1PPDA

Restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HYDROXYETHYL-THIOPAPAIN
publication title Restrained Least-Squares Refinement of the Sulfhydryl Protease Papain to 2.0 Angstroms
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1984-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppdA00
1AECA 2DCDA 5CVOB 4W4UA 3F5VA 3S3RA 4FJCA 1PPPA 2G6DA 1THEA 3RVVA 2OULA 3BCNA 3LFYA 2VHSA 1PPNA 2XU5A 2AVWA 1BY8A 1BP4A 4K7CA 4WA6A 4I07A 5CVNB 4CZWA 3MORA 3OF8A 2OP3A 4Q8HA 3K24A 1GMYA 3H6SA 3AI8A 1MS6A 4CDFB 3S3QA 3RVWA 1EF7A 1ATKA 5A24A 2R9FA 5CHTA 4CDEB 2AUZA 3MTNA 4KLBA 1MIRA 2WBFX 1NB5A 2PADA 3PW3A 3H7DA 2FT2A 4Q8GA 3QJ3A 1K3BB 1QDQA 3P5UA 4PP2E 2AYNA 2HHNA 2FRAA 5J94A 4OEMA 3O1GA 2DJGB 2PREA 1AU3A 2FTDA 3IV2A 4BPVA 4DMYA 4MZSA 1U9VA 1F2AA 4CDDB 1ME3A 2IBIA 3CBKA 1YT7A 3I3TA 3WXEA 8PCHA 4PADA 2AS8A 2AYOA 1QOLA 4YYSA 1EWMA 4HWYA 2B1MA 3KSEA 3BWKA 3IHPA 4BSQA 2AIMA 4X6JA 4PI3A 2FQ9A 2JQFR 3KX1A 2B1NA 3CBJA 2DC9A 3P5WA 1AU2A 4BQVA 3BC3A 4W5CA 3USVA 1CV8A 4CDCB 1DF0A 1MHWA 2YJ2A 3C9EA 2FRQA 1AYWA 1F2CA 3MHHA 3H8CA 4YYWA 1NPZA 2F7DA 4MSXA 3B79A 2DZZA 3K9MA 1U5IA 1AYVA 2NQAA 3NHEA 1BGOA 3HD3A 4XR7A 2DJFB 2GHUA 3D6SA 5PADA 4N8WA 1NQCA 3N3GA 3CH3X 2R9CA 1SP4B 1U9XA 9PAPA 2DCBA 3BPFA 4FIPA 4YYQA 1YALA 3OF9A 1F2BA 1EWPA 4BS5A 1GCBA 2DCCA 1AIMA 3KFQA 2G8EA 4I04A 4N4ZA 3IMAA 1O0EA 1XKGA 1AU4A 1EWLA 1PXVA 2E01A 4RY2A 4W5BA 2NQDB 5CHVA 1ITOA 1CPJA 3U8EA 2R6NA 1M6DA 2P0RA 3DF0A 4QRVA 3QT4A 3CH2X 2O6XA 1CB5A 4YYUA 1DEUA 2IPPB 2GFOA 4YYRA 1KHPA 1AU0A 2YJCA 2PNSA 4G54A 1PPDA 2PBHA 3WXGA 3M99A 2AU1A 4P6EA 2YJ9A 2NQIA 1CJLA 3P5XA 5EF4A 1CSBB 1PPOA 1GECE 3PDFA 2Y6EA 1CVZA 1SNKA 4QRGA 4YV8A 4AXMA 1ZIVA 1STFE 3V6EA 4I05A 1PBHA 6PADA 3P5VA 2DC6A 3KWZA 3HHIA 2VHFA 1IWDA 3N3KA 3KKUA 1CTEA 4MZOA 1HUCB 1Q6KA 4FK5A 2G7YA 4YYVA 2XU4A 3H8BA 3IOQA 2DC7A 1JQPA 4AXLA 3GCBA 2H7JA 1YK8A 3I06A 2Y5BA 4PP1A 3PBHA 1TU6A 2R9MA 3HWNA 1TL9A 1CS8A 1U9QX 2OZ2A 2E02A 1AYUA 1KFUL 2ARYA 3BOWA 2AUXA 1MEMA 3TNXA 1YK7A 3IUTA 4OELA 3V6CA 1PIPA 1QXPA 2HXZA 3ERVA 2DZYA 2C0YA 2R9OA 3OISA 1KXRA 3HHAA 3K8UA 3IEJA 1MDWA 5K16A 5CVMA 1NB3A 3OVXA 3ZUAA 1MEGA 3RVXA 2P86A 5EGWA 3WXFA 3QSDA 2FO5A 1EWOA 1S4VA 2HD5A 5F02A 1Y08A 2YJBA 2BDLA 2G8JA 2XU3A 3N4CA 1VSNA 3F75A 2F1GA 1NLJA 2E03A 3O0UA 1X9YA 2E00A 3BPMA 4DMXA 1VJVA 3OVZA 1BQIA 2CIOA 1QMYA 3PNRA 5FPWA 1ICFA 5JH3A 1CQDA 4XUIA 3H89A 1PCIA 2NQGA 1YVBA 1ME4A 1TLOA 3E1ZB 4N79A 4YVAA 2HH5A 1PE6A 2P7UA 4QRXA 1U9WA 3LXSA 1A6RA 1FH0A 5JA7A 1Y4HA 1KFXL 1NL6A 2FUDA 3KWBX 2DC8A 2CB5A 4QH6A 2ACTA 1F29A 1ZCMA 4X6IA 4P6GA 2FYEA 2YJ8A 2DCAA 4X6HA 4BS6A 2ATOA 4QBBA 3MHSA 2R9NA 1KHQA 1GLOA 3KW9A 2BDZA 4ZUXU 2JQGR 7PCKA 1POPA 2XU1A 1PADA
