4DMXA

Cathepsin k inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title (1R,2R)-N-(1-cyanocyclopropyl)-2-(6-methoxy-1,3,4,5-tetrahydropyrido[4,3-b]indole-2-carbonyl)cyclohexanecarboxamide (AZD4996): a potent and highly selective cathepsin K inhibitor for the treatment of osteoarthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4dmxA00
1K3BB 2XU4A 3NHEA 3PNRA 2OP3A 1EWOA 5CHTA 4YYVA 2XU3A 2DJFB 4MZSA 2R9CA 4FIPA 5CVNB 1QMYA 5CVMA 1NPZA 3P5UA 2DCBA 1PPPA 2FQ9A 4QRGA 4G54A 4W5BA 2NQIA 2XU5A 1YALA 2NQDB 2FT2A 3KKUA 1KFUL 1PPOA 4PI3A 2E00A 1GECE 1JQPA 1EWLA 3S3RA 4CDCB 3IV2A 2O6XA 2R6NA 1GLOA 2FRQA 3N3GA 1THEA 5K16A 1Y08A 2IBIA 1PBHA 1PCIA 2DCCA 5J94A 3BOWA 3WXFA 1BQIA 3MHHA 1KHPA 4FJCA 1U9VA 3BWKA 5JH3A 4ZUXU 2HXZA 2HH5A 4CDEB 3OF9A 4P6GA 1AU2A 3I3TA 4CDDB 2FYEA 1KXRA 3HD3A 1MEGA 1CPJA 1EF7A 2AVWA 3I06A 2PNSA 2PADA 4YYRA 3QT4A 1AU0A 2OZ2A 3N3KA 3KW9A 1GMYA 2FTDA 5A24A 3H8BA 2HD5A 1CV8A 1DEUA 4N8WA 1AYWA 1F2AA 2G6DA 3KWZA 1PIPA 1BP4A 4W5CA 3BPMA 4CZWA 1AIMA 2XU1A 2AUZA 3MHSA 1EWMA 3HHAA 2AYNA 1PADA 3CBJA 1YT7A 3V6EA 2ARYA 4Q8GA 1MDWA 3QSDA 3P5XA 4X6IA 4Q8HA 3LXSA 1O0EA 1XKGA 3BC3A 4PADA 5JA7A 1ZCMA 4AXMA 3F5VA 1PXVA 2YJ8A 1SP4B 3BPFA 2E03A 2G8JA 3ZUAA 1STFE 3KWBX 2YJ2A 1TL9A 6PADA 5EGWA 5FPWA 4P6EA 3O1GA 1MEMA 3KFQA 1MS6A 2R9NA 1F2CA 3PW3A 2C0YA 2DZZA 4CDFB 1Q6KA 1ME3A 1Y4HA 3WXEA 4YYSA 3IMAA 1CSBB 1TLOA 3IOQA 2GHUA 2FRAA 1PPNA 5F02A 2JQFR 4BSQA 4YV8A 1CTEA 3PDFA 4YYQA 3BCNA 2AUXA 1HUCB 4QRVA 4PP1A 1EWPA 3H7DA 2B1MA 2DC8A 3IHPA 4OELA 9PAPA 3HWNA 4PP2E 2OULA 4QBBA 3GCBA 3WXGA 3KSEA 3PBHA 4FK5A 4MSXA 1F29A 1U5IA 1CQDA 1SNKA 2Y6EA 3V6CA 2F1GA 4YYUA 2WBFX 3K9MA 2G7YA 1ME4A 2DZYA 1VJVA 4I04A 4XR7A 2E01A 2R9OA 3K24A 2BDZA 1POPA 2PBHA 2R9FA 2NQAA 2H7JA 4BPVA 1VSNA 4HWYA 5PADA 1ICFA 2FUDA 1ZIVA 2JQGR 1CJLA 1U9WA 4DMXA 1X9YA 3H6SA 4OEMA 4KLBA 3O0UA 2F7DA 3H89A 1KFXL 2CIOA 3C9EA 1NB5A 1ITOA 1A6RA 2VHSA 3K8UA 1YK7A 4K7CA 2P7UA 2G8EA 3P5WA 1CB5A 3USVA 2P86A 1NLJA 2BDLA 2DC7A 1ATKA 1BGOA 4I07A 3LFYA 2ATOA 4BS5A 2P0RA 3OF8A 4YVAA 2DJGB 1AYVA 1F2BA 3MTNA 2DC6A 1NQCA 4X6JA 3CBKA 1PPDA 1KHQA 3H8CA 1AYUA 1YK8A 3OVXA 2DC9A 1AU4A 4DMYA 3S3QA 2FO5A 1FH0A 2Y5BA 4BQVA 4W4UA 5EF4A 4N79A 2HHNA 7PCKA 2AU1A 3RVVA 4X6HA 3ERVA 3MORA 3IUTA 3E1ZB 2AYOA 3QJ3A 2B1NA 2AIMA 2DCAA 4BS6A 4AXLA 2YJBA 1DF0A 1QOLA 5CHVA 1AECA 3RVWA 3M99A 3CH2X 3U8EA 2GFOA 1PE6A 4YYWA 1AU3A 2YJCA 5CVOB 1NB3A 3P5VA 1MIRA 3AI8A 4N4ZA 2DCDA 2IPPB 3KX1A 4MZOA 3IEJA 4I05A 3OISA 2E02A 3TNXA 4QH6A 2PREA 3HHIA 3DF0A 2VHFA 3CH3X 1IWDA 2NQGA 1M6DA 3B79A 3RVXA 4QRXA 1U9QX 1S4VA 3OVZA 2YJ9A 1CS8A 2AS8A 4RY2A 2R9MA 2ACTA 1GCBA 1BY8A 1MHWA 8PCHA 3F75A 4WA6A 1U9XA 1CVZA 1TU6A 2CB5A 1QDQA 3D6SA 3N4CA 1NL6A 4XUIA 1QXPA 1YVBA
chains in the Genus database with same CATH superfamily
1K3BB 2XU4A 3NHEA 3PNRA 2OP3A 1EWOA 5CHTA 4YYVA 2XU3A 2DJFB 3O65A 4MI7A 4MZSA 2R9CA 4FIPA 5CVNB 1QMYA 5CVMA 1NPZA 3P5UA 2DCBA 4D8BA 4PT5A 1PPPA 2FQ9A 3PHUA 4QRGA 4G54A 4W5BA 2NQIA 2XU5A 1YALA 2NQDB 2FT2A 3KKUA 1KFUL 1PPOA 4PI3A 3PHXA 5KO3A 4BOQA 2E00A 1GECE 1JQPA 3TRKA 1EWLA 3S3RA 4CDCB 3IV2A 2O6XA 2R6NA 1GLOA 2FRQA 3N3GA 4REZA 2DOSA 1THEA 5K16A 2JRIA 1Y08A 2IBIA 2J7QA 1PBHA 1PCIA 2DCCA 5J94A 3BOWA 3WXFA 1BQIA 3MHHA 1KHPA 4FJCA 1U9VA 3BWKA 5JH3A 4OVZA 4ZUXU 2HXZA 2HH5A 4CDEB 3OF9A 4P6GA 1AU2A 3I3TA 4BOSA 4CDDB 3HD3A 2FYEA 1KXRA 1PVJA 1MEGA 1CPJA 1EF7A 2AVWA 3I06A 2PNSA 2PADA 4YYRA 3QT4A 1AU0A 3N3KA 2OZ2A 3KW9A 1GMYA 2FTDA 5A24A 3H8BA 2HD5A 1CV8A 1DEUA 4N8WA 3C0RA 1AYWA 1F2AA 2G6DA 3KWZA 1PIPA 1BP4A 2BU3A 4D8IA 4W5CA 3BPMA 4CZWA 1YZBA 1AIMA 2XU1A 2AUZA 5EZQA 3MHSA 1EWMA 3HHAA 2AYNA 1PADA 3CBJA 1YT7A 3V6EA 2ARYA 4OW0A 4ZTBA 4Q8GA 1MDWA 3QSDA 3P5XA 4X6IA 4Q8HA 3LXSA 3RNVA 1O0EA 1XKGA 3BC3A 4PADA 5JA7A 1ZCMA 2FE8A 4AXMA 3F5VA 1PXVA 2YJ8A 4P16A 1SP4B 3BPFA 2E03A 4BOUA 2G8JA 3ZUAA 3MTVA 4BOZA 1STFE 2UZJA 3KWBX 2YJ2A 1TL9A 6PADA 5EGWA 5FPWA 2BTWB 4P6EA 3O1GA 4WURA 3PT2A 1MEMA 3KFQA 1MS6A 2R9NA 1F2CA 3PRMA 3PW3A 2C0YA 2DZZA 3BY4A 4CDFB 1Q6KA 1ME3A 1Y4HA 3WXEA 4YYSA 3IMAA 2JTCA 1CSBB 1TLOA 4IUMA 3IOQA 2GHUA 2FRAA 1PPNA 3OQCA 5F02A 2JQFR 4BSQA 4RF1A 4YV8A 1CTEA 5JZEA 3PHWA 3PDFA 4YYQA 3BCNA 2AUXA 1HUCB 4QRVA 4PP1A 1EWPA 3H7DA 2B1MA 4RKXA 2DC8A 3IHPA 4OELA 1UKFA 3PSEA 9PAPA 3HWNA 4PP2E 2OULA 4QBBA 3GCBA 3WXGA 3KSEA 3PBHA 4FK5A 4MSXA 1F29A 1U5IA 1CQDA 1SNKA 2Y6EA 3V6CA 2F1GA 4BOPA 2WBFX 4YYUA 4HXDB 5E6JA 3K9MA 2G7YA 1ME4A 2AGAA 1VJVA 2DZYA 4I04A 4XR7A 2E01A 2R9OA 3K24A 2BDZA 1POPA 2PBHA 2R9FA 2NQAA 3W30A 3MP2A 2H7JA 4BPVA 1VSNA 4OVZB 4HWYA 5PADA 1ICFA 2FUDA 1ZIVA 2JQGR 1CJLA 1U9WA 4DMXA 1X9YA 3H6SA 4OEMA 4KLBA 3O0UA 2F7DA 3H89A 1KFXL 3BBAA 2CIOA 3C9EA 1NB5A 1ITOA 1A6RA 2VHSA 4RF0A 3K8UA 1YK7A 4K7CA 2P7UA 5EZSA 2G8EA 3P5WA 1CB5A 3USVA 2P86A 1NLJA 2BDLA 2DC7A 1ATKA 3MJ5A 4XZXA 1BGOA 4I07A 4D8EA 3LFYA 2ATOA 4BS5A 2P0RA 3OF8A 4YVAA 2DJGB 1AYVA 1F2BA 2HWKA 2DC6A 3MTNA 1NQCA 4X6JA 3CBKA 1PPDA 1KHQA 3IFUA 4M0WA 3ZNHA 3H8CA 1AYUA 3W31A 1YK8A 3OVXA 2DC9A 1AU4A 4DMYA 