1PPDA

Restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restrained Least-Squares Refinement of the Sulfhydryl Protease Papain to 2.0 Angstroms
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
molecule keywords 2-HYDROXYETHYL-THIOPAPAIN
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1984-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppdA00
1PPNA 2NQIA 3WXFA 4I05A 1TL9A 3ERVA 1STFE 4CDCB 2FTDA 3C9EA 1EWOA 1ME4A 5PADA 2AYOA 4P6EA 3BPMA 3OISA 2AYNA 1YK8A 3KWZA 4W4UA 1PXVA 1VSNA 2DZZA 2CB5A 1F29A 1FH0A 1YK7A 1BY8A 1SP4B 1HUCB 4YYQA 4YYUA 3KKUA 4WA6A 2DJFB 1ME3A 2YJ9A 1THEA 2P0RA 4YYVA 3MORA 3CH2X 1TU6A 4QRGA 3KX1A 2NQGA 1KXRA 1CQDA 4BSQA 4OEMA 4P6GA 3BC3A 1AU2A 4N8WA 2HHNA 4MSXA 4X6IA 3I3TA 1BQIA 2GHUA 4N4ZA 3RVWA 2XU3A 2WBFX 1ATKA 2OZ2A 1QMYA 2FO5A 4X6JA 2BDZA 1MIRA 4W5CA 1Y4HA 2O6XA 2GFOA 3KFQA 2JQFR 1F2CA 1AU4A 5K16A 5FPWA 2R6NA 1MEMA 2PADA 5A24A 1BGOA 2G6DA 3IOQA 2XU5A 4CDEB 4AXMA 2OP3A 4QRVA 4Q8GA 2YJ8A 4QBBA 1MEGA 4XR7A 3N4CA 3IEJA 3H8CA 5CVOB 1QDQA 4PI3A 1ZIVA 4OELA 1U9WA 2E00A 3CBKA 4W5BA 1CJLA 2ATOA 2C0YA 4QH6A 2R9OA 2ARYA 3N3KA 1PPOA 4PP1A 3NHEA 2E01A 3F75A 3HD3A 1NQCA 1IWDA 3H89A 4FK5A 2FQ9A 3WXEA 3V6CA 1X9YA 2P86A 4KLBA 3PNRA 1PE6A 3AI8A 2DC7A 1EF7A 2Y5BA 6PADA 3DF0A 3V6EA 1QXPA 1KHPA 1ICFA 1YALA 1NB5A 1AYWA 1EWPA 1GMYA 3O0UA 3IMAA 1U9VA 1U9XA 3PBHA 4N79A 2FRAA 4YYWA 2FUDA 1PPPA 4PADA 4MZSA 5CVMA 1YT7A 1NB3A 2XU1A 1CTEA 3K24A 3PDFA 3OVZA 4BQVA 3HWNA 4BS6A 1CV8A 3P5VA 3S3RA 3S3QA 2YJCA 1CVZA 4YYRA 1ITOA 1K3BB 1M6DA 2VHFA 2HH5A 3O1GA 1U9QX 3H8BA 2DCAA 1DF0A 3LFYA 1SNKA 1CB5A 2CIOA 1JQPA 1PADA 2AU1A 4I04A 3E1ZB 2HD5A 2XU4A 5JH3A 1ZCMA 1MHWA 2DC8A 4G54A 1AIMA 2FYEA 1NPZA 3RVXA 4QRXA 2AVWA 3I06A 2DJGB 5CVNB 2IBIA 4BPVA 3BCNA 4DMYA 1AYVA 3KSEA 4FIPA 3P5WA 3U8EA 1CPJA 2DC6A 3H6SA 2IPPB 3RVVA 2NQAA 4K7CA 5CHVA 3H7DA 1TLOA 2G8EA 2AUXA 1QOLA 3IV2A 4PP2E 2R9MA 4FJCA 3OF9A 4CDDB 4I07A 3BWKA 3CBJA 3QJ3A 3GCBA 4YV8A 3MHHA 5JA7A 3PW3A 4DMXA 2R9CA 2AS8A 4X6HA 3BOWA 4ZUXU 1PIPA 1KFXL 1Q6KA 2YJ2A 2FRQA 2Y6EA 4Q8HA 2H7JA 9PAPA 1NL6A 2DC9A 1AU0A 2R9NA 4BS5A 2G7YA 2OULA 1MS6A 1PBHA 1F2AA 2E03A 2BDLA 2FT2A 1AU3A 2AUZA 3HHIA 3ZUAA 3B79A 3KWBX 3USVA 2G8JA 1PPDA 3BPFA 1AECA 1S4VA 2F1GA 3D6SA 