2YJ9A

Cathepsin l with a nitrile inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
216
Chain Sequence
APRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDTGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFEDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN L1
publication title Halogen Bonding at the Active Sites of Human Cathepsin L and Mek1 Kinase: Efficient Interactions in Different Environments.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 216
sequence length 220
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2yj9A00
2G8JA 3U8EA 2IPPB 1ZCMA 2R6NA 3IHPA 3OVXA 5JH3A 3KWBX 1XKGA 2DCAA 2VHSA 4YYUA 1EF7A 1KHQA 1QDQA 3KWZA 1PPDA 1MHWA 3WXFA 3IUTA 1QOLA 4W5BA 2AVWA 3I3TA 1MDWA 8PCHA 1BGOA 2DC6A 3CBJA 4MZSA 4CDDB 4I07A 2YJ8A 2XU5A 3S3QA 3RVXA 3NHEA 1AYUA 1ZIVA 3H7DA 3TNXA 1PADA 1CVZA 4YYRA 2YJCA 3N4CA 2FRQA 1M6DA 3KW9A 4G54A 4BPVA 1PPPA 2Y6EA 4YV8A 1MIRA 1BP4A 1MEMA 1NB3A 2BDLA 1SNKA 1YT7A 1Y4HA 2WBFX 1S4VA 2OP3A 3QJ3A 2AIMA 5PADA 3K8UA 1AIMA 4YYWA 1AYWA 2G7YA 2VHFA 3H89A 2PREA 1EWPA 2E00A 2AS8A 4PI3A 3KX1A 1GECE 3AI8A 7PCKA 1CPJA 2DZZA 3PNRA 1F2AA 2P7UA 2OULA 4AXLA 4W5CA 1GLOA 1YALA 3E1ZB 4DMYA 3MTNA 4W4UA 4BS6A 2R9OA 5FPWA 1KXRA 2BDZA 2C0YA 2E03A 1PPOA 2DCDA 2PBHA 4Q8GA 3F5VA 1ICFA 4BQVA 5EGWA 3KKUA 5CVNB 2DC7A 6PADA 3MORA 3V6EA 2NQDB 3BCNA 3P5WA 2DJFB 3LXSA 3QT4A 2YJ2A 1U5IA 1U9QX 3HHAA 2GHUA 1EWOA 1F2BA 3QSDA 2FYEA 3V6CA 3USVA 2F7DA 3C9EA 5F02A 4YYVA 2JQFR 4PP2E 1KHPA 1MS6A 3BPFA 1MEGA 1PIPA 2E01A 3M99A 4QBBA 4ZUXU 2DJGB 3O0UA 1TLOA 5CVOB 2AYOA 1O0EA 4XUIA 1AU3A 4BSQA 2Y5BA 4CDFB 9PAPA 2IBIA 4BS5A 1BQIA 3HHIA 4XR7A 4Q8HA 1PE6A 5A24A 2O6XA 4I05A 4KLBA 4YYSA 2HHNA 2R9FA 4MSXA 4K7CA 3OISA 1Q6KA 3MHHA 1YVBA 3IMAA 2XU1A 1CQDA 4QRXA 3PDFA 2AU1A 4WA6A 1PPNA 1ATKA 3BOWA 1QMYA 3OF8A 1POPA 2DCCA 4PADA 1NL6A 2ACTA 2G6DA 3H6SA 4OELA 1CJLA 2XU3A 3BPMA 2OZ2A 1CS8A 3K24A 5CVMA 1CSBB 1F2CA 5JA7A 3N3GA 3ZUAA 2G8EA 5CHVA 1VSNA 3MHSA 3WXEA 4OEMA 1F29A 2FUDA 2AUZA 1AECA 2P0RA 1PXVA 3N3KA 1IWDA 3S3RA 1PCIA 4P6GA 2B1MA 1A6RA 3GCBA 1NQCA 4YVAA 2PADA 3KFQA 4N4ZA 3K9MA 3ERVA 1TL9A 3DF0A 2HXZA 2CIOA 2B1NA 2ATOA 5K16A 4RY2A 3F75A 1K3BB 3IOQA 2YJ9A 4CDCB 3RVVA 2ARYA 4YYQA 3KSEA 5J94A 2FTDA 4CDEB 1ITOA 1THEA 3IEJA 3WXGA 1GCBA 4FIPA 4X6JA 4QRGA 3OVZA 4N8WA 4HWYA 1YK7A 3I06A 4DMXA 5CHTA 2AYNA 3BC3A 2FT2A 3O1GA 1NLJA 3PW3A 4X6IA 4AXMA 2DCBA 3P5XA 2H7JA 1JQPA 1DEUA 3B79A 3RVWA 3OF9A 3HWNA 4N79A 4PP1A 2R9NA 3D6SA 3PBHA 1FH0A 1GMYA 2F1GA 2FQ9A 3H8BA 2DC9A 