1XWH A;  2VJE B;  1BGO A;  5J94 A;  1WEU A;  3U5P A;  3F5V A;  4N4Z A;  2JRJ A;  3L1X A;  2XU1 A;  4R2Y A;  3OVZ A;  1YAL A;  3HCT A;  1CV8 A;  1ICF A;  2AYN A;  4L7X A;  1PCI A;  2B1M A;  2PAD A;  3O0U A;  6PAD A;  5JA7 A;  5F02 A;  2MUM A;  1U5I A;  1F2A A;  2DZY A;  2G8E A;  4I07 A;  1MDW A;  3LQH A;  3V6E A;  2P7U A;  4DMY A;  5B78 A;  1VFY A;  4PTB A;  3MHH A;  4QRG A;  2FTD A;  3RVX A;  3V6C A;  3NG2 A;  4GNG A;  1U9W A;  1AU2 A;  1HUC B;  4UP0 A;  3K8U A;  4QH6 A;  2E6R A;  4DMX A;  2ECV A;  3HCS A;  4BS5 A;  2EGP A;  4AVX A;  4YVA A;  3DQV R;  2F7D A;  1AIM A;  2VHS A;  1IYM A;  3KKU A;  3KWB X;  1WEQ A;  2FQ9 A;  5LKZ A;  3O1G A;  4IC3 A;  3P5W A;  2F6J A;  3N9N A;  4YAX A;  3C5K A;  3QJ3 A;  1KFX L;  2FUI A;  1YK7 A;  3S3Q A;  3PUQ A; 
#chains in the Genus database with same CATH topology
 4GNF A;  1K2F A;  2KKX A;  2P57 A;  1VYX A;  2C0Y A;  4AYC A;  2ACT A;  1MHW A;  2YT5 A;  1VD4 A;  1CHC A;  3W31 A;  3CBK A;  2EOD A;  5B76 A;  1WEE A;  5C11 A;  2RR4 A;  2M6M A;  2YU4 A;  2XU5 A;  1N87 A;  3MTN A;  2LDR A;  4OGE A;  1AU4 A;  2I50 A;  1VJV A;  2IBI A;  4YBS A;  2JMD A;  2PRE A;  2CSV A;  1EWM A;  2DCD A;  2KU3 A;  4GB0 A;  3N9Q A;  3BBA A;  1NQC A;  2DC9 A;  3EB6 A;  3N9M A;  4V3K C;  2VJF B;  4QRV A;  1Z2Q A;  2ATO A;  1E4U A;  3M7K A;  1PE6 A;  3KW9 A;  5H1V A;  1MEG A;  4W5C A;  3PT2 A;  2CKL B;  3ERV A;  2AUZ A;  2CSY A;  2HH5 A;  2Y5B A;  5KH9 A;  2R9C A;  3AI8 A;  3RVV A;  2MA5 A;  1VSN A;  3ASL A;  2CSZ A;  3KV6 A;  1F29 A;  5EYA F;  2QIC A;  2L43 A;  3CBJ A;  3QSD A;  3DDT A;  2CT2 A;  2YJ2 A;  3KFQ A;  4I7C A;  2NQI A;  4YBM A;  1MIR A;  3N9P A;  1CTE A;  3CH3 X;  4K7C A;  3V43 A;  2F42 A;  1X9Y A;  3ZNH A;  2ECG A;  4QF3 A;  5JZE A;  3SOU A;  4N79 A;  4A5U A;  3WXE A;  2M13 A;  3M63 A;  1WGM A;  4YV8 A;  4PP2 E;  4P16 A;  4WUR A;  4R7E A;  2VHF A;  3BWK A;  3T6R A;  3IHP A;  2VPD A;  2XU4 A;  1WES A;  3I3T A;  2MNY A;  1PPN A;  3RTR B;  2YRE A;  5FER A;  3GL6 A;  1WIL A;  4N4F A;  1NL6 A;  2VNF