4DMXA

Cathepsin k inhibitor
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin K
publication title (1R,2R)-N-(1-cyanocyclopropyl)-2-(6-methoxy-1,3,4,5-tetrahydropyrido[4,3-b]indole-2-carbonyl)cyclohexanecarboxamide (AZD4996): a potent and highly selective cathepsin K inhibitor for the treatment of osteoarthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2012-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4dmxA00
1DF0A 1NB3A 3QJ3A 1CVZA 4W4UA 4PADA 1XKGA 2FUDA 2BDLA 3N3GA 3C9EA 3MHHA 1O0EA 1F29A 2F1GA 2HH5A 4CDDB 2R9OA 2DZZA 2P86A 5A24A 2G6DA 4DMYA 1AU4A 4YYQA 3WXGA 1CS8A 2VHSA 3OF9A 3HD3A 4ZUXU 3IMAA 3O0UA 1MDWA 4W5CA 3H8CA 3RVVA 2AIMA 3H89A 3DF0A 4YYRA 2F7DA 3RVXA 3N4CA 2R9FA 1CTEA 1U9WA 4AXLA 4MSXA 2OP3A 3LFYA 2JQFR 5F02A 1KHQA 4K7CA 3KWBX 1YK7A 4P6GA 4FJCA 4CDEB 3OF8A 3PBHA 1YT7A 1QDQA 1NLJA 1ZCMA 3HHIA 3IHPA 4I05A 3IV2A 3K24A 1CPJA 4Q8GA 3H6SA 4XR7A 1AU2A 1KHPA 4RY2A 4YV8A 3I06A 2H7JA 1THEA 1AECA 1CQDA 1U5IA 2JQGR 4FK5A 1CSBB 4N4ZA 1KXRA 3CH3X 3OVZA 4PP1A 2YJCA 1FH0A 2B1NA 1EF7A 2DCCA 2NQGA 2YJ8A 1PPOA 2E01A 1BQIA 1GLOA 5CVMA 5FPWA 3P5UA 3PDFA 2G8EA 3RVWA 2E00A 3CBJA 3F75A 1GMYA 1NL6A 6PADA 2E02A 5CVNB 3BCNA 1X9YA 2FYEA 2DCAA 4CZWA 3V6CA 1PXVA 5EGWA 2Y6EA 3BPMA 3QT4A 1BP4A 2GHUA 1PCIA 4QRGA 1PPNA 1YALA 1S4VA 2NQIA 1AIMA 1KFXL 2C0YA 4X6JA 4BS5A 2XU4A 4YYUA 1PBHA 2DC6A 1GECE 4HWYA 1MHWA 4I04A 3U8EA 4KLBA 4QRVA 4X6HA 1AU0A 3KKUA 2XU1A 2Y5BA 2VHFA 3H7DA 2DC9A 2OULA 3K8UA 3AI8A 4QH6A 2G7YA 2R9CA 2O6XA 1EWMA 4PP2E 1AU3A 2NQDB 2OZ2A 2DJFB 1MEGA 1HUCB 7PCKA 3CBKA 3D6SA 3LXSA 3ZUAA 2BDZA 4BQVA 3OVXA 3BOWA 4I07A 1PADA 1U9VA 4QRXA 1SNKA 1NQCA 2ARYA 2FTDA 3IEJA 2AU1A 3V6EA 2P0RA 3P5WA 4P6EA 1QXPA 1CB5A 2R6NA 4BS6A 1Q6KA 2XU3A 1U9XA 1ICFA 2PBHA 3MORA 1BGOA 3IUTA 2FRQA 1MEMA 3HHAA 4YVAA 1ITOA 3PW3A 5CVOB 1TU6A 1PE6A 2HHNA 2DCBA 3USVA 4W5BA 4YYVA 1ME4A 2DZYA 3WXEA 2YJ2A 2G8JA 2IBIA 1U9QX 1MS6A 2NQAA 1EWOA 5JA7A 2YJ9A 4OEMA 1VSNA 1BY8A 4CDCB 2ATOA 1F2CA 1NPZA 4YYWA 2CB5A 1VJVA 5CHTA 1QMYA 2AUZA 1F2AA 2CIOA 1EWPA 4YYSA 1YVBA 5PADA 4N8WA 1IWDA 2P7UA 2AUXA 2AS8A 3I3TA 1Y08A 1TL9A 2FRAA 3K9MA 3BWKA 2DJGB 3P5XA 3S3QA 1AYWA 3M99A 3QSDA 1JQPA 1EWLA 2FQ9A 4N79A 2YJBA 4DMXA 8PCHA 1F2BA 3H8BA 1CV8A 1ATKA 3KX1A 5K16A 4BPVA 4CDFB 3KSEA 1AYVA 1NB5A 2PADA 3PNRA 2DCDA 3MTNA 2WBFX 1SP4B 4MZSA 3E1ZB 1KFUL 4Q8HA 1GCBA 5JH3A 2GFOA 1A6RA 4AXMA 2E03A 2PNSA 3CH2X 3NHEA 1MIRA 2FT2A 1PPPA 3TNXA 2DC8A 1YK8A 4MZOA 4FIPA 1QOLA 1ME3A 2HXZA 4OELA 2R9MA 2DC7A 3B79A 1AYUA 1STFE 3BPFA 1POPA 3GCBA 1PPDA 3S3RA 2IPPB 2AYNA 3IOQA 3N3KA 3WXFA 2AYOA 1TLOA 9PAPA 3O1GA 4WA6A 4BSQA 4QBBA 5EF4A 3BC3A 1ZIVA 1PIPA 2B1MA 2AVWA 3KFQA 5CHVA 2FO5A 4G54A 1DEUA 3HWNA 2R9NA 3KW9A 1Y4HA 4XUIA 2XU5A 4PI3A 1CJLA 1M6DA 2ACTA 1K3BB 5J94A 3P5VA 3ERVA 3F5VA 4X6IA 2PREA 3MHSA 2HD5A 3KWZA 3OISA
