4DMXA

Cathepsin k inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (1R,2R)-N-(1-cyanocyclopropyl)-2-(6-methoxy-1,3,4,5-tetrahydropyrido[4,3-b]indole-2-carbonyl)cyclohexanecarboxamide (AZD4996): a potent and highly selective cathepsin K inhibitor for the treatment of osteoarthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin K
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4dmxA00
2FUDA 3BWKA 3P5WA 2HHNA 4BS6A 1X9YA 1PCIA 1MEGA 3F5VA 4N4ZA 1DEUA 4FK5A 3D6SA 3B79A 3I3TA 2VHSA 2F1GA 4DMYA 1CS8A 1BQIA 4CZWA 3MTNA 2CB5A 3OVXA 1MIRA 1KFUL 3TNXA 3QSDA 3NHEA 4G54A 1YK8A 1AYWA 2OULA 3PDFA 1GLOA 1FH0A 1KHPA 2XU5A 1MDWA 2C0YA 1CSBB 4Q8HA 4AXMA 4PP1A 3H7DA 1TL9A 2YJCA 1PPOA 2FYEA 1AU3A 3O0UA 1QDQA 3LXSA 5JH3A 1YT7A 1S4VA 3H8CA 3ERVA 2R9NA 3BCNA 4AXLA 4CDFB 3PW3A 2PADA 3OF9A 3O1GA 1NQCA 7PCKA 1GCBA 2PBHA 4FJCA 2CIOA 1NPZA 3C9EA 2WBFX 3S3RA 1BGOA 4W5BA 1YK7A 3M99A 4QRGA 4MZOA 2HXZA 2OP3A 3CBKA 2DC7A 1TU6A 2NQGA 2NQIA 2DCAA 4YYUA 3USVA 3BPMA 2DCBA 3K9MA 6PADA 2DZYA 1F29A 1TLOA 4ZUXU 1PPNA 1PE6A 3OF8A 2BDLA 2HD5A 3H6SA 2XU3A 3IOQA 4N79A 1CTEA 2FT2A 2G6DA 1JQPA 1CPJA 2GFOA 2NQAA 1AYUA 4MZSA 1CV8A 2BDZA 5FPWA 3KWBX 4BSQA 3CH2X 4P6EA 3N3GA 1M6DA 1ME4A 3AI8A 4YVAA 4X6IA 2YJ8A 1MEMA 4BPVA 1NB3A 1ZIVA 2DC9A 2P86A 1SP4B 1MS6A 1STFE 4HWYA 4CDDB 1U9WA 1NB5A 4QRVA 9PAPA 1QMYA 1KXRA 2E02A 5JA7A 1EF7A 4QBBA 3E1ZB 2P7UA 4WA6A 3U8EA 1EWLA 1Y4HA 3KWZA 3MORA 3CBJA 4X6JA 1PADA 2AU1A 1Q6KA 2R9FA 2F7DA 3H8BA 3MHHA 2ATOA 5A24A 3GCBA 2VHFA 2HH5A 3KW9A 3BC3A 1F2AA 4BQVA 2YJ2A 3IUTA 1AU0A 2PNSA 4P6GA 3V6CA 2E03A 3F75A 4Q8GA 2DC8A 3KFQA 2DCDA 4QRXA 2DC6A 2YJ9A 2DJGB 1AYVA 4PP2E 4I07A 4YYWA 3LFYA 1EWPA 1PPPA 3KKUA 2AUZA 3BPFA 3P5UA 2R9OA 1BY8A 1K3BB 3N3KA 1AU4A 5EGWA 2B1NA 2E00A 2AS8A 1MHWA 1HUCB 4CDEB 4X6HA 1ZCMA 5F02A 1PXVA 4DMXA 2ARYA 4RY2A 2AYNA 2H7JA 3N4CA 2AVWA 3KX1A 4OEMA 5CHVA 8PCHA 1DF0A 5CHTA 4MSXA 2XU4A 1KHQA 4YYVA 3HHAA 3ZUAA 1ME3A 1U5IA 3DF0A 4W4UA 1QOLA 5CVOB 2FO5A 1U9XA 1GMYA 4N8WA 3V6EA 1A6RA 3S3QA 3WXGA 1YALA 1PBHA 3K24A 4K7CA 2NQDB 1GECE 4XR7A 2GHUA 4YV8A 1BP4A 2YJBA 1XKGA 2DZZA 2AIMA 2AYOA 1IWDA 4CDCB 3RVXA 3OISA 4OELA 1U9VA 1EWOA 1POPA 2P0RA 2OZ2A 2JQGR 2XU1A 1ITOA 3P5XA 2FTDA 4FIPA 2FQ9A 1U9QX 2G7YA 2FRQA 1O0EA 4I04A 1SNKA 3OVZA 4PI3A 1AECA 3H89A 2PREA 1AIMA 3QJ3A 1F2BA 3K8UA 3RVVA 2IPPB 1NL6A 4QH6A 3WXFA 4YYQA 4YYRA 1QXPA 4PADA 2G8JA 1KFXL 3CH3X 1ATKA 2JQFR 5CVMA 1CQDA 1CJLA 4YYSA 5J94A 3RVWA 2E01A 4I05A 1AU2A 3MHSA 3HHIA 5CVNB 5K16A 4KLBA 1ICFA 1VJVA 2IBIA 3QT4A 2B1MA 3PNRA 3IHPA 1VSNA 4BS5A 1EWMA 3I06A 3P5VA 1PIPA 1F2CA 2R9MA 3HWNA 1Y08A 2Y6EA 2R6NA 1PPDA 1CVZA 2ACTA 3IEJA 1THEA 2AUXA 3WXEA 3PBHA 2FRAA 2Y5BA 4XUIA 1NLJA 2G8EA 1CB5A 3BOWA 5PADA 4W5CA 2R9CA 3KSEA 3IV2A 3HD3A 3IMAA 2O6XA 1YVBA 2DCCA 2DJFB 5EF4A