A;  4TKP B;  3U5N A;  1AYU A;  1NPZ A;  1ZBD B;  3BOW A;  5D1K B;  3LDY A;  4LAD B;  3N9O A;  2ARY A;  2EGM A;  1FH0 A;  5SVI A;  9PAP A;  3O70 A;  5G04 B;  3MHS A;  3PHD A;  5TAB A;  2HHN A;  1CVZ A;  1F2C A;  2E00 A;  3P5V A;  4AYC B;  4C9Z A;  2DOS A;  4IUM A;  3FEH A;  2XOC A;  2MD7 B;  3HHA A;  1GEC E;  4CDC B;  2E02 A;  3PSE A;  7PCK A;  2AUX A;  2L5U A;  2FYE A;  3KNV A;  2KGI A;  2YSJ A;  3KSE A;  1F62 A;  2KWO A;  1CJL A;  1HYJ A;  4D8E A;  4FJC A;  2J7Q C;  1A6R A;  3ZVZ B;  5FEY A;  4WZ2 A;  2G45 A;  1MM3 A;  2IPP B;  4YYW A;  1FP0 A;  3N9L A;  1DF0 A;  1RMD A;  4A4B A;  2OWA A;  2Y6E A;  3PHX A;  1MS6 A;  1O0E A;  1LDK C;  2JMI A;  1PVJ A;  4Q8G A;  3DPL R;  5DIN A;  2H0D A;  3O33 A;  1Z60 A;  2DC8 A;  1MM2 A;  2LGV A;  2QIZ A;  4H9D A;  4XUI A;  3N3K A;  4QF2 A;  2AN6 A;  1AYV A;  1U9V A;  2Z84 A;  3KWZ A;  5AIU A;  3H7H A;  4WZ0 A;  3M99 A;  2AIM A;  3LRQ A;  4LLB A;  4P5O B;  2JRI A;  2R9N A;  1S4V A;  2DZZ A;  3PRM A;  5JH3 A;  4A0C D;  5LKU A;  1WFK A;  2NQG A;  2G6Q A;  1HYI A;  2KIZ A;  4X6J A;  2CON A;  2LAU A;  1ZCM A;  3N4C A;  3U5O A;  3O34 A;  2CB5 A;  1CPJ A;  2FFW A;  2XB1 A;  1EWL A;  1ATK A;  2RI7 A;  4NN2 A;  1KHP A;  1G25 A;  2PNS A;  1WIM A;  3SOX A;  3BCN A;  4YAB A;  1TL9 A;  3USV A;  2ZET C;  3BY4 A;  3MOR A;  1EWO A;  3GCB A;  1GLO A;  4P6G A;  4GNE A;  1STF E;  2FT2 A;  4MVT A;  1DVP A;  2R9M A;  4HWY A;  3TMP A;  1PIP A;  4PI3 A;  4LK9 A;  2BU3 A;  4LKA A;  3FAN A;  3FJU B;  1YT7 A;  3ZNI A;  4BQV A;  1U9X A;  2G43 A;  2YW8 A;  5KH3 A;  3KQI A;  2HWK A;  4B86 C;  2XOZ A;  4BOQ A;  1WEO A;  2KE1 A;  3KV5 A;  2B1N A;  5I3L A;  2GHU A;  3H8B A;  5B77 A;  3DWD A;  5D1M B;  1V87 A;  3ZYQ A;  2JQG R;  4BSQ A;  5B75 A;  3WXG A;  2KWJ A;  4MZS A;  3MP2 A;  2MKE A;  3Q1D A;  4CZW A;  1TU6 A;  2BTW B;  4ZUX U;  1NLJ A;  2YJB A;  4FO9 A;  4AXM A;  3IEJ A;  4OEL A;  2H0D B;  3PHU A;  4G54 A;  4XZX A;  2LGG A;  1AYW A;  3QT4 A;  3OIS A;  4LJN A;  2LXP C;  2DC6 A;  3P5U A;  3PW3 A;  4GUA A;  3OF9 