chains in the Genus database with same CATH superfamily
3O65A 1DF0A 1NB3A 3QJ3A 1CVZA 4W4UA 4PADA 1XKGA 2FUDA 2BDLA 3N3GA 3C9EA 3MHHA 1O0EA 4BOSA 1F29A 2DOSA 2F1GA 2HH5A 3TRKA 3B21A 4CDDB 2R9OA 2DZZA 4OW0A 2P86A 5A24A 2G6DA 4DMYA 1AU4A 4YYQA 3WXGA 1CS8A 2BU3A 5E6JA 2VHSA 3OF9A 3HD3A 4ZUXU 3IMAA 3O0UA 1MDWA 4W5CA 3H8CA 3RVVA 2AIMA 3H89A 2BTWB 3DF0A 4WURA 4YYRA 2F7DA 3RVXA 3N4CA 2R9FA 1CTEA 1U9WA 4AXLA 4MSXA 3W30A 2OP3A 3LFYA 2JQFR 5F02A 1KHQA 3C0RA 4K7CA 3KWBX 1YK7A 4P6GA 4FJCA 4CDEB 3OF8A 3PBHA 1YT7A 1YZBA 3IFUA 1QDQA 1NLJA 1ZCMA 4R3DA 3HHIA 3IHPA 3PRPA 4I05A 5JZEA 3IV2A 3K24A 1CPJA 4Q8GA 3H6SA 4XR7A 1AU2A 3PSEA 1KHPA 4RY2A 4YV8A 3I06A 2H7JA 4D8BA 1THEA 1AECA 1CQDA 1U5IA 2JQGR 3PT2A 4FK5A 3RNVA 1CSBB 4N4ZA 1KXRA 2Z84A 4D8IA 4HXDB 3CH3X 4BOQA 3OVZA 2FE8A 4PP1A 2YJCA 1FH0A 2B1NA 1PVJA 1EF7A 2DCCA 2NQGA 2YJ8A 1PPOA 2E01A 1BQIA 1GLOA 5CVMA 5FPWA 3P5UA 3PDFA 2G8EA 3RVWA 2E00A 3CBJA 3F75A 1GMYA 1NL6A 6PADA 2E02A 5CVNB 3BCNA 4OVZB 1X9YA 2FYEA 2DCAA 4CZWA 3V6CA 1PXVA 5EGWA 4RNAA 4IUMA 2Y6EA 3BPMA 3QT4A 1BP4A 2GHUA 1PCIA 4QRGA 1PPNA 3E9SA 1YALA 1S4VA 2NQIA 1AIMA 3OQCA 4MI7A 1KFXL 2C0YA 4X6JA 4BS5A 2XU4A 4YYUA 1PBHA 2DC6A 3BB7A 1GECE 4HWYA 1MHWA 4I04A 3U8EA 3BBAA 4KLBA 4RKXA 4QRVA 4X6HA 1AU0A 3KKUA 2XU1A 2Y5BA 2VHFA 3H7DA 2DC9A 2OULA 3K8UA 3AI8A 4QH6A 2G7YA 2R9CA 2O6XA 1EWMA 4PP2E 1AU3A 2NQDB 2OZ2A 2DJFB 1MEGA 1HUCB 7PCKA 3CBKA 3D6SA 3LXSA 3ZUAA 2BDZA 4OVZA 4BQVA 3OVXA 3BOWA 4I07A 3PHXA 1PADA 1U9VA 4QRXA 1SNKA 1NQCA 2ARYA 2FTDA 3IEJA 2AU1A 3V6EA 2P0RA 3P5WA 4P6EA 3MJ5A 1QXPA 1CB5A 2R6NA 4BS6A 1Q6KA 2XU3A 1U9XA 1ICFA 2PBHA 3MORA 4M0WA 3ZNHA 1BGOA 3IUTA 2FRQA 3TMPA 1MEMA 3HHAA 4YVAA 1ITOA 2HWKA 3PW3A 5CVOB 1TU6A 1UKFA 1PE6A 2HHNA 3W31A 3MTVA 2DCBA 3USVA 4W5BA 4YYVA 1ME4A 2DZYA 4P16A 3WXEA 2YJ2A 2G8JA 2IBIA 1U9QX 5EZQA 1MS6A 2NQAA 1EWOA 5JA7A 2YJ9A 4BOUA 4GUAA 4OEMA 1VSNA 1BY8A 4CDCB 2ATOA 1F2CA 1NPZA 3MP2A 4YYWA 2CB5A 1VJVA 2JRIA 5CHTA 1QMYA 2AUZA 1F2AA 2CIOA 1EWPA 4YYSA 4MM3B 1YVBA 5PADA 4N8WA 1IWDA 2P7UA 2AUXA 2AS8A 3I3TA 1Y08A 1TL9A 2FRAA 3K9MA 3PRMA 3BWKA 2DJGB 3P5XA 3S3QA 1AYWA 3M99A 4REZA 3QSDA 1JQPA 1EWLA 2FQ9A 4N79A 2YJBA 4DMXA 8PCHA 1F2BA 3H8BA 