3S3QA 2FO5A 1FH0A 2Y5BA 4BQVA 4W4UA 5EF4A 4N79A 2HHNA 7PCKA 3PRPA 2AU1A 3RVVA 4X6HA 3ERVA 3MORA 3IUTA 3E1ZB 2AYOA 3QJ3A 2B1NA 2AIMA 2DCAA 4BS6A 4AXLA 2YJBA 1DF0A 1QOLA 5CHVA 1AECA 2J7QC 3RVWA 3M99A 3CH2X 3U8EA 2GFOA 1PE6A 4YYWA 1AU3A 1DKIA 2YJCA 5CVOB 1NB3A 3P5VA 1MIRA 3AI8A 4N4ZA 3B21A 2DCDA 2IPPB 3KX1A 4MZOA 3IEJA 4I05A 3OISA 4MM3B 2E02A 3TNXA 4QH6A 2PREA 3HHIA 3DF0A 4RNAA 2VHFA 3CH3X 1IWDA 2NQGA 1M6DA 4GUAA 3B79A 3RVXA 4QRXA 4A5UA 1U9QX 1S4VA 4R3DA 3OVZA 2YJ9A 1CS8A 3E9SA 2AS8A 4RY2A 2BTWA 2R9MA 3TMPA 2ACTA 1GCBA 1BY8A 1MHWA 8PCHA 3F75A 4WA6A 1U9XA 1CVZA 3BB7A 1TU6A 2CB5A 2Z84A 1QDQA 3D6SA 4IP3A 3N4CA 1NL6A 4XUIA 1QXPA 1YVBA
chains in the Genus database with same CATH topology
1K3BB 2XU4A 3NHEA 3PNRA 2OP3A 1EWOA 5CHTA 4YYVA 2XU3A 2DJFB 4MZSA 2R9CA 4FIPA 5CVNB 1QMYA 5CVMA 1NPZA 3P5UA 2DCBA 1PPPA 2FQ9A 4QRGA 4G54A 4W5BA 2NQIA 2XU5A 1YALA 2NQDB 2FT2A 3LTWA 3KKUA 1KFUL 1PPOA 4PI3A 2E00A 1GECE 1W6FA 1JQPA 1EWLA 3S3RA 4CDCB 1GX3A 3IV2A 2O6XA 2R6NA 1GLOA 2FRQA 3N3GA 1THEA 5K16A 1Y08A 2IBIA 1PBHA 1PCIA 2DCCA 5J94A 3BOWA 3WXFA 1BQIA 3MHHA 1KHPA 4FJCA 1U9VA 3BWKA 5JH3A 4ZUXU 2HXZA 2HH5A 4CDEB 3OF9A 4P6GA 1AU2A 3D9WA 3I3TA 4CDDB 2FYEA 1KXRA 3HD3A 1MEGA 1CPJA 1EF7A 2AVWA 3I06A 2PNSA 2PADA 4YYRA 3QT4A 1AU0A 3N3KA 2OZ2A 3KW9A 1GMYA 2FTDA 4B55A 5A24A 3H8BA 2HD5A 1CV8A 1DEUA 4N8WA 1AYWA 1F2AA 2G6DA 3KWZA 1PIPA 1BP4A 4W5CA 3BPMA 4CZWA 1AIMA 2VFBA 2XU1A 2AUZA 2BSZA 4BGFA 3MHSA 1EWMA 3HHAA 2AYNA 1PADA 3CBJA 1YT7A 3V6EA 2ARYA 4Q8GA 1MDWA 3QSDA 3P5XA 4X6IA 4Q8HA 3LXSA 1O0EA 1XKGA 3BC3A 4PADA 5JA7A 1ZCMA 4AXMA 3F5VA 1PXVA 2YJ8A 1SP4B 3BPFA 4GUZA 2E03A 2G8JA 3ZUAA 1STFE 3KWBX 2YJ2A 4NV7A 1TL9A 6PADA 5EGWA 5FPWA 4P6EA 3O1GA 1MEMA 3KFQA 1MS6A 2R9NA 1F2CA 3PW3A 2C0YA 2DZZA 4CDFB 1Q6KA 1ME3A 1Y4HA 3WXEA 4YYSA 3IMAA 1CSBB 1TLOA 3IOQA 2GHUA 2FRAA 1PPNA 5F02A 2JQFR 4BSQA 4YV8A 1CTEA 3PDFA 4YYQA 3BCNA 2AUXA 1HUCB 4QRVA 4PP1A 1EWPA 3H7DA 2B1MA 2DC8A 3IHPA 4OELA 9PAPA 3HWNA 4PP2E 2OULA 4QBBA 3GCBA 3WXGA 3KSEA 3PBHA 4FK5A 4MSXA 1F29A 1U5IA 1CQDA 1SNKA 2Y6EA 3V6CA 2F1GA 4YYUA 2WBFX 3K9MA 1W5RA 2G7YA 1ME4A 2DZYA 1VJVA 4I04A 4XR7A 2E01A 2R9OA 3K24A 2BDZA 1POPA 2PBHA 2R9FA 2NQAA 2H7JA 4BPVA 1VSNA 4HWYA 5PADA 1ICFA 2FUDA 1ZIVA 2JQGR 1CJLA 1U9WA 4DMXA 1X9YA 3H6SA 4OEMA 4KLBA 3O0UA 2F7DA 3H89A 1KFXL 1E2TA 2CIOA 3C9EA 1NB5A 1ITOA 1A6RA 2VHSA 3K8UA 1YK7A 4K7CA 2P7UA 2G8EA 3P5WA 1CB5A 3USVA 2P86A 1NLJA 2BDLA 2DC7A 1ATKA 1BGOA 4I07A 3LFYA 2ATOA 4BS5A 2P0RA 1W4TA 3OF8A 4YVAA 