1PPDA

Restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restrained Least-Squares Refinement of the Sulfhydryl Protease Papain to 2.0 Angstroms
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
molecule keywords 2-HYDROXYETHYL-THIOPAPAIN
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1984-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppdA00
1DEUA 4X6JA 5EF4A 3OVXA 1QOLA 4YYSA 4QRVA 1AYVA 4W4UA 8PCHA 3H6SA 3MHHA 1F29A 3P5UA 3PNRA 1EF7A 3IOQA 5K16A 1ITOA 3HHIA 3PBHA 1KFUL 1PPDA 3AI8A 1PE6A 2ARYA 3K8UA 1MHWA 2E03A 1PCIA 1U9XA 3KWBX 2ACTA 3H8CA 3N3KA 2G6DA 3E1ZB 4DMXA 3K24A 1U9WA 3N3GA 1K3BB 3BCNA 1TL9A 1Y4HA 4W5CA 1F2BA 3ZUAA 1KHPA 2FQ9A 1U9VA 3LFYA 4G54A 3H89A 3OVZA 3OISA 2FUDA 2AVWA 1PPPA 5CVMA 2R9OA 3WXFA 3O1GA 2AUZA 4BSQA 4AXLA 4N8WA 3IEJA 3V6CA 5JH3A 1STFE 4YYRA 2DCDA 1PPOA 2CB5A 1S4VA 7PCKA 1YT7A 1KXRA 1CTEA 3N4CA 2R6NA 1MEMA 3CBKA 2DC8A 3RVWA 4QBBA 3BC3A 3IHPA 3MHSA 2AU1A 1Q6KA 2P0RA 1VSNA 1SP4B 3O0UA 2AYOA 1CSBB 2ATOA 5CHVA 2FRAA 1PADA 2B1MA 5CHTA 4BS6A 3CH3X 2AUXA 2JQGR 1BY8A 1PBHA 2F7DA 2NQGA 1AIMA 4BQVA 1ME4A 2YJ8A 4YV8A 4KLBA 4K7CA 2B1NA 1TLOA 5PADA 3HHAA 1QMYA 1DF0A 5FPWA 1CS8A 5CVOB 1AU2A 3B79A 2FYEA 4XUIA 3MTNA 2BDZA 9PAPA 2IPPB 2GFOA 2OULA 4AXMA 2OZ2A 1NLJA 1XKGA 2YJCA 1ATKA 4RY2A 4CDFB 2DZZA 1F2AA 1ICFA 3RVXA 4YYUA 3U8EA 1NQCA 3BOWA 2HD5A 2NQAA 2Y6EA 4CDDB 1CJLA 3KFQA 2Y5BA 2FTDA 3PDFA 3V6EA 3OF9A 2WBFX 1ME3A 2BDLA 4YYWA 1BGOA 2G8EA 2YJ2A 1YVBA 1EWMA 1NB5A 1NB3A 3KSEA 2GHUA 2XU3A 3F5VA 2DC6A 2H7JA 4QH6A 2NQDB 4PP1A 3BPFA 1U5IA 2AYNA 2JQFR 2P7UA 3TNXA 1CV8A 2FRQA 3HWNA 1YK8A 1ZIVA 1NL6A 2PBHA 3P5XA 1FH0A 1MEGA 3P5WA 3DF0A 2PREA 3D6SA 2DJFB 1QXPA 2CIOA 4I04A 4BPVA 1GCBA 4I07A 4OELA 3M99A 3KWZA 3USVA 1GMYA 4HWYA 1AU4A 1QDQA 2DC9A 3IV2A 3OF8A 1O0EA 1X9YA 3I3TA 3QSDA 3H7DA 3KKUA 1EWOA 4PI3A 4W5BA 4I05A 3PW3A 1EWLA 2DC7A 2FT2A 2HH5A 1NPZA 3BWKA 2VHSA 4CDCB 1CPJA 4N79A 2XU5A 3K9MA 3C9EA 4PP2E 1AU0A 4YYVA 1TU6A 1THEA 5J94A 1MS6A 4FK5A 4PADA 1AYUA 2VHFA 2R9NA 2YJ9A 1SNKA 3NHEA 3P5VA 2R9MA 1CVZA 2XU1A 1A6RA 4ZUXU 4YVAA 3QT4A 1PIPA 5JA7A 1GLOA 1POPA 3MORA 4CZWA 1PXVA 3WXGA 3CH2X 2DZYA 1CQDA 1YK7A 1U9QX 5CVNB 1YALA 4Q8GA 1GECE 6PADA 4OEMA 1BQIA 1Y08A 1AYWA 1AECA 1EWPA 1KFXL 3ERVA 1ZCMA 5F02A 3F75A 1M6DA 4YYQA 3HD3A 5A24A 4DMYA 4X6IA 1HUCB 2E02A 4N4ZA 2PADA 4WA6A 2O6XA 3IMAA 4FJCA 2FO5A 3QJ3A 4QRXA 1IWDA 1JQPA 2NQIA 2G8JA 2R9FA 3CBJA 4Q8HA 2DCCA 2PNSA 4XR7A 3KW9A 1VJVA 3S3QA 2F1GA 3BPMA 1BP4A 4FIPA 2HXZA 4MSXA 2XU4A 1AU3A 2AS8A 4P6EA 4P6GA 1MIRA 2DCAA 3S3RA 3GCBA 3LXSA 4X6HA 3WXEA 2DJGB 3IUTA 4CDEB 1CB5A 2P86A 2YJBA 3I06A 2DCBA 1MDWA 3KX1A 1PPNA 2AIMA 1F2CA 2IBIA 4MZOA 5EGWA 2R9CA 2G7YA 4MZSA 2E01A 3RVVA 2E00A 2OP3A 4BS5A 1KHQA 4QRGA 2C0YA 2HHNA 3H8BA