chains in the Genus database with same CATH superfamily
1AECA 2DCDA 5CVOB 4W4UA 3F5VA 3S3RA 3O65A 4FJCA 1PPPA 3PHWA 3MJ5A 2G6DA 1THEA 3RVVA 2OULA 3BCNA 4D8EA 3LFYA 5KO3A 2VHSA 1PPNA 2XU5A 4BOZA 2AVWA 4PT5A 1BY8A 1BP4A 3PT2A 4K7CA 4WA6A 4I07A 5CVNB 4CZWA 3TRKA 3MORA 3OF8A 2OP3A 4Q8HA 3K24A 1GMYA 3C0RA 3H6SA 3AI8A 1MS6A 4CDFB 3S3QA 3RVWA 1EF7A 1DKIA 1ATKA 5A24A 2R9FA 5JZEA 5CHTA 3BBAA 4CDEB 2AUZA 3MTNA 4KLBA 1MIRA 2WBFX 4HXDB 1NB5A 2PADA 3PW3A 3H7DA 2FT2A 4Q8GA 3QJ3A 1K3BB 1QDQA 3P5UA 4PP2E 2BTWB 2AYNA 2HHNA 4MI7A 2FRAA 5J94A 4OEMA 3O1GA 2DJGB 2PREA 1AU3A 2FTDA 3IV2A 4BPVA 3MP2A 4DMYA 4MZSA 1U9VA 1F2AA 4CDDB 1ME3A 2FE8A 2IBIA 3CBKA 1YT7A 3I3TA 3WXEA 8PCHA 4PADA 2AS8A 2AYOA 1QOLA 3RNVA 4YYSA 1EWMA 4HWYA 2B1MA 4BOUA 3KSEA 3BWKA 3IHPA 4BSQA 2AIMA 4X6JA 2J7QA 4PI3A 2FQ9A 2JQFR 3W31A 3KX1A 2B1NA 3CBJA 2DC9A 3P5WA 1AU2A 3MTVA 4BQVA 3BC3A 4W5CA 3USVA 1CV8A 4CDCB 1DF0A 1MHWA 2YJ2A 3C9EA 2FRQA 1AYWA 1F2CA 3MHHA 3H8CA 3PHUA 4YYWA 1NPZA 2F7DA 4MSXA 3B79A 2DZZA 3K9MA 1U5IA 1AYVA 2NQAA 4MM3B 3NHEA 1BGOA 3HD3A 4XR7A 4BOSA 2DJFB 2GHUA 3D6SA 2DOSA 4XZXA 5PADA 4GUAA 4IUMA 4N8WA 1NQCA 3N3GA 3CH3X 2R9CA 1SP4B 1U9XA 9PAPA 2JRIA 2DCBA 3BPFA 3PRPA 4FIPA 4YYQA 1YALA 3OF9A 1F2BA 1EWPA 4BS5A 1GCBA 2DCCA 1AIMA 3KFQA 5EZQA 2G8EA 4I04A 4N4ZA 3IMAA 1O0EA 1XKGA 1AU4A 3TMPA 1EWLA 1PXVA 2E01A 4RY2A 3B21A 4W5BA 2NQDB 5CHVA 1ITOA 1CPJA 3U8EA 2R6NA 1M6DA 2P0RA 3DF0A 4QRVA 3QT4A 3CH2X 2O6XA 1CB5A 4YYUA 1DEUA 2IPPB 2GFOA 4YYRA 1KHPA 1AU0A 2YJCA 2PNSA 4G54A 1PPDA 2PBHA 4WURA 3M99A 3WXGA 2AU1A 4P6EA 2YJ9A 3ZNHA 2NQIA 1CJLA 3P5XA 5EF4A 1CSBB 1PPOA 1GECE 3PDFA 3W30A 4A5UA 2Y6EA 1CVZA 1SNKA 4QRGA 3E9SA 4YV8A 3OQCA 4AXMA 1ZIVA 1STFE 3V6EA 4I05A 1PBHA 6PADA 3P5VA 2BU3A 4R3DA 2DC6A 3KWZA 3HHIA 2VHFA 1IWDA 3N3KA 3KKUA 1CTEA 4MZOA 1HUCB 1Q6KA 2HWKA 4FK5A 1PVJA 2G7YA 4RNAA 4YYVA 2XU4A 3H8BA 4RF0A 3IOQA 2DC7A 2AGAA 1JQPA 4AXLA 3GCBA 2H7JA 2BTWA 1YK8A 3I06A 2Y5BA 4PP1A 2Z84A 1TU6A 3PBHA 2R9MA 3HWNA 1TL9A 1CS8A 1U9QX 2OZ2A 3BY4A 2E02A 2UZJA 1AYUA 1KFUL 2ARYA 3BOWA 2AUXA 4OVZB 1MEMA 3TNXA 1YK7A 1UKFA 3IUTA 4OELA 3V6CA 1PIPA 1QXPA 2HXZA 3ERVA 2DZYA 2C0YA 2R9OA 3OISA 1KXRA 3HHAA 3K8UA 3IEJA 1MDWA 5K16A 5CVMA 1NB3A 3OVXA 3ZUAA 3PRMA 4BOQA 1MEGA 3RVXA 2P86A 5EGWA 3WXFA 3QSDA 2FO5A 4IP3A 