chains in the Genus database with same CATH superfamily
2FUDA 3BWKA 3P5WA 4HXDB 2HHNA 4BS6A 1X9YA 1PCIA 1MEGA 3F5VA 4N4ZA 1DEUA 4FK5A 3D6SA 4IUMA 3B79A 4RNAA 3I3TA 2VHSA 2F1GA 4DMYA 1CS8A 1BQIA 4CZWA 3MTNA 2CB5A 3OVXA 4PT5A 5E6JA 3PT2A 1MIRA 1KFUL 3TNXA 3MTVA 3QSDA 3NHEA 4G54A 1YK8A 1AYWA 2OULA 3PDFA 1GLOA 1FH0A 1KHPA 2FE8A 2XU5A 1MDWA 2C0YA 1CSBB 4Q8HA 4AXMA 4PP1A 5EZQA 3H7DA 1TL9A 2YJCA 1PPOA 2FYEA 1AU3A 3O0UA 1QDQA 3LXSA 5JH3A 1YT7A 3W30A 1S4VA 3H8CA 4REZA 3ERVA 2R9NA 3BCNA 4AXLA 4CDFB 3PW3A 2PADA 3OF9A 3O1GA 1NQCA 3ZNHA 7PCKA 1GCBA 2PBHA 3O65A 4FJCA 2CIOA 1NPZA 3C9EA 2JRIA 2WBFX 3S3RA 1BGOA 3PRMA 4W5BA 1YK7A 3M99A 4QRGA 4MZOA 2HXZA 2OP3A 3CBKA 2HWKA 2DC7A 4OVZB 1TU6A 3MJ5A 2NQGA 2NQIA 2DCAA 3E9SA 4YYUA 3USVA 3BPMA 3MP2A 2DCBA 3K9MA 6PADA 2DZYA 2DOSA 4D8IA 4MI7A 1F29A 1TLOA 4ZUXU 1PPNA 1PE6A 3OF8A 2BDLA 3RNVA 2HD5A 3H6SA 4IP3A 2XU3A 3IOQA 4N79A 2J7QC 4P16A 1CTEA 4BOUA 2FT2A 2G6DA 1JQPA 1CPJA 2GFOA 2NQAA 3PSEA 1AYUA 4MZSA 1CV8A 2BDZA 3BB7A 1DKIA 4A5UA 5FPWA 3KWBX 2UZJA 4BSQA 3CH2X 4P6EA 3N3GA 1M6DA 1ME4A 3AI8A 4YVAA 4X6IA 2YJ8A 1MEMA 3BBAA 4BPVA 1NB3A 4OW0A 1ZIVA 2DC9A 2P86A 1PVJA 1SP4B 1MS6A 1STFE 4HWYA 4CDDB 1U9WA 1NB5A 4QRVA 9PAPA 1QMYA 1KXRA 2E02A 5KO3A 5JA7A 1EF7A 4QBBA 3E1ZB 2P7UA 4WA6A 3U8EA 1EWLA 1Y4HA 3KWZA 3MORA 3CBJA 4X6JA 1PADA 2AU1A 1Q6KA 2R9FA 2F7DA 3H8BA 3MHHA 3PHXA 4R3DA 2ATOA 5A24A 2BTWB 4RF1A 3GCBA 2VHFA 2HH5A 3KW9A 3BC3A 1F2AA 4BQVA 2YJ2A 3IUTA 1AU0A 1UKFA 4XZXA 2PNSA 4P6GA 3V6CA 4M0WA 2E03A 3F75A 4Q8GA 2DC8A 3KFQA 2DCDA 4QRXA 5EZSA 2DC6A 2YJ9A 2DJGB 1AYVA 4PP2E 2AGAA 4WURA 4I07A 4YYWA 3LFYA 1EWPA 1PPPA 3KKUA 2AUZA 3BPFA 3P5UA 2R9OA 1BY8A 1K3BB 3N3KA 1AU4A 5EGWA 2B1NA 3OQCA 2E00A 2AS8A 1MHWA 1HUCB 4CDEB 2BU3A 4BOQA 4X6HA 4RKXA 1ZCMA 5F02A 4ZTBA 1PXVA 4DMXA 2ARYA 4RY2A 2AYNA 2H7JA 3N4CA 2AVWA 3KX1A 3TMPA 4OEMA 5CHVA 8PCHA 1DF0A 5CHTA 4MSXA 4D8BA 2XU4A 1KHQA 4YYVA 3HHAA 3ZUAA 1ME3A 1U5IA 4D8EA 3DF0A 4W4UA 1QOLA 5CVOB 2FO5A 1U9XA 1GMYA 4N8WA 3V6EA 1A6RA 3S3QA 3PHWA 3WXGA 2JTCA 1YALA 1PBHA 3K24A 4K7CA 2NQDB 1GECE 4MM3B 4XR7A 2GHUA 4YV8A 1BP4A 3C0RA 2YJBA 1XKGA 2DZZA 2AIMA 2AYOA 1IWDA 4CDCB 3RVXA 3OISA 4OELA 1U9VA 1EWOA 1POPA 2P0RA 2OZ2A 2JQGR 3TRKA 