chains in the Genus database with same CATH superfamily
1DEUA 4X6JA 5EF4A 3OVXA 1QOLA 4YYSA 4QRVA 1AYVA 4W4UA 8PCHA 3H6SA 3MHHA 1F29A 3ZNHA 3P5UA 4OVZB 3PNRA 4BOPA 1EF7A 3IOQA 3BBAA 5K16A 3MTVA 4R3DA 5EZQA 1ITOA 3HHIA 3PBHA 1KFUL 1PPDA 3AI8A 1PE6A 2ARYA 4ZTBA 3K8UA 1MHWA 2E03A 1PCIA 1U9XA 2BTWB 3KWBX 2Z84A 4RF0A 2ACTA 3H8CA 3N3KA 2G6DA 3E1ZB 4DMXA 4D8BA 3K24A 1U9WA 3N3GA 1K3BB 1UKFA 3BCNA 1TL9A 1Y4HA 4W5CA 1F2BA 3ZUAA 1KHPA 2FQ9A 1U9VA 3LFYA 4G54A 3H89A 3OVZA 3OISA 4WURA 2FUDA 3B21A 2AVWA 2JTCA 1PPPA 5CVMA 2R9OA 3WXFA 3O1GA 4D8IA 1DKIA 2AUZA 4BSQA 4AXLA 4N8WA 3IEJA 3V6CA 5JH3A 1STFE 3W31A 2BU3A 4YYRA 2DCDA 1PPOA 2CB5A 1S4VA 7PCKA 1YT7A 1KXRA 1CTEA 3N4CA 2R6NA 1MEMA 3CBKA 2DC8A 3RVWA 4QBBA 4BOSA 3MHSA 3BC3A 3IHPA 2AU1A 1Q6KA 2P0RA 1VSNA 1SP4B 3O0UA 2AYOA 1CSBB 2ATOA 5CHVA 3IFUA 2FRAA 1PADA 2B1MA 5CHTA 4BS6A 3CH3X 2AUXA 2JQGR 1BY8A 2DOSA 3O65A 1PBHA 2F7DA 4MI7A 2NQGA 1AIMA 4BQVA 1ME4A 3TMPA 2YJ8A 4YV8A 2JRIA 4IUMA 4KLBA 4K7CA 2B1NA 4IP3A 1TLOA 5PADA 3HHAA 1QMYA 1DF0A 5FPWA 1CS8A 4OW0A 5CVOB 1AU2A 3B79A 2FYEA 4XUIA 3MTNA 2BDZA 9PAPA 2IPPB 2GFOA 2OULA 4AXMA 2OZ2A 1NLJA 1XKGA 2AGAA 2YJCA 1ATKA 4RY2A 4CDFB 2DZZA 1F2AA 1ICFA 3RVXA 4YYUA 3U8EA 1NQCA 3BOWA 2HD5A 2NQAA 2Y6EA 4CDDB 5E6JA 1CJLA 3KFQA 2Y5BA 2FTDA 3PDFA 3V6EA 3OF9A 2WBFX 1ME3A 2BDLA 4YYWA 1BGOA 2G8EA 2YJ2A 1YVBA 1EWMA 1NB5A 1NB3A 3KSEA 2GHUA 2HWKA 2XU3A 3F5VA 2DC6A 2H7JA 4QH6A 2NQDB 4PP1A 3E9SA 3BPFA 3C0RA 1U5IA 2AYNA 2JQFR 2P7UA 3TNXA 1CV8A 2FRQA 3HWNA 1YK8A 1ZIVA 1NL6A 2PBHA 3P5XA 1FH0A 3PRPA 1MEGA 3P5WA 3DF0A 2PREA 3D6SA 2DJFB 1QXPA 2CIOA 4I04A 4BOUA 4BPVA 1GCBA 4I07A 4OELA 3M99A 4M0WA 4BOQA 3KWZA 4REZA 3USVA 5JZEA 1GMYA 4HXDB 4HWYA 1AU4A 1QDQA 2DC9A 3IV2A 3OF8A 1O0EA 1X9YA 3I3TA 3QSDA 3H7DA 3PSEA 3RNVA 3KKUA 1EWOA 4PI3A 4W5BA 4I05A 3PW3A 1EWLA 4GUAA 2DC7A 2FT2A 2HH5A 1NPZA 3BWKA 2VHSA 4CDCB 1CPJA 4N79A 2XU5A 3K9MA 4RKXA 3C9EA 4PP2E 1AU0A 3BY4A 4YYVA 1TU6A 1THEA 5J94A 4P16A 1MS6A 4FK5A 4PADA 1AYUA 2FE8A 2VHFA 2R9NA 3PT2A 5EZSA 2YJ9A 1SNKA 3NHEA 2J7QC 3P5VA 2R9MA 1CVZA 5KO3A 2XU1A 3OQCA 1A6RA 3PHWA 4ZUXU 4YVAA 3QT4A 1PIPA 5JA7A 1GLOA 1PVJA 1POPA 3MORA 4CZWA 1PXVA 3WXGA 2J7QA 3CH2X 4XZXA 3W30A 2DZYA 1CQDA 1YK7A 1U9QX 5CVNB 1YALA 4Q8GA 