4YVAA

Cathepsin k co-crystallized with actinomycetes extract
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
213
structure length
213
Chain Sequence
DSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity Crystallography: A New Approach to Extracting High-Affinity Enzyme Inhibitors from Natural Extracts.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 63
structure length 213
sequence length 213
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4yvaA00
1U9QX 2AVWA 3P5UA 4HWYA 1NLJA 2DC6A 1TL9A 2AU1A 5PADA 1MDWA 1SNKA 1ZCMA 2YJCA 3GCBA 2GFOA 3HWNA 3O1GA 3OVXA 1U9WA 1CJLA 1Y08A 3OISA 3IV2A 3QT4A 1NQCA 3ZUAA 1YVBA 4XR7A 1EF7A 2DCBA 1MIRA 3ERVA 2AYOA 3PDFA 1Q6KA 2HD5A 3BOWA 2WBFX 1NB3A 3HHIA 2F1GA 4CZWA 1ME3A 2HH5A 1AYVA 3OF8A 1KFUL 2JQFR 1AU4A 2R6NA 3LXSA 3PW3A 1QOLA 1AECA 1PE6A 1U9VA 2R9NA 1QDQA 2PNSA 4YYUA 3NHEA 2P7UA 4KLBA 3C9EA 2R9MA 2B1MA 5CHTA 4BSQA 2NQIA 4YYSA 2E01A 2ARYA 3IHPA 1KHPA 3M99A 1GMYA 4DMXA 3BWKA 5EGWA 4QH6A 3HD3A 2DJGB 4CDCB 4FJCA 1GLOA 1YK8A 3MHSA 3U8EA 2VHSA 2CB5A 4QRVA 3KWBX 5JA7A 3CH2X 4AXLA 1PPDA 2DJFB 2P0RA 4OELA 3O0UA 2XU1A 1NPZA 3N3KA 1ME4A 4YVAA 4P6GA 1U9XA 1EWPA 4W5CA 3IUTA 1GECE 2PADA 9PAPA 2YJ8A 1F2CA 4YYRA 6PADA 3P5WA 3LFYA 2DCCA 4WA6A 4PP2E 2AUXA 2FO5A 3BC3A 2DC8A 1CQDA 3IEJA 1EWMA 4PI3A 4YYWA 2G8EA 4BPVA 4I05A 1THEA 4I04A 1Y4HA 1YT7A 2YJBA 3F5VA 1TLOA 3CBJA 4Q8HA 1NB5A 1IWDA 2NQGA 2HXZA 2ATOA 3K24A 1XKGA 4AXMA 2AS8A 1SP4B 3MTNA 3CH3X 2E02A 5A24A 1QMYA 2C0YA 1AU2A 2XU4A 3S3RA 1CPJA 4OEMA 3PNRA 2XU5A 2R9OA 4N4ZA 4BS6A 5CVOB 4N79A 2DZZA 1ICFA 3H8BA 1BP4A 4PADA 4W5BA 4ZUXU 1A6RA 4CDFB 3K9MA 1CB5A 1BY8A 2YJ2A 2NQDB 3N4CA 2OULA 1ATKA 4CDEB 2R9CA 5CVMA 4W4UA 4P6EA 2GHUA 1AYWA 4X6JA 1K3BB 5EF4A 3IMAA 1CV8A 4CDDB 2E03A 2NQAA 3DF0A 3HHAA 3F75A 4YYVA 5FPWA 3WXFA 3CBKA 3BPFA 3RVVA 3KFQA 1FH0A 3RVWA 1CTEA 2OP3A 8PCHA 1PIPA 1U5IA 1AYUA 1NL6A 1VJVA 2VHFA 2YJ9A 1CVZA 2B1NA 2DC9A 1POPA 1PXVA 4G54A 2OZ2A 3KW9A 2DCAA 1BQIA 1QXPA 1AU0A 3I06A 1ITOA 1BGOA 2Y6EA 3D6SA 5CVNB 3BCNA 2G8JA 4YYQA 2FQ9A 2FYEA 4N8WA 2H7JA 4RY2A 1MEMA 4DMYA 1EWLA 3N3GA 2JQGR 4FIPA 2FTDA 4X6HA 2AIMA 1STFE 1YALA 2DCDA 3KX1A 3V6EA 4Q8GA 1ZIVA 5CHVA 4XUIA 1PBHA 1EWOA 1KHQA 3K8UA 2R9FA 4BS5A 1S4VA 3MHHA 3TNXA 2F7DA 4QBBA 1O0EA 2G6DA 2DZYA 1PPNA 2FRQA 1HUCB 1PPOA 2AYNA 1VSNA 1MS6A 1CS8A 4K7CA 1AIMA 3KKUA 4X6IA 1X9YA 3MORA 4I07A 2Y5BA 2E00A 1AU3A 3KSEA 4BQVA 2O6XA 3BPMA 3I3TA 4FK5A 1TU6A 3IOQA 3OF9A 1F2BA 5J94A 1DEUA 1MEGA 2ACTA 2XU3A 3H8CA 3P5VA 3PBHA 1DF0A 3USVA 3QSDA 3B79A 3WXEA 2IBIA 4MZSA 2HHNA 4YV8A 1KXRA 3RVXA 2PBHA 3QJ3A 3OVZA 1F29A 4MSXA 1PPPA 2BDZA 1PADA 2AUZA 2CIOA 5F02A 1F2AA 1JQPA 3S3QA 5JH3A 3H7DA 7PCKA 1YK7A 1MHWA 2BDLA 3H6SA 2G7YA 2P86A 1KFXL 2PREA 1GCBA 3KWZA 5K16A 4MZOA 2IPPB 4QRXA 4PP1A 2FT2A 1PCIA 2FUDA 3H89A 1M6DA 3E1ZB 3V6CA 3WXGA 4QRGA 3AI8A 1CSBB 3P5XA 2DC7A 2FRAA