1CV8A 1ATKA 4BOZA 3KX1A 4IP3A 4ZTBA 5K16A 4BPVA 4CDFB 3KSEA 4D8EA 4XZXA 1AYVA 1NB5A 4BOPA 2PADA 3PNRA 2DCDA 2JTCA 3MTNA 2WBFX 1SP4B 4MZSA 3E1ZB 1KFUL 4Q8HA 1GCBA 5JH3A 2GFOA 1A6RA 4AXMA 2J7QA 2E03A 2PNSA 2UZJA 4PT5A 3CH2X 2AGAA 3NHEA 1MIRA 2FT2A 1DKIA 1PPPA 3PHWA 3TNXA 2DC8A 1YK8A 4MZOA 4RF0A 4FIPA 1QOLA 1ME3A 2HXZA 4RF1A 4OELA 2R9MA 2DC7A 3B79A 1AYUA 1STFE 3BPFA 1POPA 3GCBA 1PPDA 3S3RA 2IPPB 2AYNA 3IOQA 3N3KA 3WXFA 3BY4A 2AYOA 1TLOA 9PAPA 3O1GA 4WA6A 4BSQA 4QBBA 5EF4A 3BC3A 1ZIVA 1PIPA 2J7QC 2B1MA 2AVWA 3KFQA 5CHVA 2FO5A 5KO3A 4G54A 3PHUA 1DEUA 3HWNA 2R9NA 3KW9A 2BTWA 1Y4HA 4XUIA 2XU5A 4PI3A 1CJLA 1M6DA 2ACTA 1K3BB 5J94A 3P5VA 4A5UA 3ERVA 3F5VA 4X6IA 2PREA 3MHSA 2HD5A 3KWZA 5EZSA 3OISA
chains in the Genus database with same CATH topology
1DF0A 1NB3A 3QJ3A 1CVZA 4W4UA 4PADA 1XKGA 2FUDA 1W6FA 2BDLA 3N3GA 3C9EA 3MHHA 1O0EA 1F29A 2F1GA 2HH5A 1GX3A 4CDDB 3D9WA 2R9OA 2DZZA 2P86A 5A24A 2G6DA 4DMYA 1AU4A 4YYQA 3WXGA 1CS8A 2VHSA 3OF9A 3HD3A 4ZUXU 3IMAA 3O0UA 1MDWA 4W5CA 3H8CA 3RVVA 2AIMA 3H89A 3DF0A 4YYRA 2F7DA 3RVXA 3N4CA 4NV8A 2R9FA 1CTEA 1U9WA 4AXLA 4MSXA 2OP3A 3LFYA 2JQFR 5F02A 1KHQA 4K7CA 3KWBX 1YK7A 4P6GA 4FJCA 4CDEB 3OF8A 3PBHA 1YT7A 1QDQA 1NLJA 1ZCMA 3HHIA 3IHPA 4I05A 3IV2A 3K24A 1CPJA 4Q8GA 3H6SA 4XR7A 1AU2A 4B55A 1KHPA 4RY2A 4YV8A 1E2TA 3I06A 2H7JA 1THEA 1AECA 1CQDA 1U5IA 2JQGR 4C5PA 4FK5A 1CSBB 4N4ZA 1KXRA 3CH3X 3OVZA 4PP1A 2YJCA 1FH0A 2B1NA 1EF7A 2DCCA 2NQGA 2YJ8A 2BSZA 1PPOA 1W4TA 2E01A 1BQIA 1GLOA 5CVMA 5FPWA 3P5UA 3PDFA 2G8EA 3RVWA 4GUZA 2E00A 3CBJA 3F75A 1GMYA 1NL6A 6PADA 2E02A 5CVNB 3BCNA 1X9YA 2FYEA 2DCAA 4CZWA 3V6CA 1PXVA 5EGWA 2Y6EA 3BPMA 3QT4A 1BP4A 2GHUA 1PCIA 4QRGA 1PPNA 1YALA 1S4VA 2NQIA 1AIMA 1KFXL 2C0YA 4X6JA 4BS5A 2XU4A 4YYUA 1PBHA 4BGFA 2DC6A 1GECE 4HWYA 1MHWA 4I04A 3U8EA 4KLBA 4QRVA 4X6HA 1AU0A 3KKUA 2XU1A 2Y5BA 2VHFA 3H7DA 2DC9A 2OULA 3K8UA 3LTWA 3AI8A 4QH6A 2G7YA 2R9CA 2O6XA 1EWMA 4PP2E 1AU3A 2NQDB 2OZ2A 4NV7A 2DJFB 1MEGA 1HUCB 7PCKA 3CBKA 3D6SA 3LXSA 2VFCA 3ZUAA 2BDZA 4BQVA 3OVXA 3BOWA 4I07A 1PADA 1U9VA 4QRXA 1SNKA 1NQCA 2ARYA 2FTDA 3IEJA 2AU1A 3V6EA 2P0RA 3P5WA 4P6EA 1QXPA 1CB5A 2R6NA 4BS6A 1Q6KA 2XU3A 1U9XA 1ICFA 2PBHA 3MORA 1BGOA 3IUTA 2FRQA 1MEMA 3HHAA 4YVAA 1ITOA 3PW3A 5CVOB 1TU6A 1PE6A 2HHNA 2DCBA 3USVA 4W5BA 4YYVA 1ME4A 2DZYA 3WXEA 2YJ2A 2G8JA 2IBIA 1U9QX 1MS6A 2NQAA 1EWOA 5JA7A 2YJ9A 1W5RA 4OEMA 1VSNA 1BY8A 4CDCB 2ATOA 1F2CA 1NPZA 4YYWA 2CB5A 1VJVA 5CHTA 1QMYA 2AUZA 1F2AA 2CIOA 1EWPA 4YYSA 1YVBA 5PADA 4N8WA 