2XU1A 1ITOA 3P5XA 2FTDA 4FIPA 2FQ9A 4GUAA 1U9QX 2G7YA 2FRQA 1O0EA 4I04A 1SNKA 3OVZA 4PI3A 1AECA 3H89A 2PREA 1AIMA 3QJ3A 4BOPA 1F2BA 3K8UA 3RVVA 2IPPB 1NL6A 4QH6A 3WXFA 4YYQA 5JZEA 4YYRA 1QXPA 4PADA 2G8JA 3PRPA 1KFXL 2Z84A 3CH3X 1ATKA 2JQFR 5CVMA 1CQDA 3PHUA 1CJLA 4YYSA 5J94A 3RVWA 2E01A 2BTWA 4I05A 1AU2A 3MHSA 3HHIA 5CVNB 5K16A 4KLBA 1ICFA 1VJVA 2IBIA 3QT4A 2B1MA 3PNRA 3IHPA 1VSNA 3BY4A 4BS5A 1EWMA 3I06A 3P5VA 1PIPA 2J7QA 1F2CA 2R9MA 3HWNA 1Y08A 2Y6EA 2R6NA 1PPDA 1CVZA 2ACTA 3IEJA 1THEA 2AUXA 4BOZA 3WXEA 3PBHA 2FRAA 3W31A 4RF0A 1YZBA 4OVZA 2Y5BA 4XUIA 1NLJA 2G8EA 1CB5A 3BOWA 5PADA 4BOSA 4W5CA 3IFUA 2R9CA 3KSEA 3IV2A 3HD3A 3IMAA 2O6XA 3B21A 1YVBA 2DCCA 2DJFB 5EF4A
chains in the Genus database with same CATH topology
2FUDA 3BWKA 3P5WA 2HHNA 4BS6A 1X9YA 1PCIA 1MEGA 3F5VA 4N4ZA 1DEUA 4FK5A 3D6SA 3B79A 4C5PA 3I3TA 2VHSA 2F1GA 4DMYA 1CS8A 1BQIA 4CZWA 3MTNA 2CB5A 3OVXA 1MIRA 4BGFA 1KFUL 3TNXA 3QSDA 3NHEA 4G54A 1YK8A 1AYWA 2OULA 3PDFA 1GLOA 1FH0A 1KHPA 2XU5A 1MDWA 2C0YA 1CSBB 4Q8HA 4AXMA 4PP1A 3H7DA 1TL9A 2YJCA 1PPOA 2FYEA 4NV8A 1AU3A 3O0UA 1QDQA 3LXSA 5JH3A 1YT7A 1S4VA 3H8CA 3ERVA 2R9NA 3BCNA 4AXLA 4CDFB 3PW3A 2PADA 3OF9A 3O1GA 1NQCA 7PCKA 1GCBA 2PBHA 4FJCA 2CIOA 1NPZA 3C9EA 2WBFX 3S3RA 1BGOA 4W5BA 1YK7A 3M99A 4QRGA 4MZOA 2HXZA 2OP3A 3CBKA 1W6FA 2DC7A 1TU6A 2NQGA 2NQIA 2DCAA 4YYUA 3USVA 3BPMA 2DCBA 3K9MA 6PADA 2DZYA 1F29A 1TLOA 4ZUXU 1PPNA 1PE6A 3OF8A 2BDLA 2HD5A 3H6SA 2XU3A 3IOQA 4N79A 1CTEA 2FT2A 2G6DA 1JQPA 1CPJA 2GFOA 2NQAA 1AYUA 4MZSA 1CV8A 2BDZA 5FPWA 3KWBX 4BSQA 3CH2X 4P6EA 3N3GA 1M6DA 1ME4A 3AI8A 4YVAA 4X6IA 2YJ8A 1MEMA 4BPVA 1NB3A 1ZIVA 2DC9A 2P86A 1SP4B 1MS6A 1STFE 1E2TA 4HWYA 4CDDB 1U9WA 1NB5A 4QRVA 9PAPA 1QMYA 1KXRA 2E02A 5JA7A 1EF7A 4QBBA 3E1ZB 2P7UA 4WA6A 3U8EA 1EWLA 1Y4HA 3KWZA 3MORA 3CBJA 4X6JA 1PADA 2AU1A 1Q6KA 2R9FA 2F7DA 3H8BA 3MHHA 2ATOA 5A24A 3GCBA 2VHFA 1GX3A 2HH5A 3KW9A 3BC3A 1F2AA 4BQVA 2YJ2A 3IUTA 1AU0A 2PNSA 4P6GA 3V6CA 2E03A 3F75A 4Q8GA 2DC8A 3KFQA 2DCDA 4QRXA 4B55A 2DC6A 2YJ9A 2DJGB 1AYVA 4PP2E 4I07A 4YYWA 3LFYA 1EWPA 1PPPA 3KKUA 2AUZA 3BPFA 3P5UA 2R9OA 1BY8A 1K3BB 3N3KA 1AU4A 5EGWA 2B1NA 2E00A 2AS8A 1MHWA 1HUCB 4CDEB 4X6HA 3D9WA 1ZCMA 5F02A 1W4TA 1PXVA 4DMXA 2ARYA 4RY2A 2AYNA 2H7JA 3N4CA 2AVWA 3KX1A 4OEMA 5CHVA 8PCHA 1DF0A 5CHTA 4MSXA 2XU4A 1KHQA 4YYVA 3HHAA 3ZUAA 1ME3A 1U5IA 3DF0A 4NV7A 4W4UA 1QOLA 5CVOB 2FO5A 1U9XA 1GMYA 4N8WA 3V6EA 1A6RA 3S3QA 3WXGA 1YALA 1PBHA 3K24A 4K7CA 2NQDB 1GECE 4XR7A 2GHUA 4YV8A 1BP4A 