chains in the Genus database with same CATH superfamily
3MP2A 4RF0A 4PT5A 1U9QX 3TMPA 4D8IA 2AVWA 3P5UA 4HWYA 1NLJA 3PRMA 2DC6A 1TL9A 2AU1A 5PADA 1MDWA 2JRIA 1SNKA 3O65A 1ZCMA 2YJCA 3GCBA 2GFOA 3HWNA 3O1GA 3OVXA 1U9WA 1CJLA 1Y08A 3OISA 3IV2A 3QT4A 2JTCA 1NQCA 3ZUAA 1YVBA 4XR7A 1EF7A 3W31A 2DCBA 1MIRA 3ERVA 2AYOA 3PDFA 1Q6KA 2HD5A 4IUMA 3BOWA 2WBFX 1NB3A 3OQCA 3HHIA 3PT2A 2F1GA 4CZWA 1ME3A 2HH5A 1AYVA 3OF8A 1KFUL 2JQFR 1AU4A 2R6NA 3LXSA 3PW3A 1QOLA 1AECA 1PE6A 1U9VA 2R9NA 1QDQA 2PNSA 4YYUA 3NHEA 2P7UA 4KLBA 3C9EA 2R9MA 2B1MA 5CHTA 4ZTBA 4BSQA 2NQIA 4YYSA 2E01A 2ARYA 3IHPA 1KHPA 3PHXA 3BB7A 4R3DA 3M99A 1GMYA 4DMXA 3BWKA 5EGWA 4QH6A 3HD3A 2DJGB 4CDCB 4FJCA 1GLOA 1YK8A 3IFUA 3MHSA 3U8EA 2VHSA 2CB5A 4QRVA 3KWBX 5JA7A 3CH2X 4M0WA 4AXLA 1PPDA 2DJFB 2P0RA 4BOZA 3BBAA 4OELA 3O0UA 2XU1A 1NPZA 2FE8A 3PHUA 3N3KA 1ME4A 4YVAA 4P6GA 1U9XA 1EWPA 4W5CA 5JZEA 3IUTA 1GECE 2PADA 9PAPA 2YJ8A 1F2CA 4YYRA 6PADA 3P5WA 4A5UA 3LFYA 2DCCA 4WA6A 4PP2E 2AUXA 2FO5A 3BC3A 2DC8A 1CQDA 3IEJA 1EWMA 4PI3A 4YYWA 2G8EA 1YZBA 4BPVA 4I05A 1THEA 4I04A 1Y4HA 3RNVA 1YT7A 2YJBA 3F5VA 1TLOA 3W30A 3CBJA 4Q8HA 1NB5A 1IWDA 2NQGA 2HXZA 1PVJA 2ATOA 3K24A 1XKGA 4AXMA 2Z84A 2AS8A 2UZJA 4XZXA 4BOSA 1SP4B 3MTNA 3CH3X 2E02A 5A24A 1QMYA 2C0YA 1AU2A 2XU4A 2BU3A 3S3RA 4BOPA 1CPJA 4OEMA 3PNRA 2XU5A 2R9OA 4N4ZA 3MTVA 4BS6A 5CVOB 4N79A 2DZZA 1ICFA 3H8BA 1BP4A 4REZA 4RNAA 4PADA 4W5BA 4ZUXU 1A6RA 4CDFB 3K9MA 1CB5A 1BY8A 2YJ2A 2J7QA 2NQDB 3N4CA 2OULA 1ATKA 4CDEB 2R9CA 5CVMA 4W4UA 4BOUA 4P6EA 2GHUA 1AYWA 4X6JA 1K3BB 5EF4A 3IMAA 1CV8A 4CDDB 2E03A 2NQAA 3DF0A 3HHAA 3F75A 4YYVA 5FPWA 4MI7A 3WXFA 3CBKA 3BPFA 3RVVA 3KFQA 4OVZB 1FH0A 3BY4A 3C0RA 3RVWA 1CTEA 2OP3A 4HXDB 8PCHA 1PIPA 2HWKA 1U5IA 1AYUA 1NL6A 1VJVA 2VHFA 4GUAA 4OW0A 2YJ9A 1CVZA 2B1NA 1DKIA 3ZNHA 2DC9A 1POPA 1PXVA 4G54A 2OZ2A 3KW9A 2DCAA 1BQIA 1QXPA 4BOQA 1AU0A 3I06A 1ITOA 4IP3A 1BGOA 2Y6EA 3D6SA 5CVNB 3BCNA 2G8JA 4YYQA 2FQ9A 2FYEA 4N8WA 2H7JA 2J7QC 1MEMA 4RY2A 3MJ5A 3PSEA 4DMYA 1EWLA 3N3GA 2JQGR 4FIPA 2FTDA 4X6HA 2AIMA 1STFE 5KO3A 4WURA 1YALA 2DCDA 3KX1A 3V6EA 4Q8GA 1ZIVA 3B21A 5CHVA 4XUIA 1PBHA 1EWOA 2BTWB 1KHQA 3K8UA 