A;  2YUR A;  4Q8H A;  2HYE D;  2KKY A;  4F52 B;  2MIQ A;  4YAT A;  2B0O E;  4BOU A;  4OGC A;  2G8J A;  4XR7 A;  4ZTB A;  2D8S A;  2OZ2 A;  3D6S A;  1Q6K A;  4P6E A;  2MT5 A;  3E2D A;  1THE A;  5CVO B;  1WEN A;  2C2V S;  4AP4 A;  2VPG A;  1PPP A;  2AYO A;  4O62 A;  5TRB A;  2DJA A;  4A4C A;  3HTK C;  1DEU A;  2ECJ A;  3SHB A;  4V3L C;  1CB5 A;  1PBH A;  1ME4 A;  2OUL A;  3PRP A;  3P5X A;  2K17 A;  2AVW A;  2FUD A;  4OW0 A;  3O65 A;  2YSM A;  4X6H A;  5TBN A;  2VPE A;  2H7J A;  1BQI A;  2ECI A;  4WA6 A;  2Y1M A;  2BAY A;  4MI7 A;  5AIT A;  5SVX A;  1AU3 A;  2DX8 A;  3LFY A;  3PBH A;  2BDZ A;  2E61 A;  1DCQ A;  1QDQ A;  2DC7 A;  3PLW A;  4PT5 A;  2FRA A;  4A49 A;  4W5B A;  2KYU A;  3ZTG A;  3GV4 A;  3ZPV E;  1QXP A;  1X4J A;  5FB1 A;  1MBM A;  2HD5 A;  4KLB A;  2DJG B;  4X3G A;  5EZS A;  2CRW A;  4YYV A;  2EXU A;  5CVM A;  4AXL A;  2VP7 A;  2XP0 A;  2QJ0 A;  2L7P A;  2D8U A;  2M85 A;  1KHQ A;  4OEM A;  2YJ8 A;  3N3G A;  3O35 A;  1PPD A;  2OXQ C;  1JOC A;  1SP4 B;  1MEM A;  2R6N A;  4CCG X;  2F1G A;  2DCA A;  1FBV A;  1QOL A;  4BOS A;  2EA6 A;  4Q6F A;  1DKI A;  3OVX A;  3RPG C;  1WEP A;  4FIP A;  4CDF B;  1QMY A;  4I04 A;  1ME3 A;  3MDB C;  4RKX A;  4WZ3 B;  3I2D A;  1KXR A;  2FO5 A;  3C6W A;  3HWN A;  5E6J A;  4YYQ A;  2C2L A;  3LQJ A;  4CDD B;  3IMA A;  3U8E A;  2YQL A;  1TLO A;  3IV2 A;  4R3D A;  3FAO A;  2LXH C;  2L75 A;  2AU1 A;  3QZV A;  5H1U A;  1WEW A;  2E01 A;  2R9F A;  4BPV A;  3C9E A;  4QQ4 A;  3W30 A;  2G6D A;  5B79 A;  2KRE A;  2FD4 A;  2GFO A;  2AS8 A;  3H8C A;  4IP3 A;  5A24 A;  5CHT A;  2E6S A;  1EWP A;  2E03 A;  2KWK A;  2G7Y A;  4L58 A;  3SOW A;  2HXZ A;  2P86 A;  2VJF A;  3VK6 A;  5LKX A;  4YAD A;  5FPW A;  2JTC A;  3PDF A;  3RPG B;  3NHE A;  3EB5 A;  1BP4 A;  5DKA A;  1PAD A;  4YYS A;  2CKL A;  5FB0 A;  4N8W A;  4PPE A;  1BY8 A;  2ECT A;  3O37 A;  3PUR A;  4MZO A;  5EF4 A;  3H7D A;  1PXV A;  2M3H A;  3LJU X;  1GMY A;  2BDL A;  2WBF X;  2Y43 A;  3E9S A;  4OVZ A;  4F1P A;  5SVI B;  4BOP A;  3TRK A;  