1GECE 6PADA 4OEMA 1BQIA 1Y08A 3TRKA 1AYWA 1AECA 1EWPA 1KFXL 3ERVA 1ZCMA 5F02A 3F75A 1M6DA 4YYQA 3BB7A 3HD3A 5A24A 4DMYA 3MP2A 4X6IA 1YZBA 1HUCB 4A5UA 2E02A 4N4ZA 2PADA 4WA6A 2O6XA 3IMAA 4FJCA 2FO5A 3QJ3A 4QRXA 1IWDA 1JQPA 2NQIA 3PHUA 2G8JA 2R9FA 3CBJA 4Q8HA 4PT5A 2DCCA 3MJ5A 2PNSA 4XR7A 3KW9A 1VJVA 3S3QA 4OVZA 2F1GA 3BPMA 1BP4A 3PRMA 4FIPA 4BOZA 2HXZA 2UZJA 4MSXA 2XU4A 1AU3A 2AS8A 4P6EA 4P6GA 1MIRA 2DCAA 3S3RA 3GCBA 3LXSA 4MM3B 4X6HA 3WXEA 2DJGB 3IUTA 4CDEB 1CB5A 2P86A 2YJBA 3I06A 2DCBA 1MDWA 3KX1A 1PPNA 2AIMA 3PHXA 1F2CA 2IBIA 4MZOA 5EGWA 2BTWA 4RF1A 2R9CA 2G7YA 4MZSA 2E01A 3RVVA 2E00A 2OP3A 4RNAA 1KHQA 4BS5A 4QRGA 4D8EA 2C0YA 2HHNA 3H8BA
chains in the Genus database with same CATH topology
1DEUA 4X6JA 5EF4A 3OVXA 1QOLA 4YYSA 4QRVA 1AYVA 4W4UA 8PCHA 3H6SA 3MHHA 1F29A 3P5UA 3PNRA 1EF7A 3IOQA 5K16A 1ITOA 3HHIA 3PBHA 1KFUL 1PPDA 3AI8A 1PE6A 2ARYA 3K8UA 1MHWA 2E03A 1PCIA 1U9XA 4C5PA 3KWBX 2ACTA 3H8CA 3N3KA 2G6DA 3E1ZB 4DMXA 3K24A 1U9WA 3N3GA 1K3BB 3BCNA 1TL9A 1Y4HA 4W5CA 1F2BA 3ZUAA 1KHPA 2FQ9A 2BSZA 1U9VA 3LFYA 4G54A 3H89A 3OVZA 3OISA 2FUDA 2AVWA 1PPPA 5CVMA 2R9OA 3WXFA 3O1GA 2AUZA 4BSQA 4AXLA 4N8WA 3IEJA 3V6CA 5JH3A 1STFE 4YYRA 2VFBA 2DCDA 1PPOA 2CB5A 1S4VA 7PCKA 1YT7A 1KXRA 1CTEA 3N4CA 2R6NA 4GUZA 1MEMA 3CBKA 2DC8A 3LTWA 3RVWA 4QBBA 3BC3A 2VFCA 3IHPA 3MHSA 2AU1A 1Q6KA 2P0RA 1VSNA 1SP4B 3O0UA 2AYOA 1CSBB 2ATOA 5CHVA 2FRAA 1PADA 2B1MA 5CHTA 4BS6A 3CH3X 2AUXA 2JQGR 1BY8A 1PBHA 2F7DA 4NV7A 2NQGA 1AIMA 1E2TA 4BQVA 1ME4A 2YJ8A 4YV8A 4KLBA 4K7CA 2B1NA 1TLOA 5PADA 3HHAA 1QMYA 1DF0A 5FPWA 1CS8A 5CVOB 1AU2A 3B79A 2FYEA 4XUIA 3MTNA 2BDZA 9PAPA 2IPPB 2GFOA 2OULA 4AXMA 2OZ2A 1NLJA 1XKGA 2YJCA 1ATKA 4RY2A 4CDFB 2DZZA 1F2AA 1ICFA 3RVXA 4YYUA 3U8EA 1NQCA 3BOWA 2HD5A 2NQAA 2Y6EA 4CDDB 3D9WA 1CJLA 3KFQA 2Y5BA 2FTDA 3PDFA 3V6EA 3OF9A 2WBFX 1ME3A 2BDLA 4YYWA 1BGOA 2G8EA 2YJ2A 1YVBA 1EWMA 1NB5A 1NB3A 3KSEA 1W4TA 2GHUA 2XU3A 3F5VA 2DC6A 2H7JA 4QH6A 2NQDB 4PP1A 3BPFA 1U5IA 2AYNA 2JQFR 2P7UA 3TNXA 1CV8A 2FRQA 3HWNA 1YK8A 1ZIVA 1NL6A 2PBHA 3P5XA 1FH0A 1MEGA 3P5WA 3DF0A 2PREA 3D6SA 2DJFB 1QXPA 4NV8A 2CIOA 4I04A 4BPVA 1GCBA 4I07A 4OELA 3M99A 3KWZA 3USVA 1GMYA 4HWYA 1AU4A 1QDQA 2DC9A 3IV2A 3OF8A 1O0EA 1X9YA 3I3TA 3QSDA 3H7DA 3KKUA 1EWOA 4PI3A 4W5BA 4I05A 3PW3A 1EWLA 2DC7A 2FT2A 2HH5A 1NPZA 3BWKA 2VHSA 4CDCB 1CPJA 4N79A 2XU5A 3K9MA 3C9EA 4PP2E 1AU0A 4YYVA 1TU6A 1THEA 5J94A 1MS6A 4FK5A 4PADA 1AYUA 2VHFA 2R9NA 2YJ9A 1SNKA 3NHEA 4B55A 3P5VA 2R9MA 1CVZA 2XU1A 1A6RA 