1CTEA 2CB5A 1KFUL 2NQAA 4FK5A 1NPZA 1DF0A 2XU4A 1EWMA 1U9WA 2JQGR 1EWLA 1QXPA 4CZWA 1AU4A 2NQIA 2FO5A 3P5UA 1AYVA 5EF4A 1KFXL 3CBKA 1ME4A 2HD5A 1AU2A 3LFYA 1TU6A 3BWKA 1PBHA 2YJBA 2R9MA 4QRVA 1HUCB 1CV8A 1CB5A 2AUXA 4P6EA 4QH6A 2FRAA 1U9XA 3CH2X 2HH5A 1X9YA 1U9VA 2DC8A 3CH3X 1STFE 2DZYA 1VJVA 1AU0A 2E02A 3IV2A 2PNSA 1BY8A 3P5VA 4MZOA 4FJCA 1ME3A 2GFOA 1NB5A 3HD3A 1SP4B 4I04A 2P86A 1YK8A 1Y08A 4X6HA 2NQGA 2R9CA 3H8CA
chains in the Genus database with same CATH superfamily
2G8JA 3U8EA 2IPPB 1ZCMA 2R6NA 3IHPA 3OVXA 5JH3A 3KWBX 1XKGA 2DCAA 2VHSA 4YYUA 1EF7A 1KHQA 2BU3A 1QDQA 3KWZA 1PPDA 1MHWA 3WXFA 2UZJA 3IUTA 1QOLA 4W5BA 2AVWA 3I3TA 1MDWA 8PCHA 1BGOA 2DC6A 3CBJA 4MZSA 4CDDB 4I07A 3BB7A 2YJ8A 2XU5A 3S3QA 3RVXA 3NHEA 1AYUA 1ZIVA 3ZNHA 3H7DA 3PT2A 3TNXA 4PT5A 1PADA 1CVZA 3RNVA 4YYRA 2YJCA 4HXDB 3N4CA 4D8EA 3W31A 2FRQA 1M6DA 3KW9A 4G54A 4BPVA 1PPPA 2Y6EA 4YV8A 1MIRA 1BP4A 1MEMA 1NB3A 4IUMA 2BDLA 1SNKA 1YT7A 1Y4HA 2WBFX 4D8BA 1S4VA 2OP3A 3QJ3A 2AIMA 5PADA 3K8UA 4XZXA 1AIMA 4YYWA 1AYWA 2G7YA 2VHFA 3H89A 2PREA 1EWPA 2E00A 2AS8A 4PI3A 3KX1A 4RF0A 1GECE 3AI8A 7PCKA 1CPJA 2DZZA 3PNRA 1F2AA 2P7UA 2OULA 4AXLA 4W5CA 1PVJA 1GLOA 1YALA 3E1ZB 4DMYA 3MTNA 3E9SA 4W4UA 4BS6A 2R9OA 5FPWA 1YZBA 1KXRA 2BDZA 2C0YA 2E03A 5EZQA 1PPOA 2DCDA 2PBHA 4Q8GA 4BOUA 3F5VA 1ICFA 4BQVA 5EGWA 3KKUA 5CVNB 3IFUA 2DC7A 6PADA 3MORA 3V6EA 4WURA 2NQDB 3BCNA 2JTCA 3P5WA 2DJFB 3LXSA 3QT4A 2YJ2A 1U5IA 1U9QX 3C0RA 3HHAA 2GHUA 1EWOA 4GUAA 3PRMA 1F2BA 3QSDA 2FYEA 3V6CA 3USVA 2F7DA 3C9EA 5F02A 4YYVA 2JQFR 4PP2E 1KHPA 1MS6A 3BPFA 1MEGA 1PIPA 4RF1A 2E01A 3M99A 4QBBA 4ZUXU 2DJGB 3O0UA 1TLOA 2HWKA 5CVOB 2AYOA 1O0EA 4XUIA 1AU3A 4R3DA 4BSQA 2Y5BA 4BOSA 4CDFB 9PAPA 2IBIA 3TMPA 4BS5A 1BQIA 3HHIA 4XR7A 4Q8HA 1PE6A 4RKXA 5A24A 2O6XA 2Z84A 4I05A 4KLBA 4YYSA 2HHNA 2R9FA 4MSXA 4P16A 3PHWA 4K7CA 3OISA 1Q6KA 3MHHA 1YVBA 3IMAA 2XU1A 4BOPA 1CQDA 4QRXA 3W30A 3PDFA 2AU1A 4WA6A 1PPNA 1ATKA 2AGAA 2J7QC 3BOWA 1QMYA 3OF8A 1POPA 2DCCA 4PADA 1NL6A 2ACTA 2G6DA 3MTVA 3H6SA 3TRKA 4OELA 1DKIA 4A5UA 1CJLA 2XU3A 5EZSA 3BPMA 2OZ2A 1CS8A 3K24A 5CVMA 1CSBB 1F2CA 5JA7A 3N3GA 3ZUAA 2G8EA 5CHVA 1VSNA 3MHSA 3WXEA 1UKFA 4OEMA 1F29A 2FUDA 2AUZA 4D8IA 1AECA 4M0WA 4IP3A 2DOSA 2P0RA 1PXVA 3O65A 3N3KA 4BOQA 1IWDA 3S3RA 1PCIA 4P6GA 2B1MA 1A6RA 3GCBA 1NQCA 4YVAA 5JZEA 2PADA 3OQCA 3KFQA 4N4ZA 3K9MA 3ERVA 1TL9A 3DF0A 2HXZA 2CIOA 2B1NA 2ATOA 5K16A 4REZA 2FE8A 4RY2A 3F75A 3PRPA 1K3BB 3IOQA 2YJ9A 4CDCB 3RVVA 2ARYA 4YYQA 3KSEA 5J94A 2FTDA 4CDEB 3MJ5A 1ITOA 1THEA 