2R9FA 4BS5A 1S4VA 3MHHA 3TNXA 2F7DA 2G6DA 1O0EA 4QBBA 2DZYA 1PPNA 2FRQA 1HUCB 1PPOA 2AYNA 1VSNA 1MS6A 1CS8A 4D8BA 4OVZA 4K7CA 1AIMA 3KKUA 4X6IA 1X9YA 3MORA 4I07A 2Y5BA 2E00A 1AU3A 3KSEA 4BQVA 2O6XA 3BPMA 3I3TA 4FK5A 1TU6A 3IOQA 3OF9A 3E9SA 1F2BA 5J94A 1DEUA 1MEGA 2ACTA 2XU3A 3H8CA 3P5VA 3PBHA 5EZSA 5E6JA 1DF0A 3USVA 3QSDA 4P16A 3B79A 3WXEA 2IBIA 2AGAA 4MZSA 2HHNA 4YV8A 1KXRA 3RVXA 2PBHA 3QJ3A 3OVZA 5EZQA 4D8EA 1F29A 4MSXA 3TRKA 1PPPA 2BDZA 1PADA 2AUZA 2CIOA 5F02A 1F2AA 1JQPA 3S3QA 5JH3A 3H7DA 4RKXA 7PCKA 1YK7A 3PRPA 1MHWA 2BDLA 3H6SA 2DOSA 2G7YA 2P86A 1KFXL 2PREA 1GCBA 3KWZA 5K16A 3PHWA 4MZOA 2IPPB 4QRXA 4PP1A 4MM3B 2FT2A 1PCIA 2FUDA 3H89A 1M6DA 3E1ZB 3V6CA 3WXGA 2BTWA 4QRGA 4RF1A 3AI8A 1CSBB 3P5XA 1UKFA 2DC7A 2FRAA
chains in the Genus database with same CATH topology
1U9QX 2AVWA 3P5UA 4HWYA 1NLJA 2DC6A 1TL9A 2AU1A 5PADA 1MDWA 1SNKA 1ZCMA 2YJCA 3GCBA 2GFOA 3HWNA 3O1GA 3OVXA 1U9WA 1CJLA 1Y08A 3OISA 3IV2A 3QT4A 1NQCA 3ZUAA 1YVBA 4XR7A 1EF7A 2DCBA 1MIRA 3ERVA 2AYOA 3PDFA 1Q6KA 2HD5A 3BOWA 2WBFX 1NB3A 3HHIA 2F1GA 4CZWA 1ME3A 2HH5A 1AYVA 3OF8A 1KFUL 2JQFR 1AU4A 2R6NA 3LXSA 3PW3A 1QOLA 1AECA 1PE6A 1U9VA 2R9NA 1QDQA 2PNSA 4YYUA 3NHEA 2P7UA 4KLBA 3C9EA 2R9MA 2B1MA 5CHTA 4NV8A 4BSQA 2NQIA 4YYSA 2E01A 2ARYA 3IHPA 1KHPA 3M99A 1GMYA 4DMXA 3BWKA 5EGWA 4QH6A 3HD3A 2DJGB 4CDCB 4FJCA 1GLOA 1YK8A 3MHSA 3U8EA 2VHSA 2CB5A 4QRVA 3KWBX 5JA7A 3CH2X 4AXLA 1PPDA 2DJFB 2P0RA 4OELA 3O0UA 2XU1A 1NPZA 3N3KA 1ME4A 4YVAA 4P6GA 1U9XA 1EWPA 4W5CA 3IUTA 1GECE 2PADA 9PAPA 2YJ8A 1F2CA 4C5PA 4YYRA 6PADA 3P5WA 3LFYA 2DCCA 4WA6A 4PP2E 2AUXA 2FO5A 3BC3A 2DC8A 1CQDA 3IEJA 1EWMA 4PI3A 4YYWA 2G8EA 4BPVA 4I05A 1THEA 4I04A 1Y4HA 1YT7A 2YJBA 3F5VA 1TLOA 1W6FA 3CBJA 4Q8HA 1NB5A 1IWDA 2NQGA 2HXZA 2ATOA 3K24A 1XKGA 4AXMA 2VFCA 2AS8A 2BSZA 1SP4B 3MTNA 3CH3X 2E02A 5A24A 1QMYA 2C0YA 1AU2A 2XU4A 3S3RA 1CPJA 4OEMA 3PNRA 2XU5A 2R9OA 4N4ZA 4BS6A 5CVOB 4N79A 2DZZA 1ICFA 3H8BA 1BP4A 4PADA 4W5BA 4ZUXU 1A6RA 4CDFB 3K9MA 1CB5A 1BY8A 2YJ2A 2NQDB 3N4CA 2OULA 1ATKA 4CDEB 2R9CA 5CVMA 4W4UA 4P6EA 2GHUA 1AYWA 4X6JA 1K3BB 5EF4A 3IMAA 1CV8A 4CDDB 2E03A 2NQAA 3DF0A 1W4TA 3HHAA 3F75A 4YYVA 5FPWA 3WXFA 3CBKA 3BPFA 3RVVA 3KFQA 1FH0A 1E2TA 4NV7A 3RVWA 1CTEA 4GUZA 2OP3A 8PCHA 1PIPA 1U5IA 1AYUA 1NL6A 1VJVA 2VHFA 2YJ9A 1CVZA 2B1NA 2DC9A 1POPA 1PXVA 4G54A 2OZ2A 4B55A 3KW9A 1W5RA 2DCAA 1BQIA 1QXPA 1AU0A 3I06A 1ITOA 1BGOA 2Y6EA 3D6SA 5CVNB 3BCNA 2G8JA 4YYQA 2FQ9A 2FYEA 4N8WA 2H7JA 4RY2A 1MEMA 4DMYA 1EWLA 3N3GA 2JQGR 4FIPA 