5JG6 A;  4Z0R A;  2LGK A;  4RNA A;  2MNZ A;  1CS8 A;  1YK8 A;  2KWN A;  1X4I A;  3B79 A;  3I06 A;  5LKT A;  5KH7 A;  3LVQ E;  2FRQ A;  3T7L A;  4BHW A;  3WXF A;  5TDW A;  2JUN A;  1PPO A;  3BB7 A;  1WEV A;  3O36 A;  3U5M A;  2ECW A;  2L80 A;  5J3X A;  4QBB A;  1Y08 A;  3L1Z B;  4R8P K;  2HDP A;  4N3W A;  4UP5 A;  1WE9 A;  3ZUA A;  2YHN A;  1NB3 A;  1U6G B;  4QRX A;  1Z6U A;  3CH2 X;  3PNR A;  5G0F A;  2ECN A;  4ZDT A;  1IWD A;  5D1L B;  4YYR A;  4ZQL A;  3LVR E;  1Y4H A;  4BOZ A;  1U9Q X;  2KR4 A;  3LQI A;  4S3O C;  5B8D A;  2CIO A;  3H89 A;  2UZJ A;  3TNX A;  4REZ A;  4YBT A;  1POP A;  1CSB B;  2LGL A;  1SNK A;  2XOY A;  2LRI C;  3ZVY A;  2OP3 A;  8PCH A;  4O64 A;  2LV9 A;  4XI1 A;  4I7B A;  5K16 A;  2XEU A;  1K3B B;  3BPM A;  1F2B A;  3DF0 A;  1NB5 A;  1M6D A;  4B7Y C;  1BOR A;  3O7A A;  2DJF B;  3S3R A;  4MSX A;  4RF0 A;  2P0R A;  5EZQ A;  4UI9 B;  4CA1 A;  3JUE A;  2PUY A;  4CDE B;  2DCB A;  1ZIV A;  3MTV A;  5LCW B;  1JM7 A;  2F6N A;  2DSM A;  2VJE A;  2NAA A;  4AUQ B;  4W4U A;  2UZG A;  5CVN B;  2YUC A;  3KX1 A;  2YJC A;  4S3O B;  2MA6 A;  3E1Z B;  4OVZ B;  3F75 A;  3FL2 A;  5K3Q A;  3LXS A;  3SUB A;  2NQA A;  2KFT A;  4X6I A;  3KDE C;  3HD3 A;  2L0B A;  4I7D A;  4IC2 A;  1XKG A;  5SVY A;  2K16 A;  1X4U A;  2DCC A;  5CHV A;  4BBQ A;  1T1H A;  2M1R A;  2J7Q A;  5TDR A;  2JQF R;  2LQ6 A;  3M62 A;  1LDJ B;  3RVW A;  4BS6 A;  5PAD A;  2NQD B;  2K4D A;  4I05 A;  4FK5 A;  2VPB A;  4PAD A;  2K1J A;  2KGG A;  4M0W A;  2AGA A;  1KFU L;  3BPF A;  1GCB A;  4D8I A;  1ITO A;  2JMJ A;  1JQP A;  3FM8 C;  5C13 A;  3T9K A;  2YJ9 A;  3RNV A;  2LN0 A;  1YZB A;  3K9M A;  1EF7 A;  3BC3 A;  4PP1 A;  2PNX A;  2YHO A;  5G05 B;  4RY2 A;  3IFU A;  5EGW A;  1AU0 A;  3ZPV 1;  5H9M A;  2O6X A;  3H6S A;  2RSD A;  2YQM A;  1WEM A;  5H1T A;  3HHI A;  3IUT A;  3O47 A;  2Y1N A;  4GND A;  2PBH A;  2XU3 A;  4D8B A;  4YYU A;  2FSA A;  3L11 A;  4MM3 B;  4RF1 A;  3HCU A;  1CQD A;  3K24 A;  1AEC A;  2FUU A;  2YYR A;  2R9O A;  3OF8 A;  4YC9 A;  3IOQ A;  2YVR A;  2MD8 C;  2IDA A;  1YVB A;  2IQJ A;  1JM7 B;  1XWH A;  2VJE B;  1BGO A;  5J94 A;  1WEU A;  3U5P A;  3B21 A;  3F5V A;  3OQC A;  4N4Z A;  2JRJ A;  3L1X A;  2BTW A;  3PHW A;  5KO3 A;  2XU1 A;  4R2Y A;  3OVZ A;  1YAL A;  3HCT A;  1CV8 A;  1ICF A;  2AYN A;  4L7X A;  1PCI A;  2B1M A;  2PAD A;  3O0U A;  6PAD A;  5JA7 A;  5F02 A;  2MUM A;  1U5I A;  1F2A A;  2DZY A;  2G8E A;  4Z0O A;  3MJ5 A;  4I07 A;  1MDW A;  3LQH A;  3V6E A;  2P7U A;  4DMY A;  2CRR A;  5B78 A;  1VFY A;  4PTB A;  3MHH A;  4QRG A;  2FTD A;  3RVX A;  3V6C A;  3NG2 A;  4GNG A;  1U9W A;  1AU2 A;  1HUC B;  4UP0 A;  3K8U A;  4QH6 A;  2E6R A;  4DMX A;  2ECV A;  3HCS A;  4BS5 A;  2EGP A;  4AVX A;  4YVA A;  3DQV R;  2F7D A;  1AIM A;  2VHS A;  1IYM A;  3KKU A;  3KWB X;  1WEQ A;  2FQ9 A;  5LKZ A;  3O1G A;  4IC3 A;  3P5W A;  2F6J A;  3N9N A;  4YAX A;  1UKF A;  3C0R A;  4HXD B;  3C5K A;  2FE8 A;  3QJ3 A;  1KFX L;  2FUI A;  1YK7 A;  3S3Q A;  3PUQ A;  2JM3 A; 
#chains in the Genus database with same CATH homology
 4GNF A;  1K2F A;  1VYX A;  2C0Y A;  4AYC A;  2ACT A;  1MHW A;  2YT5 A;  1VD4 A;  1CHC A;  3CBK A;  2EOD A;  5B76 A;  1WEE A;  5C11 A;  2YU4 A;  2M6M A;  2XU5 A;  1N87 A;  3MTN A;  4NV7 A;  2LDR A;  2PRE A;  1AU4 A;  2I50 A;  1VJV A;  2IBI A;  4YBS A;  2JMD A;  1EWM A;  2DCD A;  2KU3 A;  4GB0 A;  3N9Q A;  1NQC A;  2DC9 A;  3EB6 A;  3N9M A;  4V3K C;  2VJF B;  4QRV A;  1Z2Q A;  2ATO A;  1E4U A;  1PE6 A;  3KW9 A;  5H1V A;  1MEG A;  4W5C A;  4NV8 A;  2CKL B;  3ERV A;  2AUZ A;  2CSY A;  2HH5 A;  2Y5B A;  5KH9 A;  2R9C A;  3AI8 A;  2MA5 A;  1VSN A;  3ASL A;  2CSZ A;  3KV6 A;  1F29 A;  5EYA F;  2QIC A;  2L43 A;  3CBJ A;  3QSD A;  2CT2 A;  2YJ2 A;  3KFQ A;  4I7C A;  2NQI A;  4YBM A;  1MIR A;  3N9P A;  1CTE A;  3CH3 X;  4K7C A;  3V43 A;  2F42 A;  1X9Y A;  2ECG A;  4QF3 A;  3SOU A;  4N79 A;  3WXE A;  3M63 A;  1WGM A;  4C5P A;  4YV8 A;  4PP2 E;  4R7E A;  2VHF A;  3BWK A;  3T6R A;  3IHP A;  2VPD A;  2XU4 A;  1WES A;  3I3T A;  2MNY A;  1PPN A;  3RTR B;  2YRE A;  5FER