1EWOA 1S4VA 4BOPA 2HD5A 5F02A 1Y08A 3IFUA 2YJBA 2BDLA 2G8JA 2JTCA 2XU3A 3N4CA 1VSNA 3F75A 2F1GA 1NLJA 4P16A 2E03A 5EZSA 3O0UA 1X9YA 2E00A 3BPMA 4DMXA 1VJVA 3OVZA 1BQIA 3PHXA 2CIOA 1QMYA 2J7QC 3PNRA 5FPWA 1ICFA 5JH3A 5E6JA 1CQDA 4XUIA 4M0WA 3H89A 1PCIA 4REZA 2NQGA 1YVBA 1ME4A 4OVZA 1YZBA 1TLOA 3E1ZB 4N79A 4YVAA 2HH5A 1PE6A 2P7UA 4QRXA 4D8IA 1U9WA 3LXSA 1A6RA 4ZTBA 1FH0A 5JA7A 1Y4HA 1KFXL 1NL6A 2FUDA 3KWBX 2DC8A 2CB5A 4QH6A 2ACTA 1F29A 4RF1A 4RKXA 1ZCMA 4X6IA 3PSEA 3BB7A 4P6GA 2FYEA 2YJ8A 2DCAA 4X6HA 4BS6A 2ATOA 4QBBA 3MHSA 2R9NA 1KHQA 1GLOA 3KW9A 2BDZA 4ZUXU 2JQGR 7PCKA 4OW0A 1POPA 4D8BA 2XU1A 1PADA
chains in the Genus database with same CATH topology
1AECA 2DCDA 5CVOB 4W4UA 3F5VA 3S3RA 4FJCA 1PPPA 2G6DA 1THEA 3RVVA 2OULA 3BCNA 3LFYA 2VHSA 1PPNA 2XU5A 2AVWA 1BY8A 1BP4A 4K7CA 2BSZA 4WA6A 4I07A 5CVNB 4CZWA 3MORA 3OF8A 2OP3A 4Q8HA 3K24A 1GMYA 3H6SA 3AI8A 1MS6A 4CDFB 3S3QA 3RVWA 1EF7A 1ATKA 5A24A 2R9FA 5CHTA 4CDEB 2AUZA 3MTNA 4KLBA 1MIRA 2WBFX 1NB5A 2PADA 3PW3A 3H7DA 2FT2A 4Q8GA 3QJ3A 1K3BB 1QDQA 3P5UA 1W4TA 4PP2E 2AYNA 2HHNA 4NV7A 2FRAA 5J94A 4OEMA 3O1GA 2DJGB 2PREA 1AU3A 2FTDA 3IV2A 4BPVA 4DMYA 3LTWA 4MZSA 1U9VA 1F2AA 4CDDB 1ME3A 2IBIA 3CBKA 1YT7A 3I3TA 3WXEA 8PCHA 4PADA 2AS8A 2AYOA 1QOLA 4YYSA 1EWMA 4HWYA 2B1MA 3KSEA 3BWKA 3IHPA 4BSQA 1E2TA 2AIMA 4X6JA 4PI3A 2FQ9A 2JQFR 3KX1A 2B1NA 3CBJA 2DC9A 3P5WA 1AU2A 4BQVA 3BC3A 4W5CA 3USVA 1CV8A 4CDCB 1DF0A 1MHWA 2YJ2A 3C9EA 2FRQA 1AYWA 1F2CA 3MHHA 3H8CA 4YYWA 1NPZA 2F7DA 4MSXA 3B79A 2DZZA 3K9MA 1U5IA 1AYVA 2NQAA 3NHEA 1BGOA 3HD3A 4XR7A 2DJFB 2GHUA 3D6SA 5PADA 4N8WA 1NQCA 3N3GA 3CH3X 1W6FA 2R9CA 1SP4B 1U9XA 9PAPA 2DCBA 3BPFA 4FIPA 4YYQA 1YALA 3OF9A 1F2BA 1EWPA 4BS5A 1GCBA 2DCCA 1AIMA 3KFQA 2G8EA 4I04A 4N4ZA 3IMAA 1O0EA 1XKGA 2VFCA 1AU4A 1EWLA 1PXVA 2E01A 4RY2A 4W5BA 2NQDB 5CHVA 1ITOA 1CPJA 3U8EA 2R6NA 1M6DA 2P0RA 3DF0A 4QRVA 3QT4A 3CH2X 2O6XA 1CB5A 4YYUA 1DEUA 2IPPB 2GFOA 4YYRA 1KHPA 1AU0A 2YJCA 2PNSA 4G54A 1PPDA 2PBHA 3WXGA 3M99A 4B55A 2AU1A 4P6EA 2YJ9A 2NQIA 1CJLA 3P5XA 5EF4A 1CSBB 1PPOA 1GECE 4BGFA 3PDFA 2Y6EA 1CVZA 1SNKA 4QRGA 4YV8A 4AXMA 1ZIVA 1STFE 3V6EA 4I05A 1PBHA 6PADA 3P5VA 2DC6A 3KWZA 3HHIA 2VHFA 1IWDA 3N3KA 3KKUA 1CTEA 4MZOA 1HUCB 1Q6KA 4FK5A 4GUZA 2G7YA 4YYVA 2XU4A 3H8BA 3IOQA 2DC7A 1JQPA 4AXLA 3GCBA 2H7JA 1YK8A 3I06A 2Y5BA 4PP1A 3PBHA 1TU6A 4C5PA 2R9MA 3HWNA 1TL9A 1CS8A 1U9QX 2OZ2A 2E02A 1AYUA 1KFUL 2ARYA 3BOWA 2AUXA 1MEMA 3TNXA 1YK7A 3IUTA 4OELA 3V6CA 1PIPA 1QXPA 2HXZA 3ERVA 