2FTDA 4X6HA 2AIMA 1STFE 1YALA 2DCDA 3KX1A 3V6EA 4Q8GA 1ZIVA 5CHVA 4XUIA 1PBHA 1EWOA 1KHQA 3K8UA 2R9FA 4BS5A 1S4VA 3MHHA 3TNXA 2F7DA 4QBBA 1O0EA 2G6DA 2DZYA 1PPNA 2FRQA 1HUCB 1PPOA 2AYNA 1VSNA 1MS6A 1CS8A 4K7CA 4BGFA 1AIMA 3KKUA 4X6IA 1X9YA 3MORA 4I07A 2Y5BA 2E00A 1AU3A 3KSEA 4BQVA 2O6XA 3BPMA 3I3TA 4FK5A 1TU6A 3IOQA 3OF9A 1F2BA 5J94A 1DEUA 1MEGA 2ACTA 2XU3A 3H8CA 3P5VA 3PBHA 1DF0A 3USVA 3QSDA 3B79A 3WXEA 2IBIA 4MZSA 2HHNA 4YV8A 1KXRA 3RVXA 2PBHA 3QJ3A 1GX3A 3OVZA 1F29A 4MSXA 1PPPA 2BDZA 1PADA 3D9WA 2AUZA 2CIOA 5F02A 1F2AA 1JQPA 3S3QA 2VFBA 5JH3A 3H7DA 7PCKA 1YK7A 1MHWA 2BDLA 3H6SA 2G7YA 2P86A 1KFXL 2PREA 1GCBA 3KWZA 5K16A 3LTWA 4MZOA 2IPPB 4QRXA 4PP1A 2FT2A 1PCIA 2FUDA 3H89A 1M6DA 3E1ZB 3V6CA 3WXGA 4QRGA 3AI8A 1CSBB 3P5XA 2DC7A 2FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9Q X;  2AVW A;  3P5U A;  4HWY A;  1NLJ A;  2DC6 A;  1TL9 A;  2AU1 A;  5PAD A;  1MDW A;  1SNK A;  1ZCM A;  2YJC A;  3GCB A;  2GFO A;  3HWN A;  3O1G A;  3OVX A;  1U9W A;  1CJL A;  1Y08 A;  3OIS A;  3IV2 A;  3QT4 A;  1NQC A;  3ZUA A;  1YVB A;  4XR7 A;  1EF7 A;  2DCB A;  1MIR A;  3ERV A;  2AYO A;  3PDF A;  1Q6K A;  2HD5 A;  3BOW A;  2WBF X;  1NB3 A;  3HHI A;  2F1G A;  4CZW A;  1ME3 A;  2HH5 A;  1AYV A;  3OF8 A;  1KFU L;  2JQF R;  1AU4 A;  2R6N A;  3LXS A;  3PW3 A;  1QOL A;  1AEC A;  1PE6 A;  1U9V A;  2R9N A;  1QDQ A;  2PNS A;  4YYU A;  3NHE A;  2P7U A;  4KLB A;  3C9E A;  2R9M A;  2B1M A;  5CHT A;  4BSQ A;  2NQI A;  4YYS A;  2E01 A;  2ARY A;  3IHP A;  1KHP A;  3M99 A;  1GMY A;  4DMX A;  3BWK A;  5EGW A;  4QH6 A;  3HD3 A;  2DJG B;  4CDC B;  4FJC A;  1GLO A;  1YK8 A;  3MHS A;  3U8E A;  2VHS A;  2CB5 A;  4QRV A;  3KWB X;  5JA7 A;  3CH2 X;  4AXL A;  1PPD A;  2DJF B;  2P0R A;  4OEL A;  3O0U A;  2XU1 A;  1NPZ A;  3N3K A;  1ME4 A;  4YVA A;  4P6G A;  1U9X A;  1EWP A;  4W5C A;  3IUT A;  1GEC E;  2PAD A;  9PAP A;  2YJ8 A;  1F2C A;  4YYR A;  6PAD A;  3P5W A;  3LFY A;  2DCC A;  4WA6 A;  4PP2 E;  2AUX A;  2FO5 A;  3BC3 A;  2DC8 A;  1CQD A;  3IEJ A;  1EWM A;  4PI3 A;  4YYW A;  2G8E A;  4BPV A;  4I05 A;  1THE A;  4I04 A;  1Y4H A;  1YT7 A;  2YJB A;  3F5V A;  1TLO A;  3CBJ A;  4Q8H A;  1NB5 A;  1IWD A;  2NQG A;  2HXZ A;  2ATO A;  3K24 A;  1XKG A;  4AXM A;  2AS8 A;  1SP4 B;  3MTN A;  3CH3 X;  2E02 A;  5A24 A;  1QMY A;  2C0Y A;  1AU2 A;  2XU4 A;  3S3R A;  1CPJ A;  4OEM A;  3PNR A;  2XU5 A;  2R9O A;  4N4Z A;  4BS6 A;  5CVO B;  4N79 A;  2DZZ A;  1ICF A;  3H8B A;  1BP4 A;  4PAD A;  4W5B A;  4ZUX