A;  3GL6 A;  1WIL A;  4N4F A;  1NL6 A;  2VNF A;  4TKP B;  3U5N A;  1AYU A;  1NPZ A;  1ZBD B;  3BOW A;  5D1K B;  2ARY A;  4LAD B;  3N9O A;  1FH0 A;  9PAP A;  3O70 A;  5G04 B;  3MHS A;  3PHD A;  5TAB A;  2HHN A;  1CVZ A;  1F2C A;  2E00 A;  3P5V A;  4AYC B;  4C9Z A;  2MD7 B;  3HHA A;  1GEC E;  4CDC B;  2E02 A;  7PCK A;  2AUX A;  2L5U A;  2FYE A;  3KNV A;  2KGI A;  2YSJ A;  3KSE A;  1F62 A;  2KWO A;  1CJL A;  1HYJ A;  4FJC A;  1A6R A;  3ZVZ B;  5FEY A;  4WZ2 A;  2G45 A;  1MM3 A;  2IPP B;  4YYW A;  1FP0 A;  3N9L A;  1DF0 A;  1RMD A;  4A4B A;  2Y6E A;  1MS6 A;  1O0E A;  1LDK C;  2JMI A;  4Q8G A;  3DPL R;  5DIN A;  2H0D A;  3O33 A;  1Z60 A;  2DC8 A;  1MM2 A;  2LGV A;  2QIZ A;  4XUI A;  3N3K A;  4QF2 A;  2AN6 A;  1AYV A;  1U9V A;  3KWZ A;  5AIU A;  4WZ0 A;  3M99 A;  2AIM A;  3LRQ A;  4LLB A;  4P5O B;  2R9N A;  1S4V A;  2DZZ A;  5JH3 A;  4A0C D;  5LKU A;  1WFK A;  2NQG A;  2G6Q A;  1HYI A;  2KIZ A;  4X6J A;  1ZCM A;  3N4C A;  3U5O A;  3O34 A;  2CB5 A;  1CPJ A;  2XB1 A;  1EWL A;  1ATK A;  2RI7 A;  4NN2 A;  1KHP A;  1G25 A;  2PNS A;  1WIM A;  3SOX A;  3BCN A;  4YAB A;  1TL9 A;  3USV A;  2ZET C;  3MOR A;  1EWO A;  3GCB A;  1GLO A;  4P6G A;  4GNE A;  1STF E;  2FT2 A;  4MVT A;  1DVP A;  2R9M A;  4HWY A;  1W6F A;  1PIP A;  4PI3 A;  4LK9 A;  4LKA A;  1YT7 A;  3ZNI A;  4BQV A;  1U9X A;  2G43 A;  2YW8 A;  5KH3 A;  3KQI A;  4B86 C;  1WEO A;  2KE1 A;  3KV5 A;  2B1N A;  5I3L A;  2GHU A;  3H8B A;  5B77 A;  5D1M B;  1V87 A;  3ZYQ A;  2JQG R;  4BSQ A;  5B75 A;  3WXG A;  2KWJ A;  4MZS A;  4CZW A;  1TU6 A;  1E2T A;  4ZUX U;  1NLJ A;  2YJB A;  4FO9 A;  4AXM A;  3IEJ A;  4OEL A;  2H0D B;  3RVV A;  4G54 A;  2LGG A;  1AYW A;  3QT4 A;  3OIS A;  4LJN A;  2LXP C;  2DC6 A;  3P5U A;  3PW3 A;  3OF9 A;  2YUR A;  4Q8H A;  2HYE D;  4F52 B;  2MIQ A;  4YAT A;  2VFB A;  2G8J A;  4XR7 A;  2D8S A;  2OZ2 A;  3D6S A;  1Q6K A;  4P6E A;  2MT5 A;  1THE A;  5CVO B;  1WEN A;  2C2V S;  4AP4 A;  2VPG A;  1PPP A;  2AYO A;  5TRB A;  4A4C A;  3HTK C;  1DEU A;  2ECJ A;  