4ZUXU 4YVAA 3QT4A 1PIPA 5JA7A 1GLOA 1POPA 3MORA 4CZWA 1PXVA 3WXGA 3CH2X 2DZYA 1CQDA 1YK7A 1U9QX 5CVNB 1YALA 4Q8GA 1GECE 6PADA 4OEMA 1BQIA 1Y08A 4BGFA 1AYWA 1AECA 1EWPA 1KFXL 3ERVA 1ZCMA 5F02A 3F75A 1M6DA 4YYQA 3HD3A 5A24A 1W5RA 4DMYA 4X6IA 1HUCB 2E02A 4N4ZA 2PADA 4WA6A 2O6XA 3IMAA 4FJCA 2FO5A 3QJ3A 4QRXA 1IWDA 1JQPA 2NQIA 2G8JA 2R9FA 3CBJA 4Q8HA 2DCCA 2PNSA 4XR7A 3KW9A 1VJVA 3S3QA 2F1GA 3BPMA 1BP4A 4FIPA 2HXZA 4MSXA 2XU4A 1AU3A 2AS8A 4P6EA 4P6GA 1MIRA 2DCAA 3S3RA 3GCBA 3LXSA 4X6HA 3WXEA 2DJGB 3IUTA 4CDEB 1CB5A 2P86A 2YJBA 3I06A 2DCBA 1MDWA 3KX1A 1PPNA 2AIMA 1GX3A 1F2CA 2IBIA 4MZOA 5EGWA 2R9CA 2G7YA 1W6FA 4MZSA 2E01A 3RVVA 2E00A 2OP3A 4BS5A 1KHQA 4QRGA 2C0YA 2HHNA 3H8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEU A;  4X6J A;  5EF4 A;  3OVX A;  1QOL A;  4YYS A;  4QRV A;  1AYV A;  4W4U A;  8PCH A;  3H6S A;  3MHH A;  1F29 A;  3P5U A;  3PNR A;  1EF7 A;  3IOQ A;  5K16 A;  1ITO A;  3HHI A;  3PBH A;  1KFU L;  1PPD A;  3AI8 A;  1PE6 A;  2ARY A;  3K8U A;  1MHW A;  2E03 A;  1PCI A;  1U9X A;  3KWB X;  2ACT A;  3H8C A;  3N3K A;  2G6D A;  3E1Z B;  4DMX A;  3K24 A;  1U9W A;  3N3G A;  1K3B B;  3BCN A;  1TL9 A;  1Y4H A;  4W5C A;  1F2B A;  3ZUA A;  1KHP A;  2FQ9 A;  1U9V A;  3LFY A;  4G54 A;  3H89 A;  3OVZ A;  3OIS A;  2FUD A;  2AVW A;  1PPP A;  5CVM A;  2R9O A;  3WXF A;  3O1G A;  2AUZ A;  4BSQ A;  4AXL A;  4N8W A;  3IEJ A;  3V6C A;  5JH3 A;  1STF E;  4YYR A;  2DCD A;  1PPO A;  2CB5 A;  1S4V A;  7PCK A;  1YT7 A;  1KXR A;  1CTE A;  3N4C A;  2R6N A;  1MEM A;  3CBK A;  2DC8 A;  3RVW A;  4QBB A;  3BC3 A;  3IHP A;  3MHS A;  2AU1 A;  1Q6K A;  2P0R A;  1VSN A;  1SP4 B;  3O0U A;  2AYO A;  1CSB B;  2ATO A;  5CHV A;  2FRA A;  1PAD A;  2B1M A;  5CHT A;  4BS6 A;  3CH3 X;  2AUX A;  2JQG R;  1BY8 A;  1PBH A;  2F7D A;  2NQG A;  1AIM A;  4BQV A;  1ME4 A;  2YJ8 A;  4YV8 A;  4KLB A;  4K7C A;  2B1N A;  1TLO A;  5PAD A;  3HHA A;  1QMY A;  1DF0 A;  5FPW A;  1CS8 A;  5CVO B;  1AU2 A;  3B79 A;  2FYE A;  4XUI A;  3MTN A;  2BDZ A;  9PAP A;  2IPP B;  2GFO A;  2OUL A;  4AXM A;  2OZ2 A;  1NLJ A;  1XKG A;  2YJC A;  1ATK A;  4RY2 A;  4CDF B;  2DZZ A;  1F2A A;  1ICF A;  3RVX A;  4YYU A;  3U8E A;  1NQC A;  3BOW A;  2HD5 A;  2NQA A;  2Y6E A;  4CDD B;  1CJL A;  3KFQ A;  2Y5B A;  2FTD A;  3PDF A;  3V6E A;  3OF9 A;  2WBF X;  1ME3 A;  2BDL A;  4YYW A;  1BGO A;  2G8E A;  2YJ2 A;  1YVB A;  1EWM A;  1NB5 A;  1NB3 A;  3KSE A;  2GHU A;  2XU3 A;  3F5V A;  2DC6 A;  2H7J A;  4QH6 A;  