2DZYA 2C0YA 2R9OA 3OISA 1KXRA 3HHAA 3K8UA 3IEJA 1MDWA 5K16A 5CVMA 1NB3A 3OVXA 3ZUAA 4NV8A 1MEGA 3RVXA 2P86A 5EGWA 3WXFA 3QSDA 2FO5A 1EWOA 1S4VA 2HD5A 5F02A 1Y08A 2YJBA 2BDLA 2G8JA 2XU3A 3N4CA 1VSNA 3F75A 2F1GA 1NLJA 2E03A 3O0UA 1X9YA 2E00A 3BPMA 4DMXA 1VJVA 3OVZA 1BQIA 2CIOA 1QMYA 3PNRA 5FPWA 1ICFA 5JH3A 1CQDA 4XUIA 3H89A 1PCIA 2NQGA 1YVBA 1ME4A 1TLOA 3E1ZB 4N79A 4YVAA 2HH5A 1PE6A 2P7UA 4QRXA 1U9WA 3LXSA 1A6RA 1FH0A 1GX3A 5JA7A 1Y4HA 1KFXL 1NL6A 3D9WA 2FUDA 3KWBX 2DC8A 2CB5A 4QH6A 2ACTA 1F29A 1ZCMA 4X6IA 2VFBA 4P6GA 2FYEA 2YJ8A 2DCAA 4X6HA 4BS6A 2ATOA 4QBBA 3MHSA 2R9NA 1W5RA 1KHQA 1GLOA 3KW9A 2BDZA 4ZUXU 2JQGR 7PCKA 1POPA 2XU1A 1PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEC A;  2DCD A;  5CVO B;  4W4U A;  3F5V A;  3S3R A;  4FJC A;  1PPP A;  2G6D A;  1THE A;  3RVV A;  2OUL A;  3BCN A;  3LFY A;  2VHS A;  1PPN A;  2XU5 A;  2AVW A;  1BY8 A;  1BP4 A;  4K7C A;  4WA6 A;  4I07 A;  5CVN B;  4CZW A;  3MOR A;  3OF8 A;  2OP3 A;  4Q8H A;  3K24 A;  1GMY A;  3H6S A;  3AI8 A;  1MS6 A;  4CDF B;  3S3Q A;  3RVW A;  1EF7 A;  1ATK A;  5A24 A;  2R9F A;  5CHT A;  4CDE B;  2AUZ A;  3MTN A;  4KLB A;  1MIR A;  2WBF X;  1NB5 A;  2PAD A;  3PW3 A;  3H7D A;  2FT2 A;  4Q8G A;  3QJ3 A;  1K3B B;  1QDQ A;  3P5U A;  4PP2 E;  2AYN A;  2HHN A;  2FRA A;  5J94 A;  4OEM A;  3O1G A;  2DJG B;  2PRE A;  1AU3 A;  2FTD A;  3IV2 A;  4BPV A;  4DMY A;  4MZS A;  1U9V A;  1F2A A;  4CDD B;  1ME3 A;  2IBI A;  3CBK A;  1YT7 A;  3I3T A;  3WXE A;  8PCH A;  4PAD A;  2AS8 A;  2AYO A;  1QOL A;  4YYS A;  1EWM A;  4HWY A;  2B1M A;  3KSE A;  3BWK A;  3IHP A;  4BSQ A;  2AIM A;  4X6J A;  4PI3 A;  2FQ9 A;  2JQF R;  3KX1 A;  2B1N A;  3CBJ A;  2DC9 A;  3P5W A;  1AU2 A;  4BQV A;  3BC3 A;  4W5C A;  3USV A;  1CV8 A;  4CDC B;  1DF0 A;  1MHW A;  2YJ2 A;  3C9E A;  2FRQ A;  1AYW A;  1F2C A;  3MHH A;  3H8C A;  4YYW A;  1NPZ A;  2F7D A;  4MSX A;  3B79 A;  2DZZ A;  3K9M A;  1U5I A;  1AYV A;  2NQA A;  3NHE A;  1BGO A;  3HD3 A;  4XR7 A;  2DJF B;  2GHU A;  3D6S A;  5PAD A;  4N8W A;  1NQC A;  3N3G A;  3CH3 X;  2R9C A;  1SP4 B;  1U9X A;  9PAP A;  2DCB A;  3BPF A;  4FIP A;  4YYQ A;  1YAL A;  3OF9 A;  1F2B A;  1EWP A;  4BS5 A;  1GCB A;  2DCC A;  1AIM A;  3KFQ A;  2G8E A;  4I04 A;  4N4Z A;  3IMA A;  1O0E A;  1XKG A;  1AU4 A;  1EWL A;  1PXV A;  2E01 A;  4RY2 A;  4W5B A;  2NQD B;  5CHV A;  1ITO A;  1CPJ A;  3U8E A;  2R6N A;  1M6D A;  2P0R A;  3DF0 A;  4QRV A;  3QT4 A;  3CH2 X;  2O6X A;  1CB5 A;  4YYU