3IEJA 3WXGA 1GCBA 3PSEA 4FIPA 3PHXA 4X6JA 4QRGA 3OVZA 4N8WA 4HWYA 1YK7A 3I06A 4DMXA 5CHTA 2AYNA 3BC3A 2FT2A 3O1GA 1NLJA 4OW0A 3PW3A 4X6IA 4AXMA 2DCBA 5KO3A 3P5XA 2H7JA 1JQPA 1DEUA 3B79A 3RVWA 3OF9A 3HWNA 4N79A 4PP1A 2R9NA 3D6SA 3PBHA 1FH0A 4RNAA 4ZTBA 1GMYA 2F1GA 2FQ9A 3H8BA 2DC9A 4OVZB 1CTEA 2CB5A 1KFUL 2NQAA 2JRIA 4FK5A 1NPZA 3PHUA 1DF0A 2XU4A 1EWMA 1U9WA 5E6JA 2BTWB 2JQGR 1EWLA 4BOZA 1QXPA 4CZWA 4MI7A 1AU4A 2NQIA 2FO5A 3P5UA 1AYVA 5EF4A 4MM3B 1KFXL 3CBKA 1ME4A 2HD5A 1AU2A 3LFYA 3BY4A 1TU6A 3BWKA 1PBHA 2YJBA 2R9MA 4QRVA 1HUCB 1CV8A 1CB5A 2AUXA 4P6EA 2J7QA 4QH6A 2FRAA 1U9XA 4OVZA 3CH2X 2HH5A 1X9YA 1U9VA 2DC8A 3CH3X 1STFE 2DZYA 1VJVA 1AU0A 2E02A 3IV2A 2BTWA 2PNSA 1BY8A 3P5VA 4MZOA 4FJCA 3B21A 1ME3A 2GFOA 1NB5A 3HD3A 1SP4B 3BBAA 4I04A 3MP2A 2P86A 1YK8A 1Y08A 4X6HA 2NQGA 2R9CA 3H8CA
chains in the Genus database with same CATH topology
2G8JA 3U8EA 2IPPB 1ZCMA 2R6NA 3IHPA 3OVXA 5JH3A 3KWBX 1XKGA 2DCAA 2VHSA 4YYUA 1EF7A 1KHQA 1QDQA 3KWZA 1PPDA 1MHWA 3WXFA 3IUTA 1QOLA 4W5BA 2AVWA 3I3TA 1MDWA 8PCHA 1BGOA 2DC6A 3CBJA 4MZSA 4CDDB 4I07A 2YJ8A 2XU5A 3S3QA 3RVXA 3NHEA 1AYUA 1ZIVA 3H7DA 4NV8A 3TNXA 1PADA 1CVZA 4YYRA 2YJCA 3N4CA 2FRQA 1M6DA 3KW9A 4G54A 4BPVA 1PPPA 2Y6EA 4YV8A 1MIRA 1BP4A 1MEMA 1NB3A 2BDLA 1SNKA 1YT7A 4BGFA 1Y4HA 2WBFX 1S4VA 2OP3A 3QJ3A 2AIMA 5PADA 3K8UA 1AIMA 4YYWA 1AYWA 2G7YA 2VHFA 3H89A 2PREA 1EWPA 2E00A 2AS8A 4PI3A 3KX1A 1GECE 3AI8A 7PCKA 1CPJA 2DZZA 3PNRA 1F2AA 2P7UA 2OULA 4AXLA 4W5CA 1GLOA 1YALA 3E1ZB 4DMYA 4NV7A 3MTNA 4W4UA 4BS6A 2R9OA 5FPWA 1KXRA 2BDZA 2C0YA 2E03A 1PPOA 2DCDA 2PBHA 4Q8GA 3F5VA 1ICFA 4BQVA 5EGWA 3KKUA 5CVNB 2DC7A 6PADA 3MORA 3V6EA 2NQDB 3BCNA 3P5WA 3D9WA 2DJFB 3LXSA 3QT4A 2YJ2A 1U5IA 1U9QX 3HHAA 2GHUA 1EWOA 1F2BA 3QSDA 2FYEA 3V6CA 3USVA 2F7DA 3C9EA 3LTWA 5F02A 2VFCA 2JQFR 4YYVA 4PP2E 1KHPA 1MS6A 3BPFA 1MEGA 1PIPA 2E01A 3M99A 4QBBA 4ZUXU 2DJGB 3O0UA 1TLOA 5CVOB 2AYOA 1O0EA 4XUIA 1AU3A 1E2TA 4BSQA 2Y5BA 4CDFB 9PAPA 2IBIA 2BSZA 4BS5A 1BQIA 3HHIA 4XR7A 4Q8HA 1PE6A 5A24A 2O6XA 4I05A 4KLBA 4YYSA 2HHNA 2R9FA 4MSXA 4K7CA 3OISA 1Q6KA 3MHHA 1YVBA 3IMAA 2XU1A 1CQDA 4QRXA 3PDFA 2AU1A 4WA6A 1PPNA 1ATKA 3BOWA 1QMYA 3OF8A 1POPA 2DCCA 4PADA 1NL6A 2ACTA 2G6DA 3H6SA 4OELA 1CJLA 2XU3A 1W5RA 3BPMA 2OZ2A 1CS8A 3K24A 5CVMA 1CSBB 1F2CA 5JA7A 3N3GA 3ZUAA 2G8EA 5CHVA 1VSNA 3MHSA 3WXEA 4OEMA 1W6FA 1F29A 2FUDA 2AUZA 1AECA 2P0RA 1PXVA 4B55A 3N3KA 1IWDA 3S3RA 4GUZA 1PCIA 2B1MA 4P6GA 1A6RA 3GCBA 1NQCA 4YVAA 2PADA 3KFQA 4N4ZA 3K9MA 3ERVA 1TL9A 3DF0A 2HXZA 2CIOA 