2NQD B;  4PP1 A;  3BPF A;  1U5I A;  2AYN A;  2JQF R;  2P7U A;  3TNX A;  1CV8 A;  2FRQ A;  3HWN A;  1YK8 A;  1ZIV A;  1NL6 A;  2PBH A;  3P5X A;  1FH0 A;  1MEG A;  3P5W A;  3DF0 A;  2PRE A;  3D6S A;  2DJF B;  1QXP A;  2CIO A;  4I04 A;  4BPV A;  1GCB A;  4I07 A;  4OEL A;  3M99 A;  3KWZ A;  3USV A;  1GMY A;  4HWY A;  1AU4 A;  1QDQ A;  2DC9 A;  3IV2 A;  3OF8 A;  1O0E A;  1X9Y A;  3I3T A;  3QSD A;  3H7D A;  3KKU A;  1EWO A;  4PI3 A;  4W5B A;  4I05 A;  3PW3 A;  1EWL A;  2DC7 A;  2FT2 A;  2HH5 A;  1NPZ A;  3BWK A;  2VHS A;  4CDC B;  1CPJ A;  4N79 A;  2XU5 A;  3K9M A;  3C9E A;  4PP2 E;  1AU0 A;  4YYV A;  1TU6 A;  1THE A;  5J94 A;  1MS6 A;  4FK5 A;  4PAD A;  1AYU A;  2VHF A;  2R9N A;  2YJ9 A;  1SNK A;  3NHE A;  3P5V A;  2R9M A;  1CVZ A;  2XU1 A;  1A6R A;  4ZUX U;  4YVA A;  3QT4 A;  1PIP A;  5JA7 A;  1GLO A;  1POP A;  3MOR A;  4CZW A;  1PXV A;  3WXG A;  3CH2 X;  2DZY A;  1CQD A;  1YK7 A;  1U9Q X;  5CVN B;  1YAL A;  4Q8G A;  1GEC E;  6PAD A;  4OEM A;  1BQI A;  1Y08 A;  1AYW A;  1AEC A;  1EWP A;  1KFX L;  3ERV A;  1ZCM A;  5F02 A;  3F75 A;  1M6D A;  4YYQ A;  3HD3 A;  5A24 A;  4DMY A;  4X6I A;  1HUC B;  2E02 A;  4N4Z A;  2PAD A;  4WA6 A;  2O6X A;  3IMA A;  4FJC A;  2FO5 A;  3QJ3 A;  4QRX A;  1IWD A;  1JQP A;  2NQI A;  2G8J A;  2R9F A;  3CBJ A;  4Q8H A;  2DCC A;  2PNS A;  4XR7 A;  3KW9 A;  1VJV A;  3S3Q A;  2F1G A;  3BPM A;  1BP4 A;  4FIP A;  2HXZ A;  4MSX A;  2XU4 A;  1AU3 A;  2AS8 A;  4P6E A;  4P6G A;  1MIR A;  2DCA A;  3S3R A;  3GCB A;  3LXS A;  4X6H A;  3WXE A;  2DJG B;  3IUT A;  4CDE B;  1CB5 A;  2P86 A;  2YJB A;  3I06 A;  2DCB A;  1MDW A;  3KX1 A;  1PPN A;  2AIM A;  1F2C A;  2IBI A;  4MZO A;  5EGW A;  2R9C A;  2G7Y A;  4MZS A;  2E01 A;  3RVV A;  2E00 A;  2OP3 A;  4BS5 A;  1KHQ A;  4QRG A;  2C0Y A;  2HHN A;  3H8B A; 
#chains in the Genus database with same CATH topology
 1DEU A;  4X6J A;  5EF4 A;  3OVX A;  1QOL A;  4YYS A;  4QRV A;  1AYV A;  4W4U A;  8PCH A;  3H6S A;  3MHH A;  1F29 A;  3ZNH A;  3P5U A;  4OVZ B;  3PNR A;  4BOP A;  1EF7 A;  3IOQ A;  3BBA A;  5K16 A;  3MTV A;  4R3D A;  5EZQ A;  1ITO A;  3HHI A;  3PBH A;  1KFU L;  1PPD A;  3AI8 A;  1PE6 A;  2ARY A;  4ZTB A;  3K8U A;  1MHW A;  2E03 A;  1PCI A;  1U9X A;  2BTW B;  3KWB X;  2Z84 A;  4RF0 A;  2ACT A;  3H8C A;  3N3K A;  2G6D A;  3E1Z B;  4DMX A;  4D8B A;  3K24 A;  1U9W A;  3N3G A;  1K3B B;  1UKF A;  3BCN A;  1TL9 A;  1Y4H A;  4W5C A;  1F2B A;  3ZUA A;  1KHP A;  2FQ9 A;  1U9V A;  3LFY A;  