1IWDA 2P7UA 2AUXA 2VFBA 2AS8A 3I3TA 1Y08A 1TL9A 2FRAA 3K9MA 3BWKA 2DJGB 3P5XA 3S3QA 1AYWA 3M99A 3QSDA 1JQPA 1EWLA 2FQ9A 4N79A 2YJBA 4DMXA 8PCHA 1F2BA 3H8BA 1CV8A 1ATKA 3KX1A 5K16A 4BPVA 4CDFB 3KSEA 1AYVA 1NB5A 2PADA 3PNRA 2DCDA 3MTNA 2WBFX 1SP4B 4MZSA 3E1ZB 1KFUL 4Q8HA 1GCBA 5JH3A 2GFOA 1A6RA 4AXMA 2E03A 2PNSA 3CH2X 3NHEA 1MIRA 2FT2A 1PPPA 3TNXA 2DC8A 1YK8A 4MZOA 4FIPA 1QOLA 1ME3A 2HXZA 4OELA 2R9MA 2DC7A 3B79A 1AYUA 1STFE 3BPFA 1POPA 3GCBA 1PPDA 3S3RA 2IPPB 2AYNA 3IOQA 3N3KA 3WXFA 2AYOA 1TLOA 9PAPA 3O1GA 4WA6A 4BSQA 4QBBA 5EF4A 3BC3A 1ZIVA 1PIPA 2B1MA 2AVWA 3KFQA 5CHVA 2FO5A 4G54A 1DEUA 3HWNA 2R9NA 3KW9A 1Y4HA 4XUIA 2XU5A 4PI3A 1CJLA 1M6DA 2ACTA 1K3BB 5J94A 3P5VA 3ERVA 3F5VA 4X6IA 2PREA 3MHSA 2HD5A 3KWZA 3OISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF0 A;  1NB3 A;  3QJ3 A;  1CVZ A;  4W4U A;  4PAD A;  1XKG A;  2FUD A;  2BDL A;  3N3G A;  3C9E A;  3MHH A;  1O0E A;  1F29 A;  2F1G A;  2HH5 A;  4CDD B;  2R9O A;  2DZZ A;  2P86 A;  5A24 A;  2G6D A;  4DMY A;  1AU4 A;  4YYQ A;  3WXG A;  1CS8 A;  2VHS A;  3OF9 A;  3HD3 A;  4ZUX U;  3IMA A;  3O0U A;  1MDW A;  4W5C A;  3H8C A;  3RVV A;  2AIM A;  3H89 A;  3DF0 A;  4YYR A;  2F7D A;  3RVX A;  3N4C A;  2R9F A;  1CTE A;  1U9W A;  4AXL A;  4MSX A;  2OP3 A;  3LFY A;  2JQF R;  5F02 A;  1KHQ A;  4K7C A;  3KWB X;  1YK7 A;  4P6G A;  4FJC A;  4CDE B;  3OF8 A;  3PBH A;  1YT7 A;  1QDQ A;  1NLJ A;  1ZCM A;  3HHI A;  3IHP A;  4I05 A;  3IV2 A;  3K24 A;  1CPJ A;  4Q8G A;  3H6S A;  4XR7 A;  1AU2 A;  1KHP A;  4RY2 A;  4YV8 A;  3I06 A;  2H7J A;  1THE A;  1AEC A;  1CQD A;  1U5I A;  2JQG R;  4FK5 A;  1CSB B;  4N4Z A;  1KXR A;  3CH3 X;  3OVZ A;  4PP1 A;  2YJC A;  1FH0 A;  2B1N A;  1EF7 A;  2DCC A;  2NQG A;  2YJ8 A;  1PPO A;  2E01 A;  1BQI A;  1GLO A;  5CVM A;  5FPW A;  3P5U A;  3PDF A;  2G8E A;  3RVW A;  2E00 A;  3CBJ A;  3F75 A;  1GMY A;  1NL6 A;  6PAD A;  2E02 A;  5CVN B;  3BCN A;  1X9Y A;  2FYE A;  2DCA A;  4CZW A;  3V6C A;  1PXV A;  5EGW A;  2Y6E A;  3BPM A;  3QT4 A;  1BP4 A;  2GHU A;  1PCI A;  4QRG A;  1PPN A;  1YAL A;  1S4V A;  2NQI A;  1AIM A;  1KFX L;  2C0Y A;  4X6J A;  4BS5 A;  2XU4 A;  4YYU A;  1PBH A;  2DC6 A;  1GEC E;  4HWY A;  1MHW A;  4I04 A;  3U8E A;  4KLB A;  4QRV A;  4X6H A;  1AU0 A;  3KKU A;  2XU1 A;  2Y5B A;  2VHF A;  3H7D A;  2DC9 A;  2OUL A;  3K8U A;  3AI8 A;  4QH6 A;  2G7Y A;  2R9C A;  2O6X A;  1EWM A;  4PP2 E;  1AU3 A;  2NQD B;  2OZ2 A;  2DJF B;  1MEG A;  1HUC B;  7PCK A;  3CBK A;  3D6S A;  3LXS