U;  1A6R A;  4CDF B;  3K9M A;  1CB5 A;  1BY8 A;  2YJ2 A;  2NQD B;  3N4C A;  2OUL A;  1ATK A;  4CDE B;  2R9C A;  5CVM A;  4W4U A;  4P6E A;  2GHU A;  1AYW A;  4X6J A;  1K3B B;  5EF4 A;  3IMA A;  1CV8 A;  4CDD B;  2E03 A;  2NQA A;  3DF0 A;  3HHA A;  3F75 A;  4YYV A;  5FPW A;  3WXF A;  3CBK A;  3BPF A;  3RVV A;  3KFQ A;  1FH0 A;  3RVW A;  1CTE A;  2OP3 A;  8PCH A;  1PIP A;  1U5I A;  1AYU A;  1NL6 A;  1VJV A;  2VHF A;  2YJ9 A;  1CVZ A;  2B1N A;  2DC9 A;  1POP A;  1PXV A;  4G54 A;  2OZ2 A;  3KW9 A;  2DCA A;  1BQI A;  1QXP A;  1AU0 A;  3I06 A;  1ITO A;  1BGO A;  2Y6E A;  3D6S A;  5CVN B;  3BCN A;  2G8J A;  4YYQ A;  2FQ9 A;  2FYE A;  4N8W A;  2H7J A;  4RY2 A;  1MEM A;  4DMY A;  1EWL A;  3N3G A;  2JQG R;  4FIP A;  2FTD A;  4X6H A;  2AIM A;  1STF E;  1YAL A;  2DCD A;  3KX1 A;  3V6E A;  4Q8G A;  1ZIV A;  5CHV A;  4XUI A;  1PBH A;  1EWO A;  1KHQ A;  3K8U A;  2R9F A;  4BS5 A;  1S4V A;  3MHH A;  3TNX A;  2F7D A;  4QBB A;  1O0E A;  2G6D A;  2DZY A;  1PPN A;  2FRQ A;  1HUC B;  1PPO A;  2AYN A;  1VSN A;  1MS6 A;  1CS8 A;  4K7C A;  1AIM A;  3KKU A;  4X6I A;  1X9Y A;  3MOR A;  4I07 A;  2Y5B A;  2E00 A;  1AU3 A;  3KSE A;  4BQV A;  2O6X A;  3BPM A;  3I3T A;  4FK5 A;  1TU6 A;  3IOQ A;  3OF9 A;  1F2B A;  5J94 A;  1DEU A;  1MEG A;  2ACT A;  2XU3 A;  3H8C A;  3P5V A;  3PBH A;  1DF0 A;  3USV A;  3QSD A;  3B79 A;  3WXE A;  2IBI A;  4MZS A;  2HHN A;  4YV8 A;  1KXR A;  3RVX A;  2PBH A;  3QJ3 A;  3OVZ A;  1F29 A;  4MSX A;  1PPP A;  2BDZ A;  1PAD A;  2AUZ A;  2CIO A;  5F02 A;  1F2A A;  1JQP A;  3S3Q A;  5JH3 A;  3H7D A;  7PCK A;  1YK7 A;  1MHW A;  2BDL A;  3H6S A;  2G7Y A;  2P86 A;  1KFX L;  2PRE A;  1GCB A;  3KWZ A;  5K16 A;  4MZO A;  2IPP B;  4QRX A;  4PP1 A;  2FT2 A;  1PCI A;  2FUD A;  3H89 A;  1M6D A;  3E1Z B;  3V6C A;  3WXG A;  4QRG A;  3AI8 A;  1CSB B;  3P5X A;  2DC7 A;  2FRA A; 
#chains in the Genus database with same CATH topology
 3MP2 A;  4RF0 A;  4PT5 A;  1U9Q X;  3TMP A;  4D8I A;  2AVW A;  3P5U A;  4HWY A;  1NLJ A;  3PRM A;  2DC6 A;  1TL9 A;  2AU1 A;  5PAD A;  1MDW A;  2JRI A;  1SNK A;  3O65 A;  1ZCM A;  2YJC A;  3GCB A;  2GFO A;  3HWN A;  3O1G A;  3OVX A;  1U9W A;  1CJL A;  1Y08 A;  3OIS A;  3IV2 A;  3QT4 A;  2JTC A;  1NQC A;  3ZUA A;  1YVB A;  4XR7 A;  1EF7 A;  3W31 A;  2DCB A;  1MIR A;  3ERV A;  2AYO A;  3PDF A;  1Q6K A;  2HD5 A;  4IUM A;  3BOW A;  2WBF X;  1NB3 A;  3OQC A;  3HHI A;  3PT2 A;  2F1G A;  4CZW A;  1ME3 A;  2HH5 A;  1AYV A;  3OF8 A;  1KFU L;  2JQF