3SHB A;  4V3L C;  1CB5 A;  1PBH A;  1ME4 A;  2OUL A;  3P5X A;  2K17 A;  2AVW A;  2FUD A;  2YSM A;  4X6H A;  5TBN A;  2VPE A;  2H7J A;  1BQI A;  2ECI A;  4WA6 A;  2Y1M A;  2BAY A;  5AIT A;  1AU3 A;  2DX8 A;  3LFY A;  3PBH A;  2BDZ A;  2DC7 A;  1QDQ A;  4W5B A;  2FRA A;  4A49 A;  2KYU A;  3ZTG A;  3GV4 A;  3ZPV E;  1QXP A;  1X4J A;  5FB1 A;  4KLB A;  2HD5 A;  2DJG B;  4X3G A;  4YYV A;  5CVM A;  4AXL A;  2VP7 A;  2QJ0 A;  2M85 A;  1KHQ A;  4OEM A;  2YJ8 A;  3N3G A;  3O35 A;  1PPD A;  2OXQ C;  1JOC A;  1SP4 B;  1MEM A;  2R6N A;  4CCG X;  2F1G A;  2DCA A;  1FBV A;  1QOL A;  2EA6 A;  4Q6F A;  3OVX A;  3RPG C;  1WEP A;  4FIP A;  4CDF B;  1QMY A;  4I04 A;  1ME3 A;  4WZ3 B;  3I2D A;  1KXR A;  2FO5 A;  3C6W A;  3HWN A;  4YYQ A;  2C2L A;  3LQJ A;  4CDD B;  3IMA A;  3U8E A;  2YQL A;  1TLO A;  1W4T A;  3IV2 A;  2LXH C;  2L75 A;  2AU1 A;  3QZV A;  5H1U A;  1WEW A;  2E01 A;  2R9F A;  4BPV A;  4B55 A;  3C9E A;  2G6D A;  5B79 A;  2KRE A;  2GFO A;  5A24 A;  2AS8 A;  3H8C A;  5CHT A;  2E6S A;  1EWP A;  2E03 A;  2KWK A;  2G7Y A;  4L58 A;  3SOW A;  2HXZ A;  2P86 A;  2VJF A;  3VK6 A;  5LKX A;  4YAD A;  5FPW A;  3PDF A;  3RPG B;  3NHE A;  3EB5 A;  1BP4 A;  5DKA A;  1PAD A;  4YYS A;  2CKL A;  5FB0 A;  4N8W A;  4PPE A;  1BY8 A;  2ECT A;  3O37 A;  3PUR A;  4MZO A;  5EF4 A;  3H7D A;  1PXV A;  2M3H A;  1GMY A;  2BDL A;  2WBF X;  2Y43 A;  5JG6 A;  2LGK A;  2MNZ A;  1CS8 A;  1YK8 A;  2KWN A;  1X4I A;  3B79 A;  3I06 A;  5LKT A;  5KH7 A;  2FRQ A;  3WXF A;  3T7L A;  4BHW A;  5TDW A;  1PPO A;  1WEV A;  3O36 A;  3U5M A;  2ECW A;  2L80 A;  5J3X A;  4QBB A;  1Y08 A;  3L1Z B;  4R8P K;  2HDP A;  4N3W A;  4UP5 A;  1WE9 A;  3ZUA A;  2YHN A;  1NB3 A;  1U6G B;  4QRX A;  1Z6U A;  3CH2 X;  3PNR A;  5G0F A;  2ECN A;  4ZDT A;  1IWD A;  5D1L B;  4YYR A;  4ZQL A;  1Y4H A;  1U9Q X;  2KR4 A;  3LQI A;  4S3O C;  5B8D A;  2CIO A;  3H89 A;  3TNX A;  4YBT A;  1POP A;  1CSB B;  2LGL A;  1SNK A;  3ZVY A;  2LRI C;  2OP3 A;  8PCH A;  4O64 A;  2LV9 A;  4XI1 A;  4I7B A;  5K16 A;  