2B1NA 2ATOA 5K16A 4RY2A 3F75A 1K3BB 3IOQA 2YJ9A 4CDCB 3RVVA 2ARYA 4YYQA 3KSEA 5J94A 2FTDA 4CDEB 1ITOA 1THEA 3IEJA 3WXGA 1GCBA 4FIPA 4X6JA 4QRGA 3OVZA 4N8WA 4HWYA 1YK7A 3I06A 4DMXA 5CHTA 2AYNA 3BC3A 2FT2A 3O1GA 1NLJA 3PW3A 4X6IA 4AXMA 2DCBA 3P5XA 2H7JA 1JQPA 1DEUA 3B79A 3RVWA 3OF9A 3HWNA 4N79A 4PP1A 2R9NA 3D6SA 3PBHA 1FH0A 1GMYA 2F1GA 1GX3A 2FQ9A 3H8BA 2DC9A 1CTEA 2CB5A 1KFUL 2NQAA 4FK5A 1NPZA 4C5PA 1DF0A 2XU4A 1EWMA 1U9WA 2JQGR 1EWLA 1QXPA 4CZWA 1AU4A 2NQIA 2FO5A 3P5UA 1AYVA 5EF4A 1KFXL 3CBKA 1ME4A 2HD5A 1AU2A 3LFYA 1TU6A 3BWKA 1PBHA 2YJBA 2R9MA 4QRVA 1HUCB 1CV8A 1CB5A 2AUXA 4P6EA 4QH6A 2FRAA 1U9XA 3CH2X 2HH5A 1X9YA 1U9VA 2DC8A 3CH3X 1STFE 2DZYA 1VJVA 1AU0A 2E02A 3IV2A 2PNSA 1BY8A 2VFBA 3P5VA 4MZOA 1W4TA 4FJCA 1ME3A 2GFOA 1NB5A 3HD3A 1SP4B 4I04A 2P86A 1YK8A 1Y08A 4X6HA 2NQGA 2R9CA 3H8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8J A;  3U8E A;  2IPP B;  1ZCM A;  2R6N A;  3IHP A;  3OVX A;  5JH3 A;  3KWB X;  1XKG A;  2DCA A;  2VHS A;  4YYU A;  1EF7 A;  1KHQ A;  1QDQ A;  3KWZ A;  1PPD A;  1MHW A;  3WXF A;  3IUT A;  1QOL A;  4W5B A;  2AVW A;  3I3T A;  1MDW A;  8PCH A;  1BGO A;  2DC6 A;  3CBJ A;  4MZS A;  4CDD B;  4I07 A;  2YJ8 A;  2XU5 A;  3S3Q A;  3RVX A;  3NHE A;  1AYU A;  1ZIV A;  3H7D A;  3TNX A;  1PAD A;  1CVZ A;  4YYR A;  2YJC A;  3N4C A;  2FRQ A;  1M6D A;  3KW9 A;  4G54 A;  4BPV A;  1PPP A;  2Y6E A;  4YV8 A;  1MIR A;  1BP4 A;  1MEM A;  1NB3 A;  2BDL A;  1SNK A;  1YT7 A;  1Y4H A;  2WBF X;  1S4V A;  2OP3 A;  3QJ3 A;  2AIM A;  5PAD A;  3K8U A;  1AIM A;  4YYW A;  1AYW A;  2G7Y A;  2VHF A;  3H89 A;  2PRE A;  1EWP A;  2E00 A;  2AS8 A;  4PI3 A;  3KX1 A;  1GEC E;  3AI8 A;  7PCK A;  1CPJ A;  2DZZ A;  3PNR A;  1F2A A;  2P7U A;  2OUL A;  4AXL A;  4W5C A;  1GLO A;  1YAL A;  3E1Z B;  4DMY A;  3MTN A;  4W4U A;  4BS6 A;  2R9O A;  5FPW A;  1KXR A;  2BDZ A;  2C0Y A;  2E03 A;  1PPO A;  2DCD A;  2PBH A;  4Q8G A;  3F5V A;  1ICF A;  4BQV A;  5EGW A;  3KKU A;  5CVN B;  2DC7 A;  6PAD A;  3MOR A;  3V6E A;  2NQD B;  3BCN A;  3P5W A;  2DJF B;  3LXS A;  3QT4 A;  2YJ2 A;  1U5I A;  1U9Q X;  3HHA A;  2GHU A;  1EWO A;  1F2B A;  3QSD A;  2FYE A;  3V6C A;  3USV A;  2F7D A;  3C9E A;  5F02 A;  4YYV A;  2JQF R;  4PP2 E;  1KHP A;  1MS6 A;  3BPF A;  1MEG A;  1PIP A;  2E01 A;  3M99 A;  4QBB A;  4ZUX U;  2DJG B;  3O0U A;  1TLO A;  5CVO B;  2AYO A;  1O0E A;  4XUI A;  1AU3 A;  4BSQ A;  2Y5B A;  4CDF B;  9PAP A;  2IBI A;  4BS5 A;  1BQI A;  3HHI A;  4XR7 A;  4Q8H A;  1PE6 A;  5A24 A;  2O6X