4G54 A;  3H89 A;  3OVZ A;  3OIS A;  4WUR A;  2FUD A;  3B21 A;  2AVW A;  2JTC A;  1PPP A;  5CVM A;  2R9O A;  3WXF A;  3O1G A;  4D8I A;  1DKI A;  2AUZ A;  4BSQ A;  4AXL A;  4N8W A;  3IEJ A;  3V6C A;  5JH3 A;  1STF E;  3W31 A;  2BU3 A;  4YYR A;  2DCD A;  1PPO A;  2CB5 A;  1S4V A;  7PCK A;  1YT7 A;  1KXR A;  1CTE A;  3N4C A;  2R6N A;  1MEM A;  3CBK A;  2DC8 A;  3RVW A;  4QBB A;  4BOS A;  3MHS A;  3BC3 A;  3IHP A;  2AU1 A;  1Q6K A;  2P0R A;  1VSN A;  1SP4 B;  3O0U A;  2AYO A;  1CSB B;  2ATO A;  5CHV A;  3IFU A;  2FRA A;  1PAD A;  2B1M A;  5CHT A;  4BS6 A;  3CH3 X;  2AUX A;  2JQG R;  1BY8 A;  2DOS A;  3O65 A;  1PBH A;  2F7D A;  4MI7 A;  2NQG A;  1AIM A;  4BQV A;  1ME4 A;  3TMP A;  2YJ8 A;  4YV8 A;  2JRI A;  4IUM A;  4KLB A;  4K7C A;  2B1N A;  4IP3 A;  1TLO A;  5PAD A;  3HHA A;  1QMY A;  1DF0 A;  5FPW A;  1CS8 A;  4OW0 A;  5CVO B;  1AU2 A;  3B79 A;  2FYE A;  4XUI A;  3MTN A;  2BDZ A;  9PAP A;  2IPP B;  2GFO A;  2OUL A;  4AXM A;  2OZ2 A;  1NLJ A;  1XKG A;  2AGA A;  2YJC A;  1ATK A;  4RY2 A;  4CDF B;  2DZZ A;  1F2A A;  1ICF A;  3RVX A;  4YYU A;  3U8E A;  1NQC A;  3BOW A;  2HD5 A;  2NQA A;  2Y6E A;  4CDD B;  5E6J A;  1CJL A;  3KFQ A;  2Y5B A;  2FTD A;  3PDF A;  3V6E A;  3OF9 A;  2WBF X;  1ME3 A;  2BDL A;  4YYW A;  1BGO A;  2G8E A;  2YJ2 A;  1YVB A;  1EWM A;  1NB5 A;  1NB3 A;  3KSE A;  2GHU A;  2HWK A;  2XU3 A;  3F5V A;  2DC6 A;  2H7J A;  4QH6 A;  2NQD B;  4PP1 A;  3E9S A;  3BPF A;  3C0R A;  1U5I A;  2AYN A;  2JQF R;  2P7U A;  3TNX A;  1CV8 A;  2FRQ A;  3HWN A;  1YK8 A;  1ZIV A;  1NL6 A;  2PBH A;  3P5X A;  1FH0 A;  3PRP A;  1MEG A;  3P5W A;  3DF0 A;  2PRE A;  3D6S A;  2DJF B;  1QXP A;  2CIO A;  4I04 A;  4BOU A;  4BPV A;  1GCB A;  4I07 A;  4OEL A;  3M99 A;  4M0W A;  4BOQ A;  3KWZ A;  4REZ A;  3USV A;  5JZE A;  1GMY A;  4HXD B;  4HWY A;  1AU4 A;  1QDQ A;  2DC9 A;  3IV2 A;  3OF8 A;  1O0E A;  1X9Y A;  3I3T A;  3QSD A;  3H7D A;  3PSE A;  3RNV A;  3KKU A;  1EWO A;  4PI3 A;  4W5B A;  4I05 A;  3PW3 A;  1EWL A;  4GUA A;  2DC7 A;  2FT2 A;  2HH5 A;  1NPZ A;  3BWK A;  2VHS A;  4CDC B;  1CPJ A;  4N79 A;  2XU5 A;  3K9M A;  4RKX A;  3C9E A;  4PP2 E;  1AU0 A;  3BY4 A;  4YYV A;  1TU6 A;  1THE A;  5J94 A;  4P16 A;  1MS6 A;  4FK5 A;  4PAD A;  1AYU A;  2FE8 A;  2VHF A;  2R9N A;  3PT2 A;  5EZS A;  2YJ9 A;  1SNK A;  3NHE A;  2J7Q C;  3P5V A;  2R9M A;  1CVZ A;  5KO3 A;  2XU1 A;  3OQC A;  1A6R A;  3PHW A;  4ZUX U;  4YVA A;  3QT4 A;  1PIP A;  5JA7 A;  1GLO A;  1PVJ A;  