2DJGB 1AYVA 1F2BA 3MTNA 2DC6A 1NQCA 4X6JA 3CBKA 1PPDA 1KHQA 4NV8A 3H8CA 1AYUA 1YK8A 3OVXA 2DC9A 1AU4A 4DMYA 3S3QA 2FO5A 1FH0A 2Y5BA 4BQVA 4W4UA 5EF4A 4N79A 2HHNA 7PCKA 2AU1A 3RVVA 4X6HA 3ERVA 3MORA 3IUTA 3E1ZB 2AYOA 3QJ3A 2B1NA 2AIMA 2DCAA 4BS6A 4AXLA 2YJBA 1DF0A 1QOLA 5CHVA 1AECA 3RVWA 3M99A 3CH2X 3U8EA 2GFOA 1PE6A 4YYWA 1AU3A 2YJCA 5CVOB 1NB3A 3P5VA 1MIRA 3AI8A 4N4ZA 2DCDA 2IPPB 3KX1A 4MZOA 3IEJA 4I05A 3OISA 2E02A 3TNXA 4QH6A 2PREA 3HHIA 3DF0A 2VHFA 3CH3X 1IWDA 2NQGA 1M6DA 3B79A 3RVXA 4QRXA 1U9QX 1S4VA 3OVZA 2YJ9A 1CS8A 2AS8A 4RY2A 2R9MA 2ACTA 1GCBA 1BY8A 1MHWA 8PCHA 3F75A 4WA6A 1U9XA 1CVZA 2VFCA 1TU6A 2CB5A 1QDQA 3D6SA 3N4CA 1NL6A 4C5PA 4XUIA 1QXPA 1YVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3B B;  2XU4 A;  3NHE A;  3PNR A;  2OP3 A;  1EWO A;  5CHT A;  4YYV A;  2XU3 A;  2DJF B;  4MZS A;  2R9C A;  4FIP A;  5CVN B;  1QMY A;  5CVM A;  1NPZ A;  3P5U A;  2DCB A;  1PPP A;  2FQ9 A;  4QRG A;  4G54 A;  4W5B A;  2NQI A;  2XU5 A;  1YAL A;  2NQD B;  2FT2 A;  3KKU A;  1KFU L;  1PPO A;  4PI3 A;  2E00 A;  1GEC E;  1JQP A;  1EWL A;  3S3R A;  4CDC B;  3IV2 A;  2O6X A;  2R6N A;  1GLO A;  2FRQ A;  3N3G A;  1THE A;  5K16 A;  1Y08 A;  2IBI A;  1PBH A;  1PCI A;  2DCC A;  5J94 A;  3BOW A;  3WXF A;  1BQI A;  3MHH A;  1KHP A;  4FJC A;  1U9V A;  3BWK A;  5JH3 A;  4ZUX U;  2HXZ A;  2HH5 A;  4CDE B;  3OF9 A;  4P6G A;  1AU2 A;  3I3T A;  4CDD B;  2FYE A;  1KXR A;  3HD3 A;  1MEG A;  1CPJ A;  1EF7 A;  2AVW A;  3I06 A;  2PNS A;  2PAD A;  4YYR A;  3QT4 A;  1AU0 A;  2OZ2 A;  3N3K A;  3KW9 A;  1GMY A;  2FTD A;  5A24 A;  3H8B A;  2HD5 A;  1CV8 A;  1DEU A;  4N8W A;  1AYW A;  1F2A A;  2G6D A;  3KWZ A;  1PIP A;  1BP4 A;  4W5C A;  3BPM A;  4CZW A;  1AIM A;  2XU1 A;  2AUZ A;  3MHS A;  1EWM A;  3HHA A;  2AYN A;  1PAD A;  3CBJ A;  1YT7 A;  3V6E A;  2ARY A;  4Q8G A;  1MDW A;  3QSD A;  3P5X A;  4X6I A;  4Q8H A;  3LXS A;  1O0E A;  1XKG A;  3BC3 A;  4PAD A;  5JA7 A;  1ZCM A;  4AXM A;  3F5V A;  1PXV A;  2YJ8 A;  1SP4 B;  3BPF A;  2E03 A;  2G8J A;  3ZUA A;  1STF E;  3KWB X;  2YJ2 A;  1TL9 A;  6PAD A;  5EGW A;  5FPW A;  4P6E A;  3O1G A;  1MEM A;  3KFQ A;  1MS6 A;  2R9N A;  1F2C A;  3PW3 A;  2C0Y A;  2DZZ A;  4CDF B;  1Q6K A;  1ME3 A;  1Y4H A;  3WXE A;  4YYS A;  3IMA A;  1CSB B;  1TLO A;  3IOQ A;  2GHU A;  2FRA A;  1PPN A;  5F02 A;  2JQF R;  4BSQ A;  4YV8 A;  1CTE A;  3PDF A;  4YYQ A;  3BCN A;  2AUX A;  1HUC B;  4QRV A;  4PP1 A;  1EWP A;  3H7D A;  2B1M A;  2DC8 A;  