A;  4I05 A;  4KLB A;  4YYS A;  2HHN A;  2R9F A;  4MSX A;  4K7C A;  3OIS A;  1Q6K A;  3MHH A;  1YVB A;  3IMA A;  2XU1 A;  1CQD A;  4QRX A;  3PDF A;  2AU1 A;  4WA6 A;  1PPN A;  1ATK A;  3BOW A;  1QMY A;  3OF8 A;  1POP A;  2DCC A;  4PAD A;  1NL6 A;  2ACT A;  2G6D A;  3H6S A;  4OEL A;  1CJL A;  2XU3 A;  3BPM A;  2OZ2 A;  1CS8 A;  3K24 A;  5CVM A;  1CSB B;  1F2C A;  5JA7 A;  3N3G A;  3ZUA A;  2G8E A;  5CHV A;  1VSN A;  3MHS A;  3WXE A;  4OEM A;  1F29 A;  2FUD A;  2AUZ A;  1AEC A;  2P0R A;  1PXV A;  3N3K A;  1IWD A;  3S3R A;  1PCI A;  4P6G A;  2B1M A;  1A6R A;  3GCB A;  1NQC A;  4YVA A;  2PAD A;  3KFQ A;  4N4Z A;  3K9M A;  3ERV A;  1TL9 A;  3DF0 A;  2HXZ A;  2CIO A;  2B1N A;  2ATO A;  5K16 A;  4RY2 A;  3F75 A;  1K3B B;  3IOQ A;  2YJ9 A;  4CDC B;  3RVV A;  2ARY A;  4YYQ A;  3KSE A;  5J94 A;  2FTD A;  4CDE B;  1ITO A;  1THE A;  3IEJ A;  3WXG A;  1GCB A;  4FIP A;  4X6J A;  4QRG A;  3OVZ A;  4N8W A;  4HWY A;  1YK7 A;  3I06 A;  4DMX A;  5CHT A;  2AYN A;  3BC3 A;  2FT2 A;  3O1G A;  1NLJ A;  3PW3 A;  4X6I A;  4AXM A;  2DCB A;  3P5X A;  2H7J A;  1JQP A;  1DEU A;  3B79 A;  3RVW A;  3OF9 A;  3HWN A;  4N79 A;  4PP1 A;  2R9N A;  3D6S A;  3PBH A;  1FH0 A;  1GMY A;  2F1G A;  2FQ9 A;  3H8B A;  2DC9 A;  1CTE A;  2CB5 A;  1KFU L;  2NQA A;  4FK5 A;  1NPZ A;  1DF0 A;  2XU4 A;  1EWM A;  1U9W A;  2JQG R;  1EWL A;  1QXP A;  4CZW A;  1AU4 A;  2NQI A;  2FO5 A;  3P5U A;  1AYV A;  5EF4 A;  1KFX L;  3CBK A;  1ME4 A;  2HD5 A;  1AU2 A;  3LFY A;  1TU6 A;  3BWK A;  1PBH A;  2YJB A;  2R9M A;  4QRV A;  1HUC B;  1CV8 A;  1CB5 A;  2AUX A;  4P6E A;  4QH6 A;  2FRA A;  1U9X A;  3CH2 X;  2HH5 A;  1X9Y A;  1U9V A;  2DC8 A;  3CH3 X;  1STF E;  2DZY A;  1VJV A;  1AU0 A;  2E02 A;  3IV2 A;  2PNS A;  1BY8 A;  3P5V A;  4MZO A;  4FJC A;  1ME3 A;  2GFO A;  1NB5 A;  3HD3 A;  1SP4 B;  4I04 A;  2P86 A;  1YK8 A;  1Y08 A;  4X6H A;  2NQG A;  2R9C A;  3H8C A; 
#chains in the Genus database with same CATH topology
 2G8J A;  3U8E A;  2IPP B;  1ZCM A;  2R6N A;  3IHP A;  3OVX A;  5JH3 A;  3KWB X;  1XKG A;  2DCA A;  2VHS A;  4YYU A;  1EF7 A;  1KHQ A;  2BU3 A;  1QDQ A;  3KWZ A;  1PPD A;  1MHW A;  3WXF A;  2UZJ A;  3IUT A;  1QOL A;  4W5B A;  2AVW A;  3I3T A;  1MDW A;  8PCH A;  1BGO A;  2DC6 A;  3CBJ A;  4MZS A;  4CDD B;  4I07 A;  3BB7 A;  2YJ8 A;  2XU5 A;  3S3Q A;  3RVX A;  3NHE A;  1AYU A;  1ZIV A;  3ZNH A;  3H7D A;  3PT2 A;  3TNX A;  4PT5 A;  1PAD A;  1CVZ A;  3RNV A;  4YYR A;  2YJC A;  4HXD B;  3N4C A;  4D8E A;  3W31 A;  