2YJBA 1XKGA 2VFCA 2DZZA 2AIMA 2AYOA 1IWDA 4CDCB 3RVXA 3OISA 4OELA 1U9VA 1EWOA 1POPA 2P0RA 2VFBA 2OZ2A 2JQGR 2XU1A 1ITOA 3P5XA 2FTDA 4FIPA 2FQ9A 1U9QX 2G7YA 2FRQA 1O0EA 4I04A 1SNKA 3OVZA 4PI3A 1AECA 3H89A 2PREA 1AIMA 3QJ3A 1F2BA 3K8UA 3RVVA 2IPPB 1NL6A 4QH6A 3WXFA 4YYQA 4YYRA 1QXPA 4PADA 2G8JA 1KFXL 3CH3X 1ATKA 2BSZA 2JQFR 5CVMA 1CQDA 1CJLA 4YYSA 5J94A 3RVWA 2E01A 4I05A 1AU2A 3MHSA 4GUZA 3HHIA 5CVNB 5K16A 4KLBA 1ICFA 1VJVA 2IBIA 3QT4A 2B1MA 3PNRA 3IHPA 1VSNA 4BS5A 1EWMA 3I06A 3P5VA 1PIPA 1F2CA 2R9MA 3HWNA 1Y08A 2Y6EA 2R6NA 1PPDA 1CVZA 2ACTA 3IEJA 1THEA 2AUXA 3WXEA 3PBHA 1W5RA 2FRAA 2Y5BA 4XUIA 1NLJA 3LTWA 2G8EA 1CB5A 3BOWA 5PADA 4W5CA 2R9CA 3KSEA 3IV2A 3HD3A 3IMAA 2O6XA 1YVBA 2DCCA 2DJFB 5EF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUD A;  3BWK A;  3P5W A;  2HHN A;  4BS6 A;  1X9Y A;  1PCI A;  1MEG A;  3F5V A;  4N4Z A;  1DEU A;  4FK5 A;  3D6S A;  3B79 A;  3I3T A;  2VHS A;  2F1G A;  4DMY A;  1CS8 A;  1BQI A;  4CZW A;  3MTN A;  2CB5 A;  3OVX A;  1MIR A;  1KFU L;  3TNX A;  3QSD A;  3NHE A;  4G54 A;  1YK8 A;  1AYW A;  2OUL A;  3PDF A;  1GLO A;  1FH0 A;  1KHP A;  2XU5 A;  1MDW A;  2C0Y A;  1CSB B;  4Q8H A;  4AXM A;  4PP1 A;  3H7D A;  1TL9 A;  2YJC A;  1PPO A;  2FYE A;  1AU3 A;  3O0U A;  1QDQ A;  3LXS A;  5JH3 A;  1YT7 A;  1S4V A;  3H8C A;  3ERV A;  2R9N A;  3BCN A;  4AXL A;  4CDF B;  3PW3 A;  2PAD A;  3OF9 A;  3O1G A;  1NQC A;  7PCK A;  1GCB A;  2PBH A;  4FJC A;  2CIO A;  1NPZ A;  3C9E A;  2WBF X;  3S3R A;  1BGO A;  4W5B A;  1YK7 A;  3M99 A;  4QRG A;  4MZO A;  2HXZ A;  2OP3 A;  3CBK A;  2DC7 A;  1TU6 A;  2NQG A;  2NQI A;  2DCA A;  4YYU A;  3USV A;  3BPM A;  2DCB A;  3K9M A;  6PAD A;  2DZY A;  1F29 A;  1TLO A;  4ZUX U;  1PPN A;  1PE6 A;  3OF8 A;  2BDL A;  2HD5 A;  3H6S A;  2XU3 A;  3IOQ A;  4N79 A;  1CTE A;  2FT2 A;  2G6D A;  1JQP A;  1CPJ A;  2GFO A;  2NQA A;  1AYU A;  4MZS A;  1CV8 A;  2BDZ A;  5FPW A;  3KWB X;  4BSQ A;  3CH2 X;  4P6E A;  3N3G A;  1M6D A;  1ME4 A;  3AI8 A;  4YVA A;  4X6I A;  2YJ8 A;  1MEM A;  4BPV A;  1NB3 A;  1ZIV A;  2DC9 A;  2P86 A;  1SP4 B;  1MS6 A;  1STF E;  4HWY A;  4CDD B;  1U9W A;  1NB5 A;  4QRV A;  9PAP A;  1QMY A;  1KXR A;  2E02 A;  5JA7 A;  1EF7 A;  4QBB A;  3E1Z B;  2P7U A;  4WA6 A;  3U8E A;  1EWL A;  1Y4H A;  3KWZ A;  3MOR A;  3CBJ A;  4X6J A;  1PAD A;  2AU1 A;  1Q6K A;  2R9F A;  2F7D A;  3H8B A;  3MHH A;  2ATO A;  5A24 A;  3GCB A;  2VHF A;  2HH5 A;  3KW9 A;  3BC3 A;  1F2A A;  4BQV A;  2YJ2 A;  3IUT A;  1AU0 