3IHP A;  4OEL A;  9PAP A;  3HWN A;  4PP2 E;  2OUL A;  4QBB A;  3GCB A;  3WXG A;  3KSE A;  3PBH A;  4FK5 A;  4MSX A;  1F29 A;  1U5I A;  1CQD A;  1SNK A;  2Y6E A;  3V6C A;  2F1G A;  4YYU A;  2WBF X;  3K9M A;  2G7Y A;  1ME4 A;  2DZY A;  1VJV A;  4I04 A;  4XR7 A;  2E01 A;  2R9O A;  3K24 A;  2BDZ A;  1POP A;  2PBH A;  2R9F A;  2NQA A;  2H7J A;  4BPV A;  1VSN A;  4HWY A;  5PAD A;  1ICF A;  2FUD A;  1ZIV A;  2JQG R;  1CJL A;  1U9W A;  4DMX A;  1X9Y A;  3H6S A;  4OEM A;  4KLB A;  3O0U A;  2F7D A;  3H89 A;  1KFX L;  2CIO A;  3C9E A;  1NB5 A;  1ITO A;  1A6R A;  2VHS A;  3K8U A;  1YK7 A;  4K7C A;  2P7U A;  2G8E A;  3P5W A;  1CB5 A;  3USV A;  2P86 A;  1NLJ A;  2BDL A;  2DC7 A;  1ATK A;  1BGO A;  4I07 A;  3LFY A;  2ATO A;  4BS5 A;  2P0R A;  3OF8 A;  4YVA A;  2DJG B;  1AYV A;  1F2B A;  3MTN A;  2DC6 A;  1NQC A;  4X6J A;  3CBK A;  1PPD A;  1KHQ A;  3H8C A;  1AYU A;  1YK8 A;  3OVX A;  2DC9 A;  1AU4 A;  4DMY A;  3S3Q A;  2FO5 A;  1FH0 A;  2Y5B A;  4BQV A;  4W4U A;  5EF4 A;  4N79 A;  2HHN A;  7PCK A;  2AU1 A;  3RVV A;  4X6H A;  3ERV A;  3MOR A;  3IUT A;  3E1Z B;  2AYO A;  3QJ3 A;  2B1N A;  2AIM A;  2DCA A;  4BS6 A;  4AXL A;  2YJB A;  1DF0 A;  1QOL A;  5CHV A;  1AEC A;  3RVW A;  3M99 A;  3CH2 X;  3U8E A;  2GFO A;  1PE6 A;  4YYW A;  1AU3 A;  2YJC A;  5CVO B;  1NB3 A;  3P5V A;  1MIR A;  3AI8 A;  4N4Z A;  2DCD A;  2IPP B;  3KX1 A;  4MZO A;  3IEJ A;  4I05 A;  3OIS A;  2E02 A;  3TNX A;  4QH6 A;  2PRE A;  3HHI A;  3DF0 A;  2VHF A;  3CH3 X;  1IWD A;  2NQG A;  1M6D A;  3B79 A;  3RVX A;  4QRX A;  1U9Q X;  1S4V A;  3OVZ A;  2YJ9 A;  1CS8 A;  2AS8 A;  4RY2 A;  2R9M A;  2ACT A;  1GCB A;  1BY8 A;  1MHW A;  8PCH A;  3F75 A;  4WA6 A;  1U9X A;  1CVZ A;  1TU6 A;  2CB5 A;  1QDQ A;  3D6S A;  3N4C A;  1NL6 A;  4XUI A;  1QXP A;  1YVB A; 
#chains in the Genus database with same CATH topology
 1K3B B;  2XU4 A;  3NHE A;  3PNR A;  2OP3 A;  1EWO A;  5CHT A;  4YYV A;  2XU3 A;  2DJF B;  3O65 A;  4MI7 A;  4MZS A;  2R9C A;  4FIP A;  5CVN B;  1QMY A;  5CVM A;  1NPZ A;  3P5U A;  2DCB A;  4D8B A;  4PT5 A;  1PPP A;  2FQ9 A;  3PHU A;  4QRG A;  4G54 A;  4W5B A;  2NQI A;  2XU5 A;  1YAL A;  2NQD B;  2FT2 A;  3KKU A;  1KFU L;  1PPO A;  4PI3 A;  3PHX A;  5KO3 A;  4BOQ A;  2E00 A;  1GEC E;  1JQP A;  3TRK A;  1EWL A;  3S3R A;  4CDC B;  3IV2 A;  2O6X A;  2R6N A;  1GLO A;  2FRQ A;  3N3G A;  4REZ A;  2DOS A;  1THE A;  5K16 A;  2JRI A;  1Y08 A;  2IBI A;  2J7Q A;  1PBH A;  1PCI A;  2DCC A;  5J94 