2FRQ A;  1M6D A;  3KW9 A;  4G54 A;  4BPV A;  1PPP A;  2Y6E A;  4YV8 A;  1MIR A;  1BP4 A;  1MEM A;  1NB3 A;  4IUM A;  2BDL A;  1SNK A;  1YT7 A;  1Y4H A;  2WBF X;  4D8B A;  1S4V A;  2OP3 A;  3QJ3 A;  2AIM A;  5PAD A;  3K8U A;  4XZX A;  1AIM A;  4YYW A;  1AYW A;  2G7Y A;  2VHF A;  3H89 A;  2PRE A;  1EWP A;  2E00 A;  2AS8 A;  4PI3 A;  3KX1 A;  4RF0 A;  1GEC E;  3AI8 A;  7PCK A;  1CPJ A;  2DZZ A;  3PNR A;  1F2A A;  2P7U A;  2OUL A;  4AXL A;  4W5C A;  1PVJ A;  1GLO A;  1YAL A;  3E1Z B;  4DMY A;  3MTN A;  3E9S A;  4W4U A;  4BS6 A;  2R9O A;  5FPW A;  1YZB A;  1KXR A;  2BDZ A;  2C0Y A;  2E03 A;  5EZQ A;  1PPO A;  2DCD A;  2PBH A;  4Q8G A;  4BOU A;  3F5V A;  1ICF A;  4BQV A;  5EGW A;  3KKU A;  5CVN B;  3IFU A;  2DC7 A;  6PAD A;  3MOR A;  3V6E A;  4WUR A;  2NQD B;  3BCN A;  2JTC A;  3P5W A;  2DJF B;  3LXS A;  3QT4 A;  2YJ2 A;  1U5I A;  1U9Q X;  3C0R A;  3HHA A;  2GHU A;  1EWO A;  4GUA A;  3PRM A;  1F2B A;  3QSD A;  2FYE A;  3V6C A;  3USV A;  2F7D A;  3C9E A;  5F02 A;  4YYV A;  2JQF R;  4PP2 E;  1KHP A;  1MS6 A;  3BPF A;  1MEG A;  1PIP A;  4RF1 A;  2E01 A;  3M99 A;  4QBB A;  4ZUX U;  2DJG B;  3O0U A;  1TLO A;  2HWK A;  5CVO B;  2AYO A;  1O0E A;  4XUI A;  1AU3 A;  4R3D A;  4BSQ A;  2Y5B A;  4BOS A;  4CDF B;  9PAP A;  2IBI A;  3TMP A;  4BS5 A;  1BQI A;  3HHI A;  4XR7 A;  4Q8H A;  1PE6 A;  4RKX A;  5A24 A;  2O6X A;  2Z84 A;  4I05 A;  4KLB A;  4YYS A;  2HHN A;  2R9F A;  4MSX A;  4P16 A;  3PHW A;  4K7C A;  3OIS A;  1Q6K A;  3MHH A;  1YVB A;  3IMA A;  2XU1 A;  4BOP A;  1CQD A;  4QRX A;  3W30 A;  3PDF A;  2AU1 A;  4WA6 A;  1PPN A;  1ATK A;  2AGA A;  2J7Q C;  3BOW A;  1QMY A;  3OF8 A;  1POP A;  2DCC A;  4PAD A;  1NL6 A;  2ACT A;  2G6D A;  3MTV A;  3H6S A;  3TRK A;  4OEL A;  1DKI A;  4A5U A;  1CJL A;  2XU3 A;  5EZS A;  3BPM A;  2OZ2 A;  1CS8 A;  3K24 A;  5CVM A;  1CSB B;  1F2C A;  5JA7 A;  3N3G A;  3ZUA A;  2G8E A;  5CHV A;  1VSN A;  3MHS A;  3WXE A;  1UKF A;  4OEM A;  1F29 A;  2FUD A;  2AUZ A;  4D8I A;  1AEC A;  4M0W A;  4IP3 A;  2DOS A;  2P0R A;  1PXV A;  3O65 A;  3N3K A;  4BOQ A;  1IWD A;  3S3R A;  1PCI A;  4P6G A;  2B1M A;  1A6R A;  3GCB A;  1NQC A;  4YVA A;  5JZE A;  2PAD A;  3OQC A;  3KFQ A;  4N4Z A;  3K9M A;  3ERV A;  1TL9 A;  3DF0 A;  2HXZ A;  2CIO A;  2B1N A;  2ATO A;  5K16 A;  4REZ A;  2FE8 A;  4RY2 A;  3F75 A;  3PRP A;  1K3B B;  3IOQ A;  2YJ9 A;  4CDC B;  3RVV A;  2ARY A;  4YYQ A;  3KSE A;  5J94 A;  2FTD A;  4CDE B;  3MJ5 A;  1ITO A;  1THE A;  3IEJ A;  3WXG A;  1GCB