A;  2PNS A;  4P6G A;  3V6C A;  2E03 A;  3F75 A;  4Q8G A;  2DC8 A;  3KFQ A;  2DCD A;  4QRX A;  2DC6 A;  2YJ9 A;  2DJG B;  1AYV A;  4PP2 E;  4I07 A;  4YYW A;  3LFY A;  1EWP A;  1PPP A;  3KKU A;  2AUZ A;  3BPF A;  3P5U A;  2R9O A;  1BY8 A;  1K3B B;  3N3K A;  1AU4 A;  5EGW A;  2B1N A;  2E00 A;  2AS8 A;  1MHW A;  1HUC B;  4CDE B;  4X6H A;  1ZCM A;  5F02 A;  1PXV A;  4DMX A;  2ARY A;  4RY2 A;  2AYN A;  2H7J A;  3N4C A;  2AVW A;  3KX1 A;  4OEM A;  5CHV A;  8PCH A;  1DF0 A;  5CHT A;  4MSX A;  2XU4 A;  1KHQ A;  4YYV A;  3HHA A;  3ZUA A;  1ME3 A;  1U5I A;  3DF0 A;  4W4U A;  1QOL A;  5CVO B;  2FO5 A;  1U9X A;  1GMY A;  4N8W A;  3V6E A;  1A6R A;  3S3Q A;  3WXG A;  1YAL A;  1PBH A;  3K24 A;  4K7C A;  2NQD B;  1GEC E;  4XR7 A;  2GHU A;  4YV8 A;  1BP4 A;  2YJB A;  1XKG A;  2DZZ A;  2AIM A;  2AYO A;  1IWD A;  4CDC B;  3RVX A;  3OIS A;  4OEL A;  1U9V A;  1EWO A;  1POP A;  2P0R A;  2OZ2 A;  2JQG R;  2XU1 A;  1ITO A;  3P5X A;  2FTD A;  4FIP A;  2FQ9 A;  1U9Q X;  2G7Y A;  2FRQ A;  1O0E A;  4I04 A;  1SNK A;  3OVZ A;  4PI3 A;  1AEC A;  3H89 A;  2PRE A;  1AIM A;  3QJ3 A;  1F2B A;  3K8U A;  3RVV A;  2IPP B;  1NL6 A;  4QH6 A;  3WXF A;  4YYQ A;  4YYR A;  1QXP A;  4PAD A;  2G8J A;  1KFX L;  3CH3 X;  1ATK A;  2JQF R;  5CVM A;  1CQD A;  1CJL A;  4YYS A;  5J94 A;  3RVW A;  2E01 A;  4I05 A;  1AU2 A;  3MHS A;  3HHI A;  5CVN B;  5K16 A;  4KLB A;  1ICF A;  1VJV A;  2IBI A;  3QT4 A;  2B1M A;  3PNR A;  3IHP A;  1VSN A;  4BS5 A;  1EWM A;  3I06 A;  3P5V A;  1PIP A;  1F2C A;  2R9M A;  3HWN A;  1Y08 A;  2Y6E A;  2R6N A;  1PPD A;  1CVZ A;  2ACT A;  3IEJ A;  1THE A;  2AUX A;  3WXE A;  3PBH A;  2FRA A;  2Y5B A;  4XUI A;  1NLJ A;  2G8E A;  1CB5 A;  3BOW A;  5PAD A;  4W5C A;  2R9C A;  3KSE A;  3IV2 A;  3HD3 A;  3IMA A;  2O6X A;  1YVB A;  2DCC A;  2DJF B;  5EF4 A; 
#chains in the Genus database with same CATH topology
 2FUD A;  3BWK A;  3P5W A;  4HXD B;  2HHN A;  4BS6 A;  1X9Y A;  1PCI A;  1MEG A;  3F5V A;  4N4Z A;  1DEU A;  4FK5 A;  3D6S A;  4IUM A;  3B79 A;  4RNA A;  3I3T A;  2VHS A;  2F1G A;  4DMY A;  1CS8 A;  1BQI A;  4CZW A;  3MTN A;  2CB5 A;  3OVX A;  4PT5 A;  5E6J A;  3PT2 A;  1MIR A;  1KFU L;  3TNX A;  3MTV A;  3QSD A;  3NHE A;  4G54 A;  1YK8 A;  1AYW A;  2OUL A;  3PDF A;  1GLO A;  1FH0 A;  1KHP A;  2FE8 A;  2XU5 A;  1MDW A;  2C0Y A;  1CSB B;  4Q8H A;  4AXM A;  4PP1 A;  5EZQ A;  3H7D A;  1TL9 A;  2YJC A;  1PPO A;  2FYE A;  1AU3 A;  3O0U A;  1QDQ A;  3LXS A;  5JH3 A;  1YT7 