A;  3BOW A;  3WXF A;  1BQI A;  3MHH A;  1KHP A;  4FJC A;  1U9V A;  3BWK A;  5JH3 A;  4OVZ A;  4ZUX U;  2HXZ A;  2HH5 A;  4CDE B;  3OF9 A;  4P6G A;  1AU2 A;  3I3T A;  4BOS A;  4CDD B;  3HD3 A;  2FYE A;  1KXR A;  1PVJ A;  1MEG A;  1CPJ A;  1EF7 A;  2AVW A;  3I06 A;  2PNS A;  2PAD A;  4YYR A;  3QT4 A;  1AU0 A;  3N3K A;  2OZ2 A;  3KW9 A;  1GMY A;  2FTD A;  5A24 A;  3H8B A;  2HD5 A;  1CV8 A;  1DEU A;  4N8W A;  3C0R A;  1AYW A;  1F2A A;  2G6D A;  3KWZ A;  1PIP A;  1BP4 A;  2BU3 A;  4D8I A;  4W5C A;  3BPM A;  4CZW A;  1YZB A;  1AIM A;  2XU1 A;  2AUZ A;  5EZQ A;  3MHS A;  1EWM A;  3HHA A;  2AYN A;  1PAD A;  3CBJ A;  1YT7 A;  3V6E A;  2ARY A;  4OW0 A;  4ZTB A;  4Q8G A;  1MDW A;  3QSD A;  3P5X A;  4X6I A;  4Q8H A;  3LXS A;  3RNV A;  1O0E A;  1XKG A;  3BC3 A;  4PAD A;  5JA7 A;  1ZCM A;  2FE8 A;  4AXM A;  3F5V A;  1PXV A;  2YJ8 A;  4P16 A;  1SP4 B;  3BPF A;  2E03 A;  4BOU A;  2G8J A;  3ZUA A;  3MTV A;  4BOZ A;  1STF E;  2UZJ A;  3KWB X;  2YJ2 A;  1TL9 A;  6PAD A;  5EGW A;  5FPW A;  2BTW B;  4P6E A;  3O1G A;  4WUR A;  3PT2 A;  1MEM A;  3KFQ A;  1MS6 A;  2R9N A;  1F2C A;  3PRM A;  3PW3 A;  2C0Y A;  2DZZ A;  3BY4 A;  4CDF B;  1Q6K A;  1ME3 A;  1Y4H A;  3WXE A;  4YYS A;  3IMA A;  2JTC A;  1CSB B;  1TLO A;  4IUM A;  3IOQ A;  2GHU A;  2FRA A;  1PPN A;  3OQC A;  5F02 A;  2JQF R;  4BSQ A;  4RF1 A;  4YV8 A;  1CTE A;  5JZE A;  3PHW A;  3PDF A;  4YYQ A;  3BCN A;  2AUX A;  1HUC B;  4QRV A;  4PP1 A;  1EWP A;  3H7D A;  2B1M A;  4RKX A;  2DC8 A;  3IHP A;  4OEL A;  1UKF A;  3PSE A;  9PAP A;  3HWN A;  4PP2 E;  2OUL A;  4QBB A;  3GCB A;  3WXG A;  3KSE A;  3PBH A;  4FK5 A;  4MSX A;  1F29 A;  1U5I A;  1CQD A;  1SNK A;  2Y6E A;  3V6C A;  2F1G A;  4BOP A;  2WBF X;  4YYU A;  4HXD B;  5E6J A;  3K9M A;  2G7Y A;  1ME4 A;  2AGA A;  1VJV A;  2DZY A;  4I04 A;  4XR7 A;  2E01 A;  2R9O A;  3K24 A;  2BDZ A;  1POP A;  2PBH A;  2R9F A;  2NQA A;  3W30 A;  3MP2 A;  2H7J A;  4BPV A;  1VSN A;  4OVZ B;  4HWY A;  5PAD A;  1ICF A;  2FUD A;  1ZIV A;  2JQG R;  1CJL A;  1U9W A;  4DMX A;  1X9Y A;  3H6S A;  4OEM A;  4KLB A;  3O0U A;  2F7D A;  3H89 A;  1KFX L;  3BBA A;  2CIO A;  3C9E A;  1NB5 A;  1ITO A;  1A6R A;  2VHS A;  4RF0 A;  3K8U A;  1YK7 A;  4K7C A;  2P7U A;  5EZS A;  2G8E A;  3P5W A;  1CB5 A;  3USV A;  2P86 A;  1NLJ A;  2BDL A;  2DC7 A;  1ATK A;  3MJ5 A;  4XZX A;  1BGO A;  4I07 A;  4D8E A;  3LFY A;  2ATO A;  4BS5 A;  2P0R A;  3OF8 A;  4YVA A;  2DJG B;  1AYV A;  1F2B A;  2HWK A;  2DC6 