A;  1DEU A;  2IPP B;  2GFO A;  4YYR A;  1KHP A;  1AU0 A;  2YJC A;  2PNS A;  4G54 A;  1PPD A;  2PBH A;  3WXG A;  3M99 A;  2AU1 A;  4P6E A;  2YJ9 A;  2NQI A;  1CJL A;  3P5X A;  5EF4 A;  1CSB B;  1PPO A;  1GEC E;  3PDF A;  2Y6E A;  1CVZ A;  1SNK A;  4QRG A;  4YV8 A;  4AXM A;  1ZIV A;  1STF E;  3V6E A;  4I05 A;  1PBH A;  6PAD A;  3P5V A;  2DC6 A;  3KWZ A;  3HHI A;  2VHF A;  1IWD A;  3N3K A;  3KKU A;  1CTE A;  4MZO A;  1HUC B;  1Q6K A;  4FK5 A;  2G7Y A;  4YYV A;  2XU4 A;  3H8B A;  3IOQ A;  2DC7 A;  1JQP A;  4AXL A;  3GCB A;  2H7J A;  1YK8 A;  3I06 A;  2Y5B A;  4PP1 A;  3PBH A;  1TU6 A;  2R9M A;  3HWN A;  1TL9 A;  1CS8 A;  1U9Q X;  2OZ2 A;  2E02 A;  1AYU A;  1KFU L;  2ARY A;  3BOW A;  2AUX A;  1MEM A;  3TNX A;  1YK7 A;  3IUT A;  4OEL A;  3V6C A;  1PIP A;  1QXP A;  2HXZ A;  3ERV A;  2DZY A;  2C0Y A;  2R9O A;  3OIS A;  1KXR A;  3HHA A;  3K8U A;  3IEJ A;  1MDW A;  5K16 A;  5CVM A;  1NB3 A;  3OVX A;  3ZUA A;  1MEG A;  3RVX A;  2P86 A;  5EGW A;  3WXF A;  3QSD A;  2FO5 A;  1EWO A;  1S4V A;  2HD5 A;  5F02 A;  1Y08 A;  2YJB A;  2BDL A;  2G8J A;  2XU3 A;  3N4C A;  1VSN A;  3F75 A;  2F1G A;  1NLJ A;  2E03 A;  3O0U A;  1X9Y A;  2E00 A;  3BPM A;  4DMX A;  1VJV A;  3OVZ A;  1BQI A;  2CIO A;  1QMY A;  3PNR A;  5FPW A;  1ICF A;  5JH3 A;  1CQD A;  4XUI A;  3H89 A;  1PCI A;  2NQG A;  1YVB A;  1ME4 A;  1TLO A;  3E1Z B;  4N79 A;  4YVA A;  2HH5 A;  1PE6 A;  2P7U A;  4QRX A;  1U9W A;  3LXS A;  1A6R A;  1FH0 A;  5JA7 A;  1Y4H A;  1KFX L;  1NL6 A;  2FUD A;  3KWB X;  2DC8 A;  2CB5 A;  4QH6 A;  2ACT A;  1F29 A;  1ZCM A;  4X6I A;  4P6G A;  2FYE A;  2YJ8 A;  2DCA A;  4X6H A;  4BS6 A;  2ATO A;  4QBB A;  3MHS A;  2R9N A;  1KHQ A;  1GLO A;  3KW9 A;  2BDZ A;  4ZUX U;  2JQG R;  7PCK A;  1POP A;  2XU1 A;  1PAD A; 
#chains in the Genus database with same CATH topology
 1AEC A;  2DCD A;  5CVO B;  4W4U A;  3F5V A;  3S3R A;  3O65 A;  4FJC A;  1PPP A;  3PHW A;  3MJ5 A;  2G6D A;  1THE A;  3RVV A;  2OUL A;  3BCN A;  4D8E A;  3LFY A;  5KO3 A;  2VHS A;  1PPN A;  2XU5 A;  4BOZ A;  2AVW A;  4PT5 A;  1BY8 A;  1BP4 A;  3PT2 A;  4K7C A;  4WA6 A;  4I07 A;  5CVN B;  4CZW A;  3TRK A;  3MOR A;  3OF8 A;  2OP3 A;  4Q8H A;  3K24 A;  1GMY A;  3C0R A;  3H6S A;  3AI8 A;  1MS6 A;  4CDF B;  3S3Q A;  3RVW A;  1EF7 A;  1DKI A;  1ATK A;  5A24 A;  2R9F A;  5JZE A;  5CHT A;  3BBA A;  4CDE B;  2AUZ A;  3MTN A;  4KLB A;  1MIR A;  2WBF X;  4HXD B;  1NB5 A;  2PAD A;  3PW3 A;  3H7D A;  2FT2 A;  4Q8G