R;  1AU4 A;  2R6N A;  3LXS A;  3PW3 A;  1QOL A;  1AEC A;  1PE6 A;  1U9V A;  2R9N A;  1QDQ A;  2PNS A;  4YYU A;  3NHE A;  2P7U A;  4KLB A;  3C9E A;  2R9M A;  2B1M A;  5CHT A;  4ZTB A;  4BSQ A;  2NQI A;  4YYS A;  2E01 A;  2ARY A;  3IHP A;  1KHP A;  3PHX A;  3BB7 A;  4R3D A;  3M99 A;  1GMY A;  4DMX A;  3BWK A;  5EGW A;  4QH6 A;  3HD3 A;  2DJG B;  4CDC B;  4FJC A;  1GLO A;  1YK8 A;  3IFU A;  3MHS A;  3U8E A;  2VHS A;  2CB5 A;  4QRV A;  3KWB X;  5JA7 A;  3CH2 X;  4M0W A;  4AXL A;  1PPD A;  2DJF B;  2P0R A;  4BOZ A;  3BBA A;  4OEL A;  3O0U A;  2XU1 A;  1NPZ A;  2FE8 A;  3PHU A;  3N3K A;  1ME4 A;  4YVA A;  4P6G A;  1U9X A;  1EWP A;  4W5C A;  5JZE A;  3IUT A;  1GEC E;  2PAD A;  9PAP A;  2YJ8 A;  1F2C A;  4YYR A;  6PAD A;  3P5W A;  4A5U A;  3LFY A;  2DCC A;  4WA6 A;  4PP2 E;  2AUX A;  2FO5 A;  3BC3 A;  2DC8 A;  1CQD A;  3IEJ A;  1EWM A;  4PI3 A;  4YYW A;  2G8E A;  1YZB A;  4BPV A;  4I05 A;  1THE A;  4I04 A;  1Y4H A;  3RNV A;  1YT7 A;  2YJB A;  3F5V A;  1TLO A;  3W30 A;  3CBJ A;  4Q8H A;  1NB5 A;  1IWD A;  2NQG A;  2HXZ A;  1PVJ A;  2ATO A;  3K24 A;  1XKG A;  4AXM A;  2Z84 A;  2AS8 A;  2UZJ A;  4XZX A;  4BOS A;  1SP4 B;  3MTN A;  3CH3 X;  2E02 A;  5A24 A;  1QMY A;  2C0Y A;  1AU2 A;  2XU4 A;  2BU3 A;  3S3R A;  4BOP A;  1CPJ A;  4OEM A;  3PNR A;  2XU5 A;  2R9O A;  4N4Z A;  3MTV A;  4BS6 A;  5CVO B;  4N79 A;  2DZZ A;  1ICF A;  3H8B A;  1BP4 A;  4REZ A;  4RNA A;  4PAD A;  4W5B A;  4ZUX U;  1A6R A;  4CDF B;  3K9M A;  1CB5 A;  1BY8 A;  2YJ2 A;  2J7Q A;  2NQD B;  3N4C A;  2OUL A;  1ATK A;  4CDE B;  2R9C A;  5CVM A;  4W4U A;  4BOU A;  4P6E A;  2GHU A;  1AYW A;  4X6J A;  1K3B B;  5EF4 A;  3IMA A;  1CV8 A;  4CDD B;  2E03 A;  2NQA A;  3DF0 A;  3HHA A;  3F75 A;  4YYV A;  5FPW A;  4MI7 A;  3WXF A;  3CBK A;  3BPF A;  3RVV A;  3KFQ A;  4OVZ B;  1FH0 A;  3BY4 A;  3C0R A;  3RVW A;  1CTE A;  2OP3 A;  4HXD B;  8PCH A;  1PIP A;  2HWK A;  1U5I A;  1AYU A;  1NL6 A;  1VJV A;  2VHF A;  4GUA A;  4OW0 A;  2YJ9 A;  1CVZ A;  2B1N A;  1DKI A;  3ZNH A;  2DC9 A;  1POP A;  1PXV A;  4G54 A;  2OZ2 A;  3KW9 A;  2DCA A;  1BQI A;  1QXP A;  4BOQ A;  1AU0 A;  3I06 A;  1ITO A;  4IP3 A;  1BGO A;  2Y6E A;  3D6S A;  5CVN B;  3BCN A;  2G8J A;  4YYQ A;  2FQ9 A;  2FYE A;  4N8W A;  2H7J A;  2J7Q C;  1MEM A;  4RY2 A;  3MJ5 A;  3PSE A;  4DMY A;  1EWL A;  3N3G A;  2JQG R;  4FIP A;  2FTD A;  4X6H A;  2AIM A;  1STF E;  5KO3 A;  4WUR A;  1YAL A;  2DCD A;  3KX1 A;  3V6E A;  4Q8G A;  1ZIV A;  3B21 A;  5CHV A;  