A;  3PSE A;  4FIP A;  3PHX A;  4X6J A;  4QRG A;  3OVZ A;  4N8W A;  4HWY A;  1YK7 A;  3I06 A;  4DMX A;  5CHT A;  2AYN A;  3BC3 A;  2FT2 A;  3O1G A;  1NLJ A;  4OW0 A;  3PW3 A;  4X6I A;  4AXM A;  2DCB A;  5KO3 A;  3P5X A;  2H7J A;  1JQP A;  1DEU A;  3B79 A;  3RVW A;  3OF9 A;  3HWN A;  4N79 A;  4PP1 A;  2R9N A;  3D6S A;  3PBH A;  1FH0 A;  4RNA A;  4ZTB A;  1GMY A;  2F1G A;  2FQ9 A;  3H8B A;  2DC9 A;  4OVZ B;  1CTE A;  2CB5 A;  1KFU L;  2NQA A;  2JRI A;  4FK5 A;  1NPZ A;  3PHU A;  1DF0 A;  2XU4 A;  1EWM A;  1U9W A;  5E6J A;  2BTW B;  2JQG R;  1EWL A;  4BOZ A;  1QXP A;  4CZW A;  4MI7 A;  1AU4 A;  2NQI A;  2FO5 A;  3P5U A;  1AYV A;  5EF4 A;  4MM3 B;  1KFX L;  3CBK A;  1ME4 A;  2HD5 A;  1AU2 A;  3LFY A;  3BY4 A;  1TU6 A;  3BWK A;  1PBH A;  2YJB A;  2R9M A;  4QRV A;  1HUC B;  1CV8 A;  1CB5 A;  2AUX A;  4P6E A;  2J7Q A;  4QH6 A;  2FRA A;  1U9X A;  4OVZ A;  3CH2 X;  2HH5 A;  1X9Y A;  1U9V A;  2DC8 A;  3CH3 X;  1STF E;  2DZY A;  1VJV A;  1AU0 A;  2E02 A;  3IV2 A;  2BTW A;  2PNS A;  1BY8 A;  3P5V A;  4MZO A;  4FJC A;  3B21 A;  1ME3 A;  2GFO A;  1NB5 A;  3HD3 A;  1SP4 B;  3BBA A;  4I04 A;  3MP2 A;  2P86 A;  1YK8 A;  1Y08 A;  4X6H A;  2NQG A;  2R9C A;  3H8C A; 
#chains in the Genus database with same CATH homology
 2G8J A;  3U8E A;  2IPP B;  1ZCM A;  2R6N A;  3IHP A;  3OVX A;  5JH3 A;  3KWB X;  1XKG A;  2DCA A;  2VHS A;  4YYU A;  1EF7 A;  1KHQ A;  1QDQ A;  3KWZ A;  1PPD A;  1MHW A;  3WXF A;  3IUT A;  1QOL A;  4W5B A;  2AVW A;  3I3T A;  1MDW A;  8PCH A;  1BGO A;  2DC6 A;  3CBJ A;  4MZS A;  4CDD B;  4I07 A;  2YJ8 A;  2XU5 A;  3S3Q A;  3RVX A;  3NHE A;  1AYU A;  1ZIV A;  3H7D A;  4NV8 A;  3TNX A;  1PAD A;  1CVZ A;  4YYR A;  2YJC A;  3N4C A;  2FRQ A;  1M6D A;  3KW9 A;  4G54 A;  4BPV A;  1PPP A;  2Y6E A;  4YV8 A;  1MIR A;  1BP4 A;  1MEM A;  1NB3 A;  2BDL A;  1SNK A;  1YT7 A;  4BGF A;  1Y4H A;  2WBF X;  1S4V A;  2OP3 A;  3QJ3 A;  2AIM A;  5PAD A;  3K8U A;  1AIM A;  4YYW A;  1AYW A;  2G7Y A;  2VHF A;  3H89 A;  2PRE A;  1EWP A;  2E00 A;  2AS8 A;  4PI3 A;  3KX1 A;  1GEC E;  3AI8 A;  7PCK A;  1CPJ A;  2DZZ A;  3PNR A;  1F2A A;  2P7U A;  2OUL A;  4AXL A;  4W5C A;  1GLO A;  1YAL A;  3E1Z B;  4DMY A;  4NV7 A;  3MTN A;  4W4U A;  4BS6 A;  2R9O A;  5FPW A;  1KXR A;  2BDZ A;  2C0Y A;  2E03 A;  1PPO A;  2DCD A;  2PBH A;  4Q8G A;  3F5V A;  1ICF A;  4BQV A;  5EGW A;  3KKU A;  5CVN B;  2DC7 A;  6PAD A;  3MOR A;  3V6E A;  2NQD B;  3BCN A;  3P5W A;  3D9W A;  2DJF B;  3LXS A;  3QT4 A;  2YJ2 A;  