A;  3QJ3 A;  1K3B B;  1QDQ A;  3P5U A;  4PP2 E;  2BTW B;  2AYN A;  2HHN A;  4MI7 A;  2FRA A;  5J94 A;  4OEM A;  3O1G A;  2DJG B;  2PRE A;  1AU3 A;  2FTD A;  3IV2 A;  4BPV A;  3MP2 A;  4DMY A;  4MZS A;  1U9V A;  1F2A A;  4CDD B;  1ME3 A;  2FE8 A;  2IBI A;  3CBK A;  1YT7 A;  3I3T A;  3WXE A;  8PCH A;  4PAD A;  2AS8 A;  2AYO A;  1QOL A;  3RNV A;  4YYS A;  1EWM A;  4HWY A;  2B1M A;  4BOU A;  3KSE A;  3BWK A;  3IHP A;  4BSQ A;  2AIM A;  4X6J A;  2J7Q A;  4PI3 A;  2FQ9 A;  2JQF R;  3W31 A;  3KX1 A;  2B1N A;  3CBJ A;  2DC9 A;  3P5W A;  1AU2 A;  3MTV A;  4BQV A;  3BC3 A;  4W5C A;  3USV A;  1CV8 A;  4CDC B;  1DF0 A;  1MHW A;  2YJ2 A;  3C9E A;  2FRQ A;  1AYW A;  1F2C A;  3MHH A;  3H8C A;  3PHU A;  4YYW A;  1NPZ A;  2F7D A;  4MSX A;  3B79 A;  2DZZ A;  3K9M A;  1U5I A;  1AYV A;  2NQA A;  4MM3 B;  3NHE A;  1BGO A;  3HD3 A;  4XR7 A;  4BOS A;  2DJF B;  2GHU A;  3D6S A;  2DOS A;  4XZX A;  5PAD A;  4GUA A;  4IUM A;  4N8W A;  1NQC A;  3N3G A;  3CH3 X;  2R9C A;  1SP4 B;  1U9X A;  9PAP A;  2JRI A;  2DCB A;  3BPF A;  3PRP A;  4FIP A;  4YYQ A;  1YAL A;  3OF9 A;  1F2B A;  1EWP A;  4BS5 A;  1GCB A;  2DCC A;  1AIM A;  3KFQ A;  5EZQ A;  2G8E A;  4I04 A;  4N4Z A;  3IMA A;  1O0E A;  1XKG A;  1AU4 A;  3TMP A;  1EWL A;  1PXV A;  2E01 A;  4RY2 A;  3B21 A;  4W5B A;  2NQD B;  5CHV A;  1ITO A;  1CPJ A;  3U8E A;  2R6N A;  1M6D A;  2P0R A;  3DF0 A;  4QRV A;  3QT4 A;  3CH2 X;  2O6X A;  1CB5 A;  4YYU A;  1DEU A;  2IPP B;  2GFO A;  4YYR A;  1KHP A;  1AU0 A;  2YJC A;  2PNS A;  4G54 A;  1PPD A;  2PBH A;  4WUR A;  3M99 A;  3WXG A;  2AU1 A;  4P6E A;  2YJ9 A;  3ZNH A;  2NQI A;  1CJL A;  3P5X A;  5EF4 A;  1CSB B;  1PPO A;  1GEC E;  3PDF A;  3W30 A;  4A5U A;  2Y6E A;  1CVZ A;  1SNK A;  4QRG A;  3E9S A;  4YV8 A;  3OQC A;  4AXM A;  1ZIV A;  1STF E;  3V6E A;  4I05 A;  1PBH A;  6PAD A;  3P5V A;  2BU3 A;  4R3D A;  2DC6 A;  3KWZ A;  3HHI A;  2VHF A;  1IWD A;  3N3K A;  3KKU A;  1CTE A;  4MZO A;  1HUC B;  1Q6K A;  2HWK A;  4FK5 A;  1PVJ A;  2G7Y A;  4RNA A;  4YYV A;  2XU4 A;  3H8B A;  4RF0 A;  3IOQ A;  2DC7 A;  2AGA A;  1JQP A;  4AXL A;  3GCB A;  2H7J A;  2BTW A;  1YK8 A;  3I06 A;  2Y5B A;  4PP1 A;  2Z84 A;  1TU6 A;  3PBH A;  2R9M A;  3HWN A;  1TL9 A;  1CS8 A;  1U9Q X;  2OZ2 A;  3BY4 A;  2E02 A;  2UZJ A;  1AYU A;  1KFU L;  2ARY A;  3BOW A;  2AUX A;  4OVZ B;  1MEM A;  3TNX A;  1YK7 A;  1UKF A;  3IUT A;  4OEL A;  3V6C A;  1PIP A;  1QXP A;  2HXZ A;  3ERV A;  2DZY A;  2C0Y A;  2R9O