4XUI A;  1PBH A;  1EWO A;  2BTW B;  1KHQ A;  3K8U A;  2R9F A;  4BS5 A;  1S4V A;  3MHH A;  3TNX A;  2F7D A;  2G6D A;  1O0E A;  4QBB A;  2DZY A;  1PPN A;  2FRQ A;  1HUC B;  1PPO A;  2AYN A;  1VSN A;  1MS6 A;  1CS8 A;  4D8B A;  4OVZ A;  4K7C A;  1AIM A;  3KKU A;  4X6I A;  1X9Y A;  3MOR A;  4I07 A;  2Y5B A;  2E00 A;  1AU3 A;  3KSE A;  4BQV A;  2O6X A;  3BPM A;  3I3T A;  4FK5 A;  1TU6 A;  3IOQ A;  3OF9 A;  3E9S A;  1F2B A;  5J94 A;  1DEU A;  1MEG A;  2ACT A;  2XU3 A;  3H8C A;  3P5V A;  3PBH A;  5EZS A;  5E6J A;  1DF0 A;  3USV A;  3QSD A;  4P16 A;  3B79 A;  3WXE A;  2IBI A;  2AGA A;  4MZS A;  2HHN A;  4YV8 A;  1KXR A;  3RVX A;  2PBH A;  3QJ3 A;  3OVZ A;  5EZQ A;  4D8E A;  1F29 A;  4MSX A;  3TRK A;  1PPP A;  2BDZ A;  1PAD A;  2AUZ A;  2CIO A;  5F02 A;  1F2A A;  1JQP A;  3S3Q A;  5JH3 A;  3H7D A;  4RKX A;  7PCK A;  1YK7 A;  3PRP A;  1MHW A;  2BDL A;  3H6S A;  2DOS A;  2G7Y A;  2P86 A;  1KFX L;  2PRE A;  1GCB A;  3KWZ A;  5K16 A;  3PHW A;  4MZO A;  2IPP B;  4QRX A;  4PP1 A;  4MM3 B;  2FT2 A;  1PCI A;  2FUD A;  3H89 A;  1M6D A;  3E1Z B;  3V6C A;  3WXG A;  2BTW A;  4QRG A;  4RF1 A;  3AI8 A;  1CSB B;  3P5X A;  1UKF A;  2DC7 A;  2FRA A; 
#chains in the Genus database with same CATH homology
 1U9Q X;  2AVW A;  3P5U A;  4HWY A;  1NLJ A;  2DC6 A;  1TL9 A;  2AU1 A;  5PAD A;  1MDW A;  1SNK A;  1ZCM A;  2YJC A;  3GCB A;  2GFO A;  3HWN A;  3O1G A;  3OVX A;  1U9W A;  1CJL A;  1Y08 A;  3OIS A;  3IV2 A;  3QT4 A;  1NQC A;  3ZUA A;  1YVB A;  4XR7 A;  1EF7 A;  2DCB A;  1MIR A;  3ERV A;  2AYO A;  3PDF A;  1Q6K A;  2HD5 A;  3BOW A;  2WBF X;  1NB3 A;  3HHI A;  2F1G A;  4CZW A;  1ME3 A;  2HH5 A;  1AYV A;  3OF8 A;  1KFU L;  2JQF R;  1AU4 A;  2R6N A;  3LXS A;  3PW3 A;  1QOL A;  1AEC A;  1PE6 A;  1U9V A;  2R9N A;  1QDQ A;  2PNS A;  4YYU A;  3NHE A;  2P7U A;  4KLB A;  3C9E A;  2R9M A;  2B1M A;  5CHT A;  4NV8 A;  4BSQ A;  2NQI A;  4YYS A;  2E01 A;  2ARY A;  3IHP A;  1KHP A;  3M99 A;  1GMY A;  4DMX A;  3BWK A;  5EGW A;  4QH6 A;  3HD3 A;  2DJG B;  4CDC B;  4FJC A;  1GLO A;  1YK8 A;  3MHS A;  3U8E A;  2VHS A;  2CB5 A;  4QRV A;  3KWB X;  5JA7 A;  3CH2 X;  4AXL A;  1PPD A;  2DJF B;  2P0R A;  4OEL A;  3O0U A;  2XU1 A;  1NPZ A;  3N3K A;  1ME4 A;  4YVA A;  4P6G A;  1U9X A;  1EWP A;  4W5C A;  3IUT A;  1GEC E;  2PAD A;  9PAP A;  2YJ8 A;  1F2C A;  4C5P A;  4YYR A;  6PAD A;  3P5W A;  3LFY A;  2DCC A;  4WA6 A;  4PP2 E;  2AUX A;  2FO5 A;  3BC3 A;  2DC8 A;  1CQD A;  3IEJ A;  1EWM A;  4PI3 A;  