1POP A;  3MOR A;  4CZW A;  1PXV A;  3WXG A;  2J7Q A;  3CH2 X;  4XZX A;  3W30 A;  2DZY A;  1CQD A;  1YK7 A;  1U9Q X;  5CVN B;  1YAL A;  4Q8G A;  1GEC E;  6PAD A;  4OEM A;  1BQI A;  1Y08 A;  3TRK A;  1AYW A;  1AEC A;  1EWP A;  1KFX L;  3ERV A;  1ZCM A;  5F02 A;  3F75 A;  1M6D A;  4YYQ A;  3BB7 A;  3HD3 A;  5A24 A;  4DMY A;  3MP2 A;  4X6I A;  1YZB A;  1HUC B;  4A5U A;  2E02 A;  4N4Z A;  2PAD A;  4WA6 A;  2O6X A;  3IMA A;  4FJC A;  2FO5 A;  3QJ3 A;  4QRX A;  1IWD A;  1JQP A;  2NQI A;  3PHU A;  2G8J A;  2R9F A;  3CBJ A;  4Q8H A;  4PT5 A;  2DCC A;  3MJ5 A;  2PNS A;  4XR7 A;  3KW9 A;  1VJV A;  3S3Q A;  4OVZ A;  2F1G A;  3BPM A;  1BP4 A;  3PRM A;  4FIP A;  4BOZ A;  2HXZ A;  2UZJ A;  4MSX A;  2XU4 A;  1AU3 A;  2AS8 A;  4P6E A;  4P6G A;  1MIR A;  2DCA A;  3S3R A;  3GCB A;  3LXS A;  4MM3 B;  4X6H A;  3WXE A;  2DJG B;  3IUT A;  4CDE B;  1CB5 A;  2P86 A;  2YJB A;  3I06 A;  2DCB A;  1MDW A;  3KX1 A;  1PPN A;  2AIM A;  3PHX A;  1F2C A;  2IBI A;  4MZO A;  5EGW A;  2BTW A;  4RF1 A;  2R9C A;  2G7Y A;  4MZS A;  2E01 A;  3RVV A;  2E00 A;  2OP3 A;  4RNA A;  1KHQ A;  4BS5 A;  4QRG A;  4D8E A;  2C0Y A;  2HHN A;  3H8B A; 
#chains in the Genus database with same CATH homology
 1DEU A;  4X6J A;  5EF4 A;  3OVX A;  1QOL A;  4YYS A;  4QRV A;  1AYV A;  4W4U A;  8PCH A;  3H6S A;  3MHH A;  1F29 A;  3P5U A;  3PNR A;  1EF7 A;  3IOQ A;  5K16 A;  1ITO A;  3HHI A;  3PBH A;  1KFU L;  1PPD A;  3AI8 A;  1PE6 A;  2ARY A;  3K8U A;  1MHW A;  2E03 A;  1PCI A;  1U9X A;  4C5P A;  3KWB X;  2ACT A;  3H8C A;  3N3K A;  2G6D A;  3E1Z B;  4DMX A;  3K24 A;  1U9W A;  3N3G A;  1K3B B;  3BCN A;  1TL9 A;  1Y4H A;  4W5C A;  1F2B A;  3ZUA A;  1KHP A;  2FQ9 A;  2BSZ A;  1U9V A;  3LFY A;  4G54 A;  3H89 A;  3OVZ A;  3OIS A;  2FUD A;  2AVW A;  1PPP A;  5CVM A;  2R9O A;  3WXF A;  3O1G A;  2AUZ A;  4BSQ A;  4AXL A;  4N8W A;  3IEJ A;  3V6C A;  5JH3 A;  1STF E;  4YYR A;  2VFB A;  2DCD A;  1PPO A;  2CB5 A;  1S4V A;  7PCK A;  1YT7 A;  1KXR A;  1CTE A;  3N4C A;  2R6N A;  4GUZ A;  1MEM A;  3CBK A;  2DC8 A;  3LTW A;  3RVW A;  4QBB A;  3BC3 A;  2VFC A;  3IHP A;  3MHS A;  2AU1 A;  1Q6K A;  2P0R A;  1VSN A;  1SP4 B;  3O0U A;  2AYO A;  1CSB B;  2ATO A;  5CHV A;  2FRA A;  1PAD A;  2B1M A;  5CHT A;  4BS6 A;  3CH3 X;  2AUX A;  2JQG R;  1BY8 A;  1PBH A;  2F7D A;  4NV7 A;  2NQG A;  1AIM A;  1E2T A;  4BQV A;  1ME4 A;  2YJ8 A;  4YV8 A;  4KLB A;  4K7C A;  2B1N A;  1TLO A;  5PAD A;  3HHA A;  1QMY A;  1DF0 A;  5FPW