A;  3ZUA A;  2BDZ A;  4BQV A;  3OVX A;  3BOW A;  4I07 A;  1PAD A;  1U9V A;  4QRX A;  1SNK A;  1NQC A;  2ARY A;  2FTD A;  3IEJ A;  2AU1 A;  3V6E A;  2P0R A;  3P5W A;  4P6E A;  1QXP A;  1CB5 A;  2R6N A;  4BS6 A;  1Q6K A;  2XU3 A;  1U9X A;  1ICF A;  2PBH A;  3MOR A;  1BGO A;  3IUT A;  2FRQ A;  1MEM A;  3HHA A;  4YVA A;  1ITO A;  3PW3 A;  5CVO B;  1TU6 A;  1PE6 A;  2HHN A;  2DCB A;  3USV A;  4W5B A;  4YYV A;  1ME4 A;  2DZY A;  3WXE A;  2YJ2 A;  2G8J A;  2IBI A;  1U9Q X;  1MS6 A;  2NQA A;  1EWO A;  5JA7 A;  2YJ9 A;  4OEM A;  1VSN A;  1BY8 A;  4CDC B;  2ATO A;  1F2C A;  1NPZ A;  4YYW A;  2CB5 A;  1VJV A;  5CHT A;  1QMY A;  2AUZ A;  1F2A A;  2CIO A;  1EWP A;  4YYS A;  1YVB A;  5PAD A;  4N8W A;  1IWD A;  2P7U A;  2AUX A;  2AS8 A;  3I3T A;  1Y08 A;  1TL9 A;  2FRA A;  3K9M A;  3BWK A;  2DJG B;  3P5X A;  3S3Q A;  1AYW A;  3M99 A;  3QSD A;  1JQP A;  1EWL A;  2FQ9 A;  4N79 A;  2YJB A;  4DMX A;  8PCH A;  1F2B A;  3H8B A;  1CV8 A;  1ATK A;  3KX1 A;  5K16 A;  4BPV A;  4CDF B;  3KSE A;  1AYV A;  1NB5 A;  2PAD A;  3PNR A;  2DCD A;  3MTN A;  2WBF X;  1SP4 B;  4MZS A;  3E1Z B;  1KFU L;  4Q8H A;  1GCB A;  5JH3 A;  2GFO A;  1A6R A;  4AXM A;  2E03 A;  2PNS A;  3CH2 X;  3NHE A;  1MIR A;  2FT2 A;  1PPP A;  3TNX A;  2DC8 A;  1YK8 A;  4MZO A;  4FIP A;  1QOL A;  1ME3 A;  2HXZ A;  4OEL A;  2R9M A;  2DC7 A;  3B79 A;  1AYU A;  1STF E;  3BPF A;  1POP A;  3GCB A;  1PPD A;  3S3R A;  2IPP B;  2AYN A;  3IOQ A;  3N3K A;  3WXF A;  2AYO A;  1TLO A;  9PAP A;  3O1G A;  4WA6 A;  4BSQ A;  4QBB A;  5EF4 A;  3BC3 A;  1ZIV A;  1PIP A;  2B1M A;  2AVW A;  3KFQ A;  5CHV A;  2FO5 A;  4G54 A;  1DEU A;  3HWN A;  2R9N A;  3KW9 A;  1Y4H A;  4XUI A;  2XU5 A;  4PI3 A;  1CJL A;  1M6D A;  2ACT A;  1K3B B;  5J94 A;  3P5V A;  3ERV A;  3F5V A;  4X6I A;  2PRE A;  3MHS A;  2HD5 A;  3KWZ A;  3OIS A; 
#chains in the Genus database with same CATH topology
 3O65 A;  1DF0 A;  1NB3 A;  3QJ3 A;  1CVZ A;  4W4U A;  4PAD A;  1XKG A;  2FUD A;  2BDL A;  3N3G A;  3C9E A;  3MHH A;  1O0E A;  4BOS A;  1F29 A;  2DOS A;  2F1G A;  2HH5 A;  3TRK A;  3B21 A;  4CDD B;  2R9O A;  2DZZ A;  4OW0 A;  2P86 A;  5A24 A;  2G6D A;  4DMY A;  1AU4 A;  4YYQ A;  3WXG A;  1CS8 A;  2BU3 A;  5E6J A;  2VHS A;  3OF9 A;  3HD3 A;  4ZUX U;  3IMA A;  3O0U A;  1MDW A;  4W5C A;  3H8C A;  3RVV A;  2AIM A;  3H89 A;  2BTW B;  3DF0 A;  4WUR A;  4YYR A;  2F7D A;  3RVX A;  3N4C A;  2R9F A;  1CTE A;  1U9W A;  4AXL A;  4MSX A;  3W30 A;  2OP3 A;  3LFY A;  