A;  3MTN A;  1NQC A;  4X6J A;  3CBK A;  1PPD A;  1KHQ A;  3IFU A;  4M0W A;  3ZNH A;  3H8C A;  1AYU A;  3W31 A;  1YK8 A;  3OVX A;  2DC9 A;  1AU4 A;  4DMY A;  3S3Q A;  2FO5 A;  1FH0 A;  2Y5B A;  4BQV A;  4W4U A;  5EF4 A;  4N79 A;  2HHN A;  7PCK A;  3PRP A;  2AU1 A;  3RVV A;  4X6H A;  3ERV A;  3MOR A;  3IUT A;  3E1Z B;  2AYO A;  3QJ3 A;  2B1N A;  2AIM A;  2DCA A;  4BS6 A;  4AXL A;  2YJB A;  1DF0 A;  1QOL A;  5CHV A;  1AEC A;  2J7Q C;  3RVW A;  3M99 A;  3CH2 X;  3U8E A;  2GFO A;  1PE6 A;  4YYW A;  1AU3 A;  1DKI A;  2YJC A;  5CVO B;  1NB3 A;  3P5V A;  1MIR A;  3AI8 A;  4N4Z A;  3B21 A;  2DCD A;  2IPP B;  3KX1 A;  4MZO A;  3IEJ A;  4I05 A;  3OIS A;  4MM3 B;  2E02 A;  3TNX A;  4QH6 A;  2PRE A;  3HHI A;  3DF0 A;  4RNA A;  2VHF A;  3CH3 X;  1IWD A;  2NQG A;  1M6D A;  4GUA A;  3B79 A;  3RVX A;  4QRX A;  4A5U A;  1U9Q X;  1S4V A;  4R3D A;  3OVZ A;  2YJ9 A;  1CS8 A;  3E9S A;  2AS8 A;  4RY2 A;  2BTW A;  2R9M A;  3TMP A;  2ACT A;  1GCB A;  1BY8 A;  1MHW A;  8PCH A;  3F75 A;  4WA6 A;  1U9X A;  1CVZ A;  3BB7 A;  1TU6 A;  2CB5 A;  2Z84 A;  1QDQ A;  3D6S A;  4IP3 A;  3N4C A;  1NL6 A;  4XUI A;  1QXP A;  1YVB A; 
#chains in the Genus database with same CATH homology
 1K3B B;  2XU4 A;  3NHE A;  3PNR A;  2OP3 A;  1EWO A;  5CHT A;  4YYV A;  2XU3 A;  2DJF B;  4MZS A;  2R9C A;  4FIP A;  5CVN B;  1QMY A;  5CVM A;  1NPZ A;  3P5U A;  2DCB A;  1PPP A;  2FQ9 A;  4QRG A;  4G54 A;  4W5B A;  2NQI A;  2XU5 A;  1YAL A;  2NQD B;  2FT2 A;  3LTW A;  3KKU A;  1KFU L;  1PPO A;  4PI3 A;  2E00 A;  1GEC E;  1W6F A;  1JQP A;  1EWL A;  3S3R A;  4CDC B;  1GX3 A;  3IV2 A;  2O6X A;  2R6N A;  1GLO A;  2FRQ A;  3N3G A;  1THE A;  5K16 A;  1Y08 A;  2IBI A;  1PBH A;  1PCI A;  2DCC A;  5J94 A;  3BOW A;  3WXF A;  1BQI A;  3MHH A;  1KHP A;  4FJC A;  1U9V A;  3BWK A;  5JH3 A;  4ZUX U;  2HXZ A;  2HH5 A;  4CDE B;  3OF9 A;  4P6G A;  1AU2 A;  3D9W A;  3I3T A;  4CDD B;  2FYE A;  1KXR A;  3HD3 A;  1MEG A;  1CPJ A;  1EF7 A;  2AVW A;  3I06 A;  2PNS A;  2PAD A;  4YYR A;  3QT4 A;  1AU0 A;  3N3K A;  2OZ2 A;  3KW9 A;  1GMY A;  2FTD A;  4B55 A;  5A24 A;  3H8B A;  2HD5 A;  1CV8 A;  1DEU A;  4N8W A;  1AYW A;  1F2A A;  2G6D A;  3KWZ A;  1PIP A;  1BP4 A;  4W5C A;  3BPM A;  4CZW A;  1AIM A;  2VFB A;  2XU1 A;  2AUZ A;  2BSZ A;  4BGF A;  3MHS A;  1EWM A;  3HHA A;  2AYN A;  1PAD A;  3CBJ A;  1YT7 A;  3V6E A;  2ARY A;  4Q8G A;  1MDW A;  3QSD A;  3P5X A;  4X6I A;  4Q8H A;  3LXS A;  1O0E A;  1XKG A;  3BC3 A;  