4YYW A;  2G8E A;  4BPV A;  4I05 A;  1THE A;  4I04 A;  1Y4H A;  1YT7 A;  2YJB A;  3F5V A;  1TLO A;  1W6F A;  3CBJ A;  4Q8H A;  1NB5 A;  1IWD A;  2NQG A;  2HXZ A;  2ATO A;  3K24 A;  1XKG A;  4AXM A;  2VFC A;  2AS8 A;  2BSZ A;  1SP4 B;  3MTN A;  3CH3 X;  2E02 A;  5A24 A;  1QMY A;  2C0Y A;  1AU2 A;  2XU4 A;  3S3R A;  1CPJ A;  4OEM A;  3PNR A;  2XU5 A;  2R9O A;  4N4Z A;  4BS6 A;  5CVO B;  4N79 A;  2DZZ A;  1ICF A;  3H8B A;  1BP4 A;  4PAD A;  4W5B A;  4ZUX U;  1A6R A;  4CDF B;  3K9M A;  1CB5 A;  1BY8 A;  2YJ2 A;  2NQD B;  3N4C A;  2OUL A;  1ATK A;  4CDE B;  2R9C A;  5CVM A;  4W4U A;  4P6E A;  2GHU A;  1AYW A;  4X6J A;  1K3B B;  5EF4 A;  3IMA A;  1CV8 A;  4CDD B;  2E03 A;  2NQA A;  3DF0 A;  1W4T A;  3HHA A;  3F75 A;  4YYV A;  5FPW A;  3WXF A;  3CBK A;  3BPF A;  3RVV A;  3KFQ A;  1FH0 A;  1E2T A;  4NV7 A;  3RVW A;  1CTE A;  4GUZ A;  2OP3 A;  8PCH A;  1PIP A;  1U5I A;  1AYU A;  1NL6 A;  1VJV A;  2VHF A;  2YJ9 A;  1CVZ A;  2B1N A;  2DC9 A;  1POP A;  1PXV A;  4G54 A;  2OZ2 A;  4B55 A;  3KW9 A;  1W5R A;  2DCA A;  1BQI A;  1QXP A;  1AU0 A;  3I06 A;  1ITO A;  1BGO A;  2Y6E A;  3D6S A;  5CVN B;  3BCN A;  2G8J A;  4YYQ A;  2FQ9 A;  2FYE A;  4N8W A;  2H7J A;  4RY2 A;  1MEM A;  4DMY A;  1EWL A;  3N3G A;  2JQG R;  4FIP A;  2FTD A;  4X6H A;  2AIM A;  1STF E;  1YAL A;  2DCD A;  3KX1 A;  3V6E A;  4Q8G A;  1ZIV A;  5CHV A;  4XUI A;  1PBH A;  1EWO A;  1KHQ A;  3K8U A;  2R9F A;  4BS5 A;  1S4V A;  3MHH A;  3TNX A;  2F7D A;  4QBB A;  1O0E A;  2G6D A;  2DZY A;  1PPN A;  2FRQ A;  1HUC B;  1PPO A;  2AYN A;  1VSN A;  1MS6 A;  1CS8 A;  4K7C A;  4BGF A;  1AIM A;  3KKU A;  4X6I A;  1X9Y A;  3MOR A;  4I07 A;  2Y5B A;  2E00 A;  1AU3 A;  3KSE A;  4BQV A;  2O6X A;  3BPM A;  3I3T A;  4FK5 A;  1TU6 A;  3IOQ A;  3OF9 A;  1F2B A;  5J94 A;  1DEU A;  1MEG A;  2ACT A;  2XU3 A;  3H8C A;  3P5V A;  3PBH A;  1DF0 A;  3USV A;  3QSD A;  3B79 A;  3WXE A;  2IBI A;  4MZS A;  2HHN A;  4YV8 A;  1KXR A;  3RVX A;  2PBH A;  3QJ3 A;  1GX3 A;  3OVZ A;  1F29 A;  4MSX A;  1PPP A;  2BDZ A;  1PAD A;  3D9W A;  2AUZ A;  2CIO A;  5F02 A;  1F2A A;  1JQP A;  3S3Q A;  2VFB A;  5JH3 A;  3H7D A;  7PCK A;  1YK7 A;  1MHW A;  2BDL A;  3H6S A;  2G7Y A;  2P86 A;  1KFX L;  2PRE A;  1GCB A;  3KWZ A;  5K16 A;  3LTW A;  4MZO A;  2IPP B;  4QRX A;  4PP1 A;  2FT2 A;  1PCI A;  2FUD A;  3H89 A;  1M6D A;  3E1Z B;  3V6C A;  3WXG A;  4QRG A;  3AI8 A;  1CSB B;  3P5X A;  2DC7 A;  2FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...