A;  3W30 A;  1S4V A;  3H8C A;  4REZ A;  3ERV A;  2R9N A;  3BCN A;  4AXL A;  4CDF B;  3PW3 A;  2PAD A;  3OF9 A;  3O1G A;  1NQC A;  3ZNH A;  7PCK A;  1GCB A;  2PBH A;  3O65 A;  4FJC A;  2CIO A;  1NPZ A;  3C9E A;  2JRI A;  2WBF X;  3S3R A;  1BGO A;  3PRM A;  4W5B A;  1YK7 A;  3M99 A;  4QRG A;  4MZO A;  2HXZ A;  2OP3 A;  3CBK A;  2HWK A;  2DC7 A;  4OVZ B;  1TU6 A;  3MJ5 A;  2NQG A;  2NQI A;  2DCA A;  3E9S A;  4YYU A;  3USV A;  3BPM A;  3MP2 A;  2DCB A;  3K9M A;  6PAD A;  2DZY A;  2DOS A;  4D8I A;  4MI7 A;  1F29 A;  1TLO A;  4ZUX U;  1PPN A;  1PE6 A;  3OF8 A;  2BDL A;  3RNV A;  2HD5 A;  3H6S A;  4IP3 A;  2XU3 A;  3IOQ A;  4N79 A;  2J7Q C;  4P16 A;  1CTE A;  4BOU A;  2FT2 A;  2G6D A;  1JQP A;  1CPJ A;  2GFO A;  2NQA A;  3PSE A;  1AYU A;  4MZS A;  1CV8 A;  2BDZ A;  3BB7 A;  1DKI A;  4A5U A;  5FPW A;  3KWB X;  2UZJ A;  4BSQ A;  3CH2 X;  4P6E A;  3N3G A;  1M6D A;  1ME4 A;  3AI8 A;  4YVA A;  4X6I A;  2YJ8 A;  1MEM A;  3BBA A;  4BPV A;  1NB3 A;  4OW0 A;  1ZIV A;  2DC9 A;  2P86 A;  1PVJ A;  1SP4 B;  1MS6 A;  1STF E;  4HWY A;  4CDD B;  1U9W A;  1NB5 A;  4QRV A;  9PAP A;  1QMY A;  1KXR A;  2E02 A;  5KO3 A;  5JA7 A;  1EF7 A;  4QBB A;  3E1Z B;  2P7U A;  4WA6 A;  3U8E A;  1EWL A;  1Y4H A;  3KWZ A;  3MOR A;  3CBJ A;  4X6J A;  1PAD A;  2AU1 A;  1Q6K A;  2R9F A;  2F7D A;  3H8B A;  3MHH A;  3PHX A;  4R3D A;  2ATO A;  5A24 A;  2BTW B;  4RF1 A;  3GCB A;  2VHF A;  2HH5 A;  3KW9 A;  3BC3 A;  1F2A A;  4BQV A;  2YJ2 A;  3IUT A;  1AU0 A;  1UKF A;  4XZX A;  2PNS A;  4P6G A;  3V6C A;  4M0W A;  2E03 A;  3F75 A;  4Q8G A;  2DC8 A;  3KFQ A;  2DCD A;  4QRX A;  5EZS A;  2DC6 A;  2YJ9 A;  2DJG B;  1AYV A;  4PP2 E;  2AGA A;  4WUR A;  4I07 A;  4YYW A;  3LFY A;  1EWP A;  1PPP A;  3KKU A;  2AUZ A;  3BPF A;  3P5U A;  2R9O A;  1BY8 A;  1K3B B;  3N3K A;  1AU4 A;  5EGW A;  2B1N A;  3OQC A;  2E00 A;  2AS8 A;  1MHW A;  1HUC B;  4CDE B;  2BU3 A;  4BOQ A;  4X6H A;  4RKX A;  1ZCM A;  5F02 A;  4ZTB A;  1PXV A;  4DMX A;  2ARY A;  4RY2 A;  2AYN A;  2H7J A;  3N4C A;  2AVW A;  3KX1 A;  3TMP A;  4OEM A;  5CHV A;  8PCH A;  1DF0 A;  5CHT A;  4MSX A;  4D8B A;  2XU4 A;  1KHQ A;  4YYV A;  3HHA A;  3ZUA A;  1ME3 A;  1U5I A;  4D8E A;  3DF0 A;  4W4U A;  1QOL A;  5CVO B;  2FO5 A;  1U9X A;  1GMY A;  4N8W A;  3V6E A;  1A6R A;  3S3Q A;  3PHW A;  3WXG A;  2JTC A;  1YAL A;  1PBH A;  3K24 A;  4K7C A;  2NQD B;  1GEC E;  4MM3 B;  4XR7 A;  2GHU A;  4YV8 A;  1BP4 A;  3C0R A;  2YJB A;  1XKG A;  2DZZ A;  2AIM A;  