2JQF R;  5F02 A;  1KHQ A;  3C0R A;  4K7C A;  3KWB X;  1YK7 A;  4P6G A;  4FJC A;  4CDE B;  3OF8 A;  3PBH A;  1YT7 A;  1YZB A;  3IFU A;  1QDQ A;  1NLJ A;  1ZCM A;  4R3D A;  3HHI A;  3IHP A;  3PRP A;  4I05 A;  5JZE A;  3IV2 A;  3K24 A;  1CPJ A;  4Q8G A;  3H6S A;  4XR7 A;  1AU2 A;  3PSE A;  1KHP A;  4RY2 A;  4YV8 A;  3I06 A;  2H7J A;  4D8B A;  1THE A;  1AEC A;  1CQD A;  1U5I A;  2JQG R;  3PT2 A;  4FK5 A;  3RNV A;  1CSB B;  4N4Z A;  1KXR A;  2Z84 A;  4D8I A;  4HXD B;  3CH3 X;  4BOQ A;  3OVZ A;  2FE8 A;  4PP1 A;  2YJC A;  1FH0 A;  2B1N A;  1PVJ A;  1EF7 A;  2DCC A;  2NQG A;  2YJ8 A;  1PPO A;  2E01 A;  1BQI A;  1GLO A;  5CVM A;  5FPW A;  3P5U A;  3PDF A;  2G8E A;  3RVW A;  2E00 A;  3CBJ A;  3F75 A;  1GMY A;  1NL6 A;  6PAD A;  2E02 A;  5CVN B;  3BCN A;  4OVZ B;  1X9Y A;  2FYE A;  2DCA A;  4CZW A;  3V6C A;  1PXV A;  5EGW A;  4RNA A;  4IUM A;  2Y6E A;  3BPM A;  3QT4 A;  1BP4 A;  2GHU A;  1PCI A;  4QRG A;  1PPN A;  3E9S A;  1YAL A;  1S4V A;  2NQI A;  1AIM A;  3OQC A;  4MI7 A;  1KFX L;  2C0Y A;  4X6J A;  4BS5 A;  2XU4 A;  4YYU A;  1PBH A;  2DC6 A;  3BB7 A;  1GEC E;  4HWY A;  1MHW A;  4I04 A;  3U8E A;  3BBA A;  4KLB A;  4RKX A;  4QRV A;  4X6H A;  1AU0 A;  3KKU A;  2XU1 A;  2Y5B A;  2VHF A;  3H7D A;  2DC9 A;  2OUL A;  3K8U A;  3AI8 A;  4QH6 A;  2G7Y A;  2R9C A;  2O6X A;  1EWM A;  4PP2 E;  1AU3 A;  2NQD B;  2OZ2 A;  2DJF B;  1MEG A;  1HUC B;  7PCK A;  3CBK A;  3D6S A;  3LXS A;  3ZUA A;  2BDZ A;  4OVZ A;  4BQV A;  3OVX A;  3BOW A;  4I07 A;  3PHX A;  1PAD A;  1U9V A;  4QRX A;  1SNK A;  1NQC A;  2ARY A;  2FTD A;  3IEJ A;  2AU1 A;  3V6E A;  2P0R A;  3P5W A;  4P6E A;  3MJ5 A;  1QXP A;  1CB5 A;  2R6N A;  4BS6 A;  1Q6K A;  2XU3 A;  1U9X A;  1ICF A;  2PBH A;  3MOR A;  4M0W A;  3ZNH A;  1BGO A;  3IUT A;  2FRQ A;  3TMP A;  1MEM A;  3HHA A;  4YVA A;  1ITO A;  2HWK A;  3PW3 A;  5CVO B;  1TU6 A;  1UKF A;  1PE6 A;  2HHN A;  3W31 A;  3MTV A;  2DCB A;  3USV A;  4W5B A;  4YYV A;  1ME4 A;  2DZY A;  4P16 A;  3WXE A;  2YJ2 A;  2G8J A;  2IBI A;  1U9Q X;  5EZQ A;  1MS6 A;  2NQA A;  1EWO A;  5JA7 A;  2YJ9 A;  4BOU A;  4GUA A;  4OEM A;  1VSN A;  1BY8 A;  4CDC B;  2ATO A;  1F2C A;  1NPZ A;  3MP2 A;  4YYW A;  2CB5 A;  1VJV A;  2JRI A;  5CHT A;  1QMY A;  2AUZ A;  1F2A A;  2CIO A;  1EWP A;  4YYS A;  4MM3 B;  1YVB A;  5PAD A;  4N8W A;  1IWD A;  2P7U A;  2AUX A;  2AS8 A;  3I3T A;  1Y08 A;  1TL9 A;  2FRA A;  3K9M A;  3PRM A;  3BWK A;  2DJG B;  3P5X A;  3S3Q A;  1AYW A;  3M99 A;  4REZ A;  