A;  3OIS A;  1KXR A;  3HHA A;  3K8U A;  3IEJ A;  1MDW A;  5K16 A;  5CVM A;  1NB3 A;  3OVX A;  3ZUA A;  3PRM A;  4BOQ A;  1MEG A;  3RVX A;  2P86 A;  5EGW A;  3WXF A;  3QSD A;  2FO5 A;  4IP3 A;  1EWO A;  1S4V A;  4BOP A;  2HD5 A;  5F02 A;  1Y08 A;  3IFU A;  2YJB A;  2BDL A;  2G8J A;  2JTC A;  2XU3 A;  3N4C A;  1VSN A;  3F75 A;  2F1G A;  1NLJ A;  4P16 A;  2E03 A;  5EZS A;  3O0U A;  1X9Y A;  2E00 A;  3BPM A;  4DMX A;  1VJV A;  3OVZ A;  1BQI A;  3PHX A;  2CIO A;  1QMY A;  2J7Q C;  3PNR A;  5FPW A;  1ICF A;  5JH3 A;  5E6J A;  1CQD A;  4XUI A;  4M0W A;  3H89 A;  1PCI A;  4REZ A;  2NQG A;  1YVB A;  1ME4 A;  4OVZ A;  1YZB A;  1TLO A;  3E1Z B;  4N79 A;  4YVA A;  2HH5 A;  1PE6 A;  2P7U A;  4QRX A;  4D8I A;  1U9W A;  3LXS A;  1A6R A;  4ZTB A;  1FH0 A;  5JA7 A;  1Y4H A;  1KFX L;  1NL6 A;  2FUD A;  3KWB X;  2DC8 A;  2CB5 A;  4QH6 A;  2ACT A;  1F29 A;  4RF1 A;  4RKX A;  1ZCM A;  4X6I A;  3PSE A;  3BB7 A;  4P6G A;  2FYE A;  2YJ8 A;  2DCA A;  4X6H A;  4BS6 A;  2ATO A;  4QBB A;  3MHS A;  2R9N A;  1KHQ A;  1GLO A;  3KW9 A;  2BDZ A;  4ZUX U;  2JQG R;  7PCK A;  4OW0 A;  1POP A;  4D8B A;  2XU1 A;  1PAD A; 
#chains in the Genus database with same CATH homology
 1AEC A;  2DCD A;  5CVO B;  4W4U A;  3F5V A;  3S3R A;  4FJC A;  1PPP A;  2G6D A;  1THE A;  3RVV A;  2OUL A;  3BCN A;  3LFY A;  2VHS A;  1PPN A;  2XU5 A;  2AVW A;  1BY8 A;  1BP4 A;  4K7C A;  2BSZ A;  4WA6 A;  4I07 A;  5CVN B;  4CZW A;  3MOR A;  3OF8 A;  2OP3 A;  4Q8H A;  3K24 A;  1GMY A;  3H6S A;  3AI8 A;  1MS6 A;  4CDF B;  3S3Q A;  3RVW A;  1EF7 A;  1ATK A;  5A24 A;  2R9F A;  5CHT A;  4CDE B;  2AUZ A;  3MTN A;  4KLB A;  1MIR A;  2WBF X;  1NB5 A;  2PAD A;  3PW3 A;  3H7D A;  2FT2 A;  4Q8G A;  3QJ3 A;  1K3B B;  1QDQ A;  3P5U A;  1W4T A;  4PP2 E;  2AYN A;  2HHN A;  4NV7 A;  2FRA A;  5J94 A;  4OEM A;  3O1G A;  2DJG B;  2PRE A;  1AU3 A;  2FTD A;  3IV2 A;  4BPV A;  4DMY A;  3LTW A;  4MZS A;  1U9V A;  1F2A A;  4CDD B;  1ME3 A;  2IBI A;  3CBK A;  1YT7 A;  3I3T A;  3WXE A;  8PCH A;  4PAD A;  2AS8 A;  2AYO A;  1QOL A;  4YYS A;  1EWM A;  4HWY A;  2B1M A;  3KSE A;  3BWK A;  3IHP A;  4BSQ A;  1E2T A;  2AIM A;  4X6J A;  4PI3 A;  2FQ9 A;  2JQF R;  3KX1 A;  2B1N A;  3CBJ A;  2DC9 A;  3P5W A;  1AU2 A;  4BQV A;  3BC3 A;  4W5C A;  3USV A;  1CV8 A;  4CDC B;  1DF0 A;  1MHW A;  2YJ2 A;  3C9E A;  2FRQ A;  1AYW A;  1F2C A;  3MHH A;  3H8C A;  4YYW A;  1NPZ A;  2F7D A;  4MSX A;  3B79 A;  2DZZ A;  3K9M A;  1U5I A;  1AYV