2AYO A;  1IWD A;  4CDC B;  3RVX A;  3OIS A;  4OEL A;  1U9V A;  1EWO A;  1POP A;  2P0R A;  2OZ2 A;  2JQG R;  3TRK A;  2XU1 A;  1ITO A;  3P5X A;  2FTD A;  4FIP A;  2FQ9 A;  4GUA A;  1U9Q X;  2G7Y A;  2FRQ A;  1O0E A;  4I04 A;  1SNK A;  3OVZ A;  4PI3 A;  1AEC A;  3H89 A;  2PRE A;  1AIM A;  3QJ3 A;  4BOP A;  1F2B A;  3K8U A;  3RVV A;  2IPP B;  1NL6 A;  4QH6 A;  3WXF A;  4YYQ A;  5JZE A;  4YYR A;  1QXP A;  4PAD A;  2G8J A;  3PRP A;  1KFX L;  2Z84 A;  3CH3 X;  1ATK A;  2JQF R;  5CVM A;  1CQD A;  3PHU A;  1CJL A;  4YYS A;  5J94 A;  3RVW A;  2E01 A;  2BTW A;  4I05 A;  1AU2 A;  3MHS A;  3HHI A;  5CVN B;  5K16 A;  4KLB A;  1ICF A;  1VJV A;  2IBI A;  3QT4 A;  2B1M A;  3PNR A;  3IHP A;  1VSN A;  3BY4 A;  4BS5 A;  1EWM A;  3I06 A;  3P5V A;  1PIP A;  2J7Q A;  1F2C A;  2R9M A;  3HWN A;  1Y08 A;  2Y6E A;  2R6N A;  1PPD A;  1CVZ A;  2ACT A;  3IEJ A;  1THE A;  2AUX A;  4BOZ A;  3WXE A;  3PBH A;  2FRA A;  3W31 A;  4RF0 A;  1YZB A;  4OVZ A;  2Y5B A;  4XUI A;  1NLJ A;  2G8E A;  1CB5 A;  3BOW A;  5PAD A;  4BOS A;  4W5C A;  3IFU A;  2R9C A;  3KSE A;  3IV2 A;  3HD3 A;  3IMA A;  2O6X A;  3B21 A;  1YVB A;  2DCC A;  2DJF B;  5EF4 A; 
#chains in the Genus database with same CATH homology
 2FUD A;  3BWK A;  3P5W A;  2HHN A;  4BS6 A;  1X9Y A;  1PCI A;  1MEG A;  3F5V A;  4N4Z A;  1DEU A;  4FK5 A;  3D6S A;  3B79 A;  4C5P A;  3I3T A;  2VHS A;  2F1G A;  4DMY A;  1CS8 A;  1BQI A;  4CZW A;  3MTN A;  2CB5 A;  3OVX A;  1MIR A;  4BGF A;  1KFU L;  3TNX A;  3QSD A;  3NHE A;  4G54 A;  1YK8 A;  1AYW A;  2OUL A;  3PDF A;  1GLO A;  1FH0 A;  1KHP A;  2XU5 A;  1MDW A;  2C0Y A;  1CSB B;  4Q8H A;  4AXM A;  4PP1 A;  3H7D A;  1TL9 A;  2YJC A;  1PPO A;  2FYE A;  4NV8 A;  1AU3 A;  3O0U A;  1QDQ A;  3LXS A;  5JH3 A;  1YT7 A;  1S4V A;  3H8C A;  3ERV A;  2R9N A;  3BCN A;  4AXL A;  4CDF B;  3PW3 A;  2PAD A;  3OF9 A;  3O1G A;  1NQC A;  7PCK A;  1GCB A;  2PBH A;  4FJC A;  2CIO A;  1NPZ A;  3C9E A;  2WBF X;  3S3R A;  1BGO A;  4W5B A;  1YK7 A;  3M99 A;  4QRG A;  4MZO A;  2HXZ A;  2OP3 A;  3CBK A;  1W6F A;  2DC7 A;  1TU6 A;  2NQG A;  2NQI A;  2DCA A;  4YYU A;  3USV A;  3BPM A;  2DCB A;  3K9M A;  6PAD A;  2DZY A;  1F29 A;  1TLO A;  4ZUX U;  1PPN A;  1PE6 A;  3OF8 A;  2BDL A;  2HD5 A;  3H6S A;  2XU3 A;  3IOQ A;  4N79 A;  1CTE A;  2FT2 A;  2G6D A;  1JQP A;  1CPJ A;  2GFO A;  2NQA A;  1AYU A;  4MZS A;  1CV8 A;  2BDZ A;  5FPW A;  3KWB X;  4BSQ A;  3CH2 X;  4P6E A;  3N3G A;  1M6D A;  1ME4 A;  3AI8 A;  