A;  1CS8 A;  5CVO B;  1AU2 A;  3B79 A;  2FYE A;  4XUI A;  3MTN A;  2BDZ A;  9PAP A;  2IPP B;  2GFO A;  2OUL A;  4AXM A;  2OZ2 A;  1NLJ A;  1XKG A;  2YJC A;  1ATK A;  4RY2 A;  4CDF B;  2DZZ A;  1F2A A;  1ICF A;  3RVX A;  4YYU A;  3U8E A;  1NQC A;  3BOW A;  2HD5 A;  2NQA A;  2Y6E A;  4CDD B;  3D9W A;  1CJL A;  3KFQ A;  2Y5B A;  2FTD A;  3PDF A;  3V6E A;  3OF9 A;  2WBF X;  1ME3 A;  2BDL A;  4YYW A;  1BGO A;  2G8E A;  2YJ2 A;  1YVB A;  1EWM A;  1NB5 A;  1NB3 A;  3KSE A;  1W4T A;  2GHU A;  2XU3 A;  3F5V A;  2DC6 A;  2H7J A;  4QH6 A;  2NQD B;  4PP1 A;  3BPF A;  1U5I A;  2AYN A;  2JQF R;  2P7U A;  3TNX A;  1CV8 A;  2FRQ A;  3HWN A;  1YK8 A;  1ZIV A;  1NL6 A;  2PBH A;  3P5X A;  1FH0 A;  1MEG A;  3P5W A;  3DF0 A;  2PRE A;  3D6S A;  2DJF B;  1QXP A;  4NV8 A;  2CIO A;  4I04 A;  4BPV A;  1GCB A;  4I07 A;  4OEL A;  3M99 A;  3KWZ A;  3USV A;  1GMY A;  4HWY A;  1AU4 A;  1QDQ A;  2DC9 A;  3IV2 A;  3OF8 A;  1O0E A;  1X9Y A;  3I3T A;  3QSD A;  3H7D A;  3KKU A;  1EWO A;  4PI3 A;  4W5B A;  4I05 A;  3PW3 A;  1EWL A;  2DC7 A;  2FT2 A;  2HH5 A;  1NPZ A;  3BWK A;  2VHS A;  4CDC B;  1CPJ A;  4N79 A;  2XU5 A;  3K9M A;  3C9E A;  4PP2 E;  1AU0 A;  4YYV A;  1TU6 A;  1THE A;  5J94 A;  1MS6 A;  4FK5 A;  4PAD A;  1AYU A;  2VHF A;  2R9N A;  2YJ9 A;  1SNK A;  3NHE A;  4B55 A;  3P5V A;  2R9M A;  1CVZ A;  2XU1 A;  1A6R A;  4ZUX U;  4YVA A;  3QT4 A;  1PIP A;  5JA7 A;  1GLO A;  1POP A;  3MOR A;  4CZW A;  1PXV A;  3WXG A;  3CH2 X;  2DZY A;  1CQD A;  1YK7 A;  1U9Q X;  5CVN B;  1YAL A;  4Q8G A;  1GEC E;  6PAD A;  4OEM A;  1BQI A;  1Y08 A;  4BGF A;  1AYW A;  1AEC A;  1EWP A;  1KFX L;  3ERV A;  1ZCM A;  5F02 A;  3F75 A;  1M6D A;  4YYQ A;  3HD3 A;  5A24 A;  1W5R A;  4DMY A;  4X6I A;  1HUC B;  2E02 A;  4N4Z A;  2PAD A;  4WA6 A;  2O6X A;  3IMA A;  4FJC A;  2FO5 A;  3QJ3 A;  4QRX A;  1IWD A;  1JQP A;  2NQI A;  2G8J A;  2R9F A;  3CBJ A;  4Q8H A;  2DCC A;  2PNS A;  4XR7 A;  3KW9 A;  1VJV A;  3S3Q A;  2F1G A;  3BPM A;  1BP4 A;  4FIP A;  2HXZ A;  4MSX A;  2XU4 A;  1AU3 A;  2AS8 A;  4P6E A;  4P6G A;  1MIR A;  2DCA A;  3S3R A;  3GCB A;  3LXS A;  4X6H A;  3WXE A;  2DJG B;  3IUT A;  4CDE B;  1CB5 A;  2P86 A;  2YJB A;  3I06 A;  2DCB A;  1MDW A;  3KX1 A;  1PPN A;  2AIM A;  1GX3 A;  1F2C A;  2IBI A;  4MZO A;  5EGW A;  2R9C A;  2G7Y A;  1W6F A;  4MZS A;  2E01 A;  3RVV A;  2E00 A;  2OP3 A;  4BS5 A;  1KHQ A;  4QRG A;  2C0Y A;  2HHN A;  3H8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...