A;  2NQA A;  3NHE A;  1BGO A;  3HD3 A;  4XR7 A;  2DJF B;  2GHU A;  3D6S A;  5PAD A;  4N8W A;  1NQC A;  3N3G A;  3CH3 X;  1W6F A;  2R9C A;  1SP4 B;  1U9X A;  9PAP A;  2DCB A;  3BPF A;  4FIP A;  4YYQ A;  1YAL A;  3OF9 A;  1F2B A;  1EWP A;  4BS5 A;  1GCB A;  2DCC A;  1AIM A;  3KFQ A;  2G8E A;  4I04 A;  4N4Z A;  3IMA A;  1O0E A;  1XKG A;  2VFC A;  1AU4 A;  1EWL A;  1PXV A;  2E01 A;  4RY2 A;  4W5B A;  2NQD B;  5CHV A;  1ITO A;  1CPJ A;  3U8E A;  2R6N A;  1M6D A;  2P0R A;  3DF0 A;  4QRV A;  3QT4 A;  3CH2 X;  2O6X A;  1CB5 A;  4YYU A;  1DEU A;  2IPP B;  2GFO A;  4YYR A;  1KHP A;  1AU0 A;  2YJC A;  2PNS A;  4G54 A;  1PPD A;  2PBH A;  3WXG A;  3M99 A;  4B55 A;  2AU1 A;  4P6E A;  2YJ9 A;  2NQI A;  1CJL A;  3P5X A;  5EF4 A;  1CSB B;  1PPO A;  1GEC E;  4BGF A;  3PDF A;  2Y6E A;  1CVZ A;  1SNK A;  4QRG A;  4YV8 A;  4AXM A;  1ZIV A;  1STF E;  3V6E A;  4I05 A;  1PBH A;  6PAD A;  3P5V A;  2DC6 A;  3KWZ A;  3HHI A;  2VHF A;  1IWD A;  3N3K A;  3KKU A;  1CTE A;  4MZO A;  1HUC B;  1Q6K A;  4FK5 A;  4GUZ A;  2G7Y A;  4YYV A;  2XU4 A;  3H8B A;  3IOQ A;  2DC7 A;  1JQP A;  4AXL A;  3GCB A;  2H7J A;  1YK8 A;  3I06 A;  2Y5B A;  4PP1 A;  3PBH A;  1TU6 A;  4C5P A;  2R9M A;  3HWN A;  1TL9 A;  1CS8 A;  1U9Q X;  2OZ2 A;  2E02 A;  1AYU A;  1KFU L;  2ARY A;  3BOW A;  2AUX A;  1MEM A;  3TNX A;  1YK7 A;  3IUT A;  4OEL A;  3V6C A;  1PIP A;  1QXP A;  2HXZ A;  3ERV A;  2DZY A;  2C0Y A;  2R9O A;  3OIS A;  1KXR A;  3HHA A;  3K8U A;  3IEJ A;  1MDW A;  5K16 A;  5CVM A;  1NB3 A;  3OVX A;  3ZUA A;  4NV8 A;  1MEG A;  3RVX A;  2P86 A;  5EGW A;  3WXF A;  3QSD A;  2FO5 A;  1EWO A;  1S4V A;  2HD5 A;  5F02 A;  1Y08 A;  2YJB A;  2BDL A;  2G8J A;  2XU3 A;  3N4C A;  1VSN A;  3F75 A;  2F1G A;  1NLJ A;  2E03 A;  3O0U A;  1X9Y A;  2E00 A;  3BPM A;  4DMX A;  1VJV A;  3OVZ A;  1BQI A;  2CIO A;  1QMY A;  3PNR A;  5FPW A;  1ICF A;  5JH3 A;  1CQD A;  4XUI A;  3H89 A;  1PCI A;  2NQG A;  1YVB A;  1ME4 A;  1TLO A;  3E1Z B;  4N79 A;  4YVA A;  2HH5 A;  1PE6 A;  2P7U A;  4QRX A;  1U9W A;  3LXS A;  1A6R A;  1FH0 A;  1GX3 A;  5JA7 A;  1Y4H A;  1KFX L;  1NL6 A;  3D9W A;  2FUD A;  3KWB X;  2DC8 A;  2CB5 A;  4QH6 A;  2ACT A;  1F29 A;  1ZCM A;  4X6I A;  2VFB A;  4P6G A;  2FYE A;  2YJ8 A;  2DCA A;  4X6H A;  4BS6 A;  2ATO A;  4QBB A;  3MHS A;  2R9N A;  1W5R A;  1KHQ A;  1GLO A;  3KW9 A;  2BDZ A;  4ZUX U;  2JQG R;  7PCK A;  1POP A;  2XU1 A;  1PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...