4YVA A;  4X6I A;  2YJ8 A;  1MEM A;  4BPV A;  1NB3 A;  1ZIV A;  2DC9 A;  2P86 A;  1SP4 B;  1MS6 A;  1STF E;  1E2T A;  4HWY A;  4CDD B;  1U9W A;  1NB5 A;  4QRV A;  9PAP A;  1QMY A;  1KXR A;  2E02 A;  5JA7 A;  1EF7 A;  4QBB A;  3E1Z B;  2P7U A;  4WA6 A;  3U8E A;  1EWL A;  1Y4H A;  3KWZ A;  3MOR A;  3CBJ A;  4X6J A;  1PAD A;  2AU1 A;  1Q6K A;  2R9F A;  2F7D A;  3H8B A;  3MHH A;  2ATO A;  5A24 A;  3GCB A;  2VHF A;  1GX3 A;  2HH5 A;  3KW9 A;  3BC3 A;  1F2A A;  4BQV A;  2YJ2 A;  3IUT A;  1AU0 A;  2PNS A;  4P6G A;  3V6C A;  2E03 A;  3F75 A;  4Q8G A;  2DC8 A;  3KFQ A;  2DCD A;  4QRX A;  4B55 A;  2DC6 A;  2YJ9 A;  2DJG B;  1AYV A;  4PP2 E;  4I07 A;  4YYW A;  3LFY A;  1EWP A;  1PPP A;  3KKU A;  2AUZ A;  3BPF A;  3P5U A;  2R9O A;  1BY8 A;  1K3B B;  3N3K A;  1AU4 A;  5EGW A;  2B1N A;  2E00 A;  2AS8 A;  1MHW A;  1HUC B;  4CDE B;  4X6H A;  3D9W A;  1ZCM A;  5F02 A;  1W4T A;  1PXV A;  4DMX A;  2ARY A;  4RY2 A;  2AYN A;  2H7J A;  3N4C A;  2AVW A;  3KX1 A;  4OEM A;  5CHV A;  8PCH A;  1DF0 A;  5CHT A;  4MSX A;  2XU4 A;  1KHQ A;  4YYV A;  3HHA A;  3ZUA A;  1ME3 A;  1U5I A;  3DF0 A;  4NV7 A;  4W4U A;  1QOL A;  5CVO B;  2FO5 A;  1U9X A;  1GMY A;  4N8W A;  3V6E A;  1A6R A;  3S3Q A;  3WXG A;  1YAL A;  1PBH A;  3K24 A;  4K7C A;  2NQD B;  1GEC E;  4XR7 A;  2GHU A;  4YV8 A;  1BP4 A;  2YJB A;  1XKG A;  2VFC A;  2DZZ A;  2AIM A;  2AYO A;  1IWD A;  4CDC B;  3RVX A;  3OIS A;  4OEL A;  1U9V A;  1EWO A;  1POP A;  2P0R A;  2VFB A;  2OZ2 A;  2JQG R;  2XU1 A;  1ITO A;  3P5X A;  2FTD A;  4FIP A;  2FQ9 A;  1U9Q X;  2G7Y A;  2FRQ A;  1O0E A;  4I04 A;  1SNK A;  3OVZ A;  4PI3 A;  1AEC A;  3H89 A;  2PRE A;  1AIM A;  3QJ3 A;  1F2B A;  3K8U A;  3RVV A;  2IPP B;  1NL6 A;  4QH6 A;  3WXF A;  4YYQ A;  4YYR A;  1QXP A;  4PAD A;  2G8J A;  1KFX L;  3CH3 X;  1ATK A;  2BSZ A;  2JQF R;  5CVM A;  1CQD A;  1CJL A;  4YYS A;  5J94 A;  3RVW A;  2E01 A;  4I05 A;  1AU2 A;  3MHS A;  4GUZ A;  3HHI A;  5CVN B;  5K16 A;  4KLB A;  1ICF A;  1VJV A;  2IBI A;  3QT4 A;  2B1M A;  3PNR A;  3IHP A;  1VSN A;  4BS5 A;  1EWM A;  3I06 A;  3P5V A;  1PIP A;  1F2C A;  2R9M A;  3HWN A;  1Y08 A;  2Y6E A;  2R6N A;  1PPD A;  1CVZ A;  2ACT A;  3IEJ A;  1THE A;  2AUX A;  3WXE A;  3PBH A;  1W5R A;  2FRA A;  2Y5B A;  4XUI A;  1NLJ A;  3LTW A;  2G8E A;  1CB5 A;  3BOW A;  5PAD A;  4W5C A;  2R9C A;  3KSE A;  3IV2 A;  3HD3 A;  3IMA A;  2O6X A;  1YVB A;  2DCC A;  2DJF B;  5EF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...