2XEU A;  1K3B B;  3BPM A;  1F2B A;  3DF0 A;  1NB5 A;  1M6D A;  4B7Y C;  1BOR A;  3O7A A;  4BGF A;  2DJF B;  3S3R A;  4MSX A;  2P0R A;  4UI9 B;  4CA1 A;  2PUY A;  4CDE B;  2DCB A;  1ZIV A;  5LCW B;  1JM7 A;  2F6N A;  2VJE A;  2NAA A;  4AUQ B;  4W4U A;  2UZG A;  5CVN B;  2YUC A;  3KX1 A;  2YJC A;  4S3O B;  2MA6 A;  3E1Z B;  3F75 A;  3FL2 A;  3LXS A;  2NQA A;  4X6I A;  2KFT A;  3D9W A;  3HD3 A;  2L0B A;  4I7D A;  4IC2 A;  1XKG A;  2K16 A;  1X4U A;  3LTW A;  2DCC A;  5CHV A;  4BBQ A;  1T1H A;  2M1R A;  5TDR A;  2JQF R;  2LQ6 A;  3M62 A;  1LDJ B;  3RVW A;  4BS6 A;  5PAD A;  2NQD B;  2K4D A;  4I05 A;  4FK5 A;  1GX3 A;  2VPB A;  4PAD A;  2K1J A;  2KGG A;  1KFU L;  3BPF A;  1GCB A;  1ITO A;  2JMJ A;  1JQP A;  5C13 A;  2YJ9 A;  2LN0 A;  3K9M A;  1EF7 A;  3BC3 A;  4PP1 A;  2PNX A;  2YHO A;  5G05 B;  4RY2 A;  5EGW A;  1AU0 A;  4GUZ A;  3ZPV 1;  5H9M A;  2O6X A;  3H6S A;  2RSD A;  2YQM A;  1WEM A;  5H1T A;  3HHI A;  3IUT A;  4GND A;  2Y1N A;  4YYU A;  2PBH A;  2XU3 A;  2FSA A;  3L11 A;  3HCU A;  1CQD A;  3K24 A;  1AEC A;  2FUU A;  2YYR A;  2R9O A;  3OF8 A;  4YC9 A;  3IOQ A;  2BSZ A;  2MD8 C;  2IDA A;  1YVB A;  1JM7 B;  1XWH A;  2VJE B;  1BGO A;  5J94 A;  2VFC A;  1WEU A;  3U5P A;  3F5V A;  4N4Z A;  2JRJ A;  3L1X A;  2XU1 A;  4R2Y A;  3OVZ A;  1YAL A;  3HCT A;  1CV8 A;  1ICF A;  2AYN A;  4L7X A;  1PCI A;  2B1M A;  2PAD A;  3O0U A;  6PAD A;  5JA7 A;  5F02 A;  2MUM A;  1U5I A;  1F2A A;  2DZY A;  2G8E A;  4I07 A;  1MDW A;  3LQH A;  3V6E A;  2P7U A;  4DMY A;  5B78 A;  1VFY A;  4PTB A;  3MHH A;  4QRG A;  2FTD A;  3RVX A;  3V6C A;  1W5R A;  3NG2 A;  4GNG A;  1U9W A;  1AU2 A;  1HUC B;  4UP0 A;  3K8U A;  4QH6 A;  2E6R A;  4DMX A;  2ECV A;  3HCS A;  4BS5 A;  2EGP A;  4AVX A;  4YVA A;  3DQV R;  2F7D A;  1AIM A;  2VHS A;  1IYM A;  3KKU A;  3KWB X;  1WEQ A;  2FQ9 A;  5LKZ A;  3O1G A;  4IC3 A;  3P5W A;  2F6J A;  3N9N A;  4YAX A;  3C5K A;  3QJ3 A;  1KFX L;  2FUI A;  1YK7 A;  3S3Q A;  3PUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...