4PAD A;  5JA7 A;  1ZCM A;  4AXM A;  3F5V A;  1PXV A;  2YJ8 A;  1SP4 B;  3BPF A;  4GUZ A;  2E03 A;  2G8J A;  3ZUA A;  1STF E;  3KWB X;  2YJ2 A;  4NV7 A;  1TL9 A;  6PAD A;  5EGW A;  5FPW A;  4P6E A;  3O1G A;  1MEM A;  3KFQ A;  1MS6 A;  2R9N A;  1F2C A;  3PW3 A;  2C0Y A;  2DZZ A;  4CDF B;  1Q6K A;  1ME3 A;  1Y4H A;  3WXE A;  4YYS A;  3IMA A;  1CSB B;  1TLO A;  3IOQ A;  2GHU A;  2FRA A;  1PPN A;  5F02 A;  2JQF R;  4BSQ A;  4YV8 A;  1CTE A;  3PDF A;  4YYQ A;  3BCN A;  2AUX A;  1HUC B;  4QRV A;  4PP1 A;  1EWP A;  3H7D A;  2B1M A;  2DC8 A;  3IHP A;  4OEL A;  9PAP A;  3HWN A;  4PP2 E;  2OUL A;  4QBB A;  3GCB A;  3WXG A;  3KSE A;  3PBH A;  4FK5 A;  4MSX A;  1F29 A;  1U5I A;  1CQD A;  1SNK A;  2Y6E A;  3V6C A;  2F1G A;  4YYU A;  2WBF X;  3K9M A;  1W5R A;  2G7Y A;  1ME4 A;  2DZY A;  1VJV A;  4I04 A;  4XR7 A;  2E01 A;  2R9O A;  3K24 A;  2BDZ A;  1POP A;  2PBH A;  2R9F A;  2NQA A;  2H7J A;  4BPV A;  1VSN A;  4HWY A;  5PAD A;  1ICF A;  2FUD A;  1ZIV A;  2JQG R;  1CJL A;  1U9W A;  4DMX A;  1X9Y A;  3H6S A;  4OEM A;  4KLB A;  3O0U A;  2F7D A;  3H89 A;  1KFX L;  1E2T A;  2CIO A;  3C9E A;  1NB5 A;  1ITO A;  1A6R A;  2VHS A;  3K8U A;  1YK7 A;  4K7C A;  2P7U A;  2G8E A;  3P5W A;  1CB5 A;  3USV A;  2P86 A;  1NLJ A;  2BDL A;  2DC7 A;  1ATK A;  1BGO A;  4I07 A;  3LFY A;  2ATO A;  4BS5 A;  2P0R A;  1W4T A;  3OF8 A;  4YVA A;  2DJG B;  1AYV A;  1F2B A;  3MTN A;  2DC6 A;  1NQC A;  4X6J A;  3CBK A;  1PPD A;  1KHQ A;  4NV8 A;  3H8C A;  1AYU A;  1YK8 A;  3OVX A;  2DC9 A;  1AU4 A;  4DMY A;  3S3Q A;  2FO5 A;  1FH0 A;  2Y5B A;  4BQV A;  4W4U A;  5EF4 A;  4N79 A;  2HHN A;  7PCK A;  2AU1 A;  3RVV A;  4X6H A;  3ERV A;  3MOR A;  3IUT A;  3E1Z B;  2AYO A;  3QJ3 A;  2B1N A;  2AIM A;  2DCA A;  4BS6 A;  4AXL A;  2YJB A;  1DF0 A;  1QOL A;  5CHV A;  1AEC A;  3RVW A;  3M99 A;  3CH2 X;  3U8E A;  2GFO A;  1PE6 A;  4YYW A;  1AU3 A;  2YJC A;  5CVO B;  1NB3 A;  3P5V A;  1MIR A;  3AI8 A;  4N4Z A;  2DCD A;  2IPP B;  3KX1 A;  4MZO A;  3IEJ A;  4I05 A;  3OIS A;  2E02 A;  3TNX A;  4QH6 A;  2PRE A;  3HHI A;  3DF0 A;  2VHF A;  3CH3 X;  1IWD A;  2NQG A;  1M6D A;  3B79 A;  3RVX A;  4QRX A;  1U9Q X;  1S4V A;  3OVZ A;  2YJ9 A;  1CS8 A;  2AS8 A;  4RY2 A;  2R9M A;  2ACT A;  1GCB A;  1BY8 A;  1MHW A;  8PCH A;  3F75 A;  4WA6 A;  1U9X A;  1CVZ A;  2VFC A;  1TU6 A;  2CB5 A;  1QDQ A;  3D6S A;  3N4C A;  1NL6 A;  4C5P A;  4XUI A;  1QXP A;  1YVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...