1U5I A;  1U9Q X;  3HHA A;  2GHU A;  1EWO A;  1F2B A;  3QSD A;  2FYE A;  3V6C A;  3USV A;  2F7D A;  3C9E A;  3LTW A;  5F02 A;  2VFC A;  2JQF R;  4YYV A;  4PP2 E;  1KHP A;  1MS6 A;  3BPF A;  1MEG A;  1PIP A;  2E01 A;  3M99 A;  4QBB A;  4ZUX U;  2DJG B;  3O0U A;  1TLO A;  5CVO B;  2AYO A;  1O0E A;  4XUI A;  1AU3 A;  1E2T A;  4BSQ A;  2Y5B A;  4CDF B;  9PAP A;  2IBI A;  2BSZ A;  4BS5 A;  1BQI A;  3HHI A;  4XR7 A;  4Q8H A;  1PE6 A;  5A24 A;  2O6X A;  4I05 A;  4KLB A;  4YYS A;  2HHN A;  2R9F A;  4MSX A;  4K7C A;  3OIS A;  1Q6K A;  3MHH A;  1YVB A;  3IMA A;  2XU1 A;  1CQD A;  4QRX A;  3PDF A;  2AU1 A;  4WA6 A;  1PPN A;  1ATK A;  3BOW A;  1QMY A;  3OF8 A;  1POP A;  2DCC A;  4PAD A;  1NL6 A;  2ACT A;  2G6D A;  3H6S A;  4OEL A;  1CJL A;  2XU3 A;  1W5R A;  3BPM A;  2OZ2 A;  1CS8 A;  3K24 A;  5CVM A;  1CSB B;  1F2C A;  5JA7 A;  3N3G A;  3ZUA A;  2G8E A;  5CHV A;  1VSN A;  3MHS A;  3WXE A;  4OEM A;  1W6F A;  1F29 A;  2FUD A;  2AUZ A;  1AEC A;  2P0R A;  1PXV A;  4B55 A;  3N3K A;  1IWD A;  3S3R A;  4GUZ A;  1PCI A;  2B1M A;  4P6G A;  1A6R A;  3GCB A;  1NQC A;  4YVA A;  2PAD A;  3KFQ A;  4N4Z A;  3K9M A;  3ERV A;  1TL9 A;  3DF0 A;  2HXZ A;  2CIO A;  2B1N A;  2ATO A;  5K16 A;  4RY2 A;  3F75 A;  1K3B B;  3IOQ A;  2YJ9 A;  4CDC B;  3RVV A;  2ARY A;  4YYQ A;  3KSE A;  5J94 A;  2FTD A;  4CDE B;  1ITO A;  1THE A;  3IEJ A;  3WXG A;  1GCB A;  4FIP A;  4X6J A;  4QRG A;  3OVZ A;  4N8W A;  4HWY A;  1YK7 A;  3I06 A;  4DMX A;  5CHT A;  2AYN A;  3BC3 A;  2FT2 A;  3O1G A;  1NLJ A;  3PW3 A;  4X6I A;  4AXM A;  2DCB A;  3P5X A;  2H7J A;  1JQP A;  1DEU A;  3B79 A;  3RVW A;  3OF9 A;  3HWN A;  4N79 A;  4PP1 A;  2R9N A;  3D6S A;  3PBH A;  1FH0 A;  1GMY A;  2F1G A;  1GX3 A;  2FQ9 A;  3H8B A;  2DC9 A;  1CTE A;  2CB5 A;  1KFU L;  2NQA A;  4FK5 A;  1NPZ A;  4C5P A;  1DF0 A;  2XU4 A;  1EWM A;  1U9W A;  2JQG R;  1EWL A;  1QXP A;  4CZW A;  1AU4 A;  2NQI A;  2FO5 A;  3P5U A;  1AYV A;  5EF4 A;  1KFX L;  3CBK A;  1ME4 A;  2HD5 A;  1AU2 A;  3LFY A;  1TU6 A;  3BWK A;  1PBH A;  2YJB A;  2R9M A;  4QRV A;  1HUC B;  1CV8 A;  1CB5 A;  2AUX A;  4P6E A;  4QH6 A;  2FRA A;  1U9X A;  3CH2 X;  2HH5 A;  1X9Y A;  1U9V A;  2DC8 A;  3CH3 X;  1STF E;  2DZY A;  1VJV A;  1AU0 A;  2E02 A;  3IV2 A;  2PNS A;  1BY8 A;  2VFB A;  3P5V A;  4MZO A;  1W4T A;  4FJC A;  1ME3 A;  2GFO A;  1NB5 A;  3HD3 A;  1SP4 B;  4I04 A;  2P86 A;  1YK8 A;  1Y08 A;  4X6H A;  2NQG A;  2R9C A;  3H8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...