3QSD A;  1JQP A;  1EWL A;  2FQ9 A;  4N79 A;  2YJB A;  4DMX A;  8PCH A;  1F2B A;  3H8B A;  1CV8 A;  1ATK A;  4BOZ A;  3KX1 A;  4IP3 A;  4ZTB A;  5K16 A;  4BPV A;  4CDF B;  3KSE A;  4D8E A;  4XZX A;  1AYV A;  1NB5 A;  4BOP A;  2PAD A;  3PNR A;  2DCD A;  2JTC A;  3MTN A;  2WBF X;  1SP4 B;  4MZS A;  3E1Z B;  1KFU L;  4Q8H A;  1GCB A;  5JH3 A;  2GFO A;  1A6R A;  4AXM A;  2J7Q A;  2E03 A;  2PNS A;  2UZJ A;  4PT5 A;  3CH2 X;  2AGA A;  3NHE A;  1MIR A;  2FT2 A;  1DKI A;  1PPP A;  3PHW A;  3TNX A;  2DC8 A;  1YK8 A;  4MZO A;  4RF0 A;  4FIP A;  1QOL A;  1ME3 A;  2HXZ A;  4RF1 A;  4OEL A;  2R9M A;  2DC7 A;  3B79 A;  1AYU A;  1STF E;  3BPF A;  1POP A;  3GCB A;  1PPD A;  3S3R A;  2IPP B;  2AYN A;  3IOQ A;  3N3K A;  3WXF A;  3BY4 A;  2AYO A;  1TLO A;  9PAP A;  3O1G A;  4WA6 A;  4BSQ A;  4QBB A;  5EF4 A;  3BC3 A;  1ZIV A;  1PIP A;  2J7Q C;  2B1M A;  2AVW A;  3KFQ A;  5CHV A;  2FO5 A;  5KO3 A;  4G54 A;  3PHU A;  1DEU A;  3HWN A;  2R9N A;  3KW9 A;  2BTW A;  1Y4H A;  4XUI A;  2XU5 A;  4PI3 A;  1CJL A;  1M6D A;  2ACT A;  1K3B B;  5J94 A;  3P5V A;  4A5U A;  3ERV A;  3F5V A;  4X6I A;  2PRE A;  3MHS A;  2HD5 A;  3KWZ A;  5EZS A;  3OIS A; 
#chains in the Genus database with same CATH homology
 1DF0 A;  1NB3 A;  3QJ3 A;  1CVZ A;  4W4U A;  4PAD A;  1XKG A;  2FUD A;  1W6F A;  2BDL A;  3N3G A;  3C9E A;  3MHH A;  1O0E A;  1F29 A;  2F1G A;  2HH5 A;  1GX3 A;  4CDD B;  3D9W A;  2R9O A;  2DZZ A;  2P86 A;  5A24 A;  2G6D A;  4DMY A;  1AU4 A;  4YYQ A;  3WXG A;  1CS8 A;  2VHS A;  3OF9 A;  3HD3 A;  4ZUX U;  3IMA A;  3O0U A;  1MDW A;  4W5C A;  3H8C A;  3RVV A;  2AIM A;  3H89 A;  3DF0 A;  4YYR A;  2F7D A;  3RVX A;  3N4C A;  4NV8 A;  2R9F A;  1CTE A;  1U9W A;  4AXL A;  4MSX A;  2OP3 A;  3LFY A;  2JQF R;  5F02 A;  1KHQ A;  4K7C A;  3KWB X;  1YK7 A;  4P6G A;  4FJC A;  4CDE B;  3OF8 A;  3PBH A;  1YT7 A;  1QDQ A;  1NLJ A;  1ZCM A;  3HHI A;  3IHP A;  4I05 A;  3IV2 A;  3K24 A;  1CPJ A;  4Q8G A;  3H6S A;  4XR7 A;  1AU2 A;  4B55 A;  1KHP A;  4RY2 A;  4YV8 A;  1E2T A;  3I06 A;  2H7J A;  1THE A;  1AEC A;  1CQD A;  1U5I A;  2JQG R;  4C5P A;  4FK5 A;  1CSB B;  4N4Z A;  1KXR A;  3CH3 X;  3OVZ A;  4PP1 A;  2YJC A;  1FH0 A;  2B1N A;  1EF7 A;  2DCC A;  2NQG A;  2YJ8 A;  2BSZ A;  1PPO A;  1W4T A;  2E01 A;  1BQI A;  1GLO A;  5CVM A;  5FPW A;  3P5U A;  3PDF A;  2G8E A;  3RVW A;  4GUZ A;  2E00 A;  3CBJ A;  3F75 A;  1GMY A;  1NL6 A;  6PAD A;  2E02 A;  5CVN B;  3BCN A;  1X9Y A;  2FYE A;  2DCA A;  4CZW A;  3V6C A;  1PXV A;  5EGW A;  2Y6E A;  3BPM A;  3QT4 A;  1BP4 A;  2GHU A;  1PCI A;  4QRG A;  1PPN A;  1YAL A;  1S4V A;  2NQI A;  1AIM A;  1KFX L;  2C0Y A;  4X6J A;  4BS5 A;  2XU4 A;  4YYU A;  1PBH A;  4BGF A;  2DC6 A;  1GEC E;  4HWY A;  1MHW A;  4I04 A;  3U8E A;  4KLB A;  4QRV A;  4X6H A;  1AU0 A;  3KKU A;  2XU1 A;  2Y5B A;  2VHF A;  3H7D A;  2DC9 A;  2OUL A;  3K8U A;  3LTW A;  3AI8 A;  4QH6 A;  2G7Y A;  2R9C A;  2O6X A;  1EWM A;  4PP2 E;  1AU3 A;  2NQD B;  2OZ2 A;  4NV7 A;  2DJF B;  1MEG A;  1HUC B;  7PCK A;  3CBK A;  3D6S A;  3LXS A;  2VFC A;  3ZUA A;  2BDZ A;  4BQV A;  3OVX A;  3BOW A;  4I07 A;  1PAD A;  1U9V A;  4QRX A;  1SNK A;  1NQC A;  2ARY A;  2FTD A;  3IEJ A;  2AU1 A;  3V6E A;  2P0R A;  3P5W A;  4P6E A;  1QXP A;  1CB5 A;  2R6N A;  4BS6 A;  1Q6K A;  2XU3 A;  1U9X A;  1ICF A;  2PBH A;  3MOR A;  1BGO A;  3IUT A;  2FRQ A;  1MEM A;  3HHA A;  4YVA A;  1ITO A;  3PW3 A;  5CVO B;  1TU6 A;  1PE6 A;  2HHN A;  2DCB A;  3USV A;  4W5B A;  4YYV A;  1ME4 A;  2DZY A;  3WXE A;  2YJ2 A;  2G8J A;  2IBI A;  1U9Q X;  1MS6 A;  2NQA A;  1EWO A;  5JA7 A;  2YJ9 A;  1W5R A;  4OEM A;  1VSN A;  1BY8 A;  4CDC B;  2ATO A;  1F2C A;  1NPZ A;  4YYW A;  2CB5 A;  1VJV A;  5CHT A;  1QMY A;  2AUZ A;  1F2A A;  2CIO A;  1EWP A;  4YYS A;  1YVB A;  5PAD A;  4N8W A;  1IWD A;  2P7U A;  2AUX A;  2VFB A;  2AS8 A;  3I3T A;  1Y08 A;  1TL9 A;  2FRA A;  3K9M A;  3BWK A;  2DJG B;  3P5X A;  3S3Q A;  1AYW A;  3M99 A;  3QSD A;  1JQP A;  1EWL A;  2FQ9 A;  4N79 A;  2YJB A;  4DMX A;  8PCH A;  1F2B A;  3H8B A;  1CV8 A;  1ATK A;  3KX1 A;  5K16 A;  4BPV A;  4CDF B;  3KSE A;  1AYV A;  1NB5 A;  2PAD A;  3PNR A;  2DCD A;  3MTN A;  2WBF X;  1SP4 B;  4MZS A;  3E1Z B;  1KFU L;  4Q8H A;  1GCB A;  5JH3 A;  2GFO A;  1A6R A;  4AXM A;  2E03 A;  2PNS A;  3CH2 X;  3NHE A;  1MIR A;  2FT2 A;  1PPP A;  3TNX A;  2DC8 A;  1YK8 A;  4MZO A;  4FIP A;  1QOL A;  1ME3 A;  2HXZ A;  4OEL A;  2R9M A;  2DC7 A;  3B79 A;  1AYU A;  1STF E;  3BPF A;  1POP A;  3GCB A;  1PPD A;  3S3R A;  2IPP B;  2AYN A;  3IOQ A;  3N3K A;  3WXF A;  2AYO A;  1TLO A;  9PAP A;  3O1G A;  4WA6 A;  4BSQ A;  4QBB A;  5EF4 A;  3BC3 A;  1ZIV A;  1PIP A;  2B1M A;  2AVW A;  3KFQ A;  5CHV A;  2FO5 A;  4G54 A;  1DEU A;  3HWN A;  2R9N A;  3KW9 A;  1Y4H A;  4XUI A;  2XU5 A;  4PI3 A;  1CJL A;  1M6D A;  2ACT A;  1K3B B;  5J94 A;  3P5V A;  3ERV A;  3F5V A;  4X6I A;  2PRE A;  3MHS A;  2HD5 A;  3KWZ A;  3OIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...