1A6RA 4RY2A 2ACTA 1U5IA 2PBHA 7PCKA 5J94A 1F2BA 3WXGA 4HWYA 1O0EA 5F02A 1GECE 3QSDA 4YVAA 3CH3X 1DEUA 1EWLA 2P7UA 1BP4A 1KFUL 1GLOA 1VJVA 4CZWA 2R9FA 2VHSA 1XKGA 2F7DA 3OVXA 3IHPA 3M99A 1NLJA 1CS8A 2YJBA 3P5UA 3N3GA 3QT4A 2B1NA 5CHTA 1GCBA 4XUIA 5EF4A 3LXSA 3P5XA 2B1MA 2DCCA 3MHSA 5EGWA 1AYUA 2NQDB 1EWMA 2PREA 3IUTA 3KW9A 4CDFB 4AXLA 1YVBA 3OF8A 1CSBB 4YYSA 8PCHA 1Y08A 3F5VA 1POPA 3TNXA 4MZOA 2AIMA 3MTNA 2JQGR 2DCDA 1MDWA 3HHAA 2DZYA 3K9MA 1PCIA 2HXZA 2PNSA 1KHQA 3K8UA 2E02A 2DCBA
chains in the Genus database with same CATH superfamily
2FE8A 1PPNA 2NQIA 3WXFA 4I05A 1TL9A 3ERVA 1STFE 4CDCB 2FTDA 3C9EA 1EWOA 3OQCA 1ME4A 2HWKA 5PADA 2AYOA 4P6EA 3BPMA 3OISA 3MP2A 2AYNA 1YK8A 3KWZA 4W4UA 1PXVA 1VSNA 2DZZA 2CB5A 1F29A 4OW0A 1FH0A 1YK7A 1BY8A 1SP4B 1HUCB 4YYQA 2J7QA 3C0RA 4YYUA 3KKUA 4WA6A 2DJFB 3W31A 1ME3A 2YJ9A 1THEA 4RF1A 2P0RA 4YYVA 3MORA 3CH2X 1TU6A 4QRGA 3KX1A 2NQGA 1KXRA 1CQDA 4BSQA 4OEMA 4P6GA 3BC3A 1AU2A 4N8WA 2HHNA 4MSXA 4X6IA 3I3TA 1BQIA 2GHUA 4N4ZA 3RVWA 2XU3A 2WBFX 1ATKA 2OZ2A 1QMYA 2FO5A 4XZXA 4X6JA 2BDZA 5EZQA 1MIRA 3O65A 4W5CA 1Y4HA 2O6XA 2GFOA 3KFQA 2JQFR 1F2CA 1AU4A 5K16A 5KO3A 5FPWA 2R6NA 1MEMA 2PADA 5A24A 2AGAA 1BGOA 2G6DA 3IOQA 4A5UA 2XU5A 4CDEB 4AXMA 2OP3A 4QRVA 4Q8GA 2YJ8A 4QBBA 1MEGA 4XR7A 3N4CA 3IEJA 3H8CA 5CVOB 1QDQA 4PI3A 1ZIVA 4OELA 1U9WA 2E00A 5E6JA 3CBKA 3PHUA 5JZEA 4GUAA 4W5BA 1CJLA 2ATOA 3E9SA 3PRPA 2C0YA 4QH6A 2R9OA 2ARYA 3N3KA 1PPOA 4PP1A 3NHEA 2E01A 3F75A 3HD3A 1NQCA 1IWDA 3H89A 4FK5A 2FQ9A 3WXEA 3V6CA 1X9YA 2P86A 3W30A 4KLBA 3PNRA 1PE6A 3PT2A 3AI8A 2DC7A 1EF7A 4BOQA 2Y5BA 6PADA 3BY4A 3DF0A 3V6EA 3PHWA 1QXPA 1KHPA 1ICFA 1YALA 4D8BA 1AYWA 1NB5A 1EWPA 1GMYA 3O0UA 3IMAA 1U9VA 1U9XA 3PBHA 3TRKA 4HXDB 2FRAA 4N79A 4YYWA 2FUDA 1PPPA 4PADA 4MZSA 5CVMA 1YT7A 1NB3A 2XU1A 1CTEA 3K24A 3PDFA 4WURA 3OVZA 3PSEA 4BQVA 3HWNA 4BS6A 1CV8A 3P5VA 3S3RA 3S3QA 2YJCA 1CVZA 4YYRA 1ITOA 1K3BB 1M6DA 2VHFA 2HH5A 3O1GA 4BOPA 1U9QX 4M0WA 3H8BA 2DCAA 3PHXA 1DF0A 3LFYA 2J7QC 1SNKA 1CB5A 4RF0A 5EZSA 2CIOA 1JQPA 1PADA 2AU1A 4I04A 3E1ZB 2HD5A 4BOZA 2XU4A 5JH3A 1ZCMA 4D8EA 1MHWA 2DC8A 4G54A 2JTCA 1AIMA 2FYEA 3MTVA 2Z84A 4IUMA 1NPZA 3RVXA 4QRXA 2AVWA 3I06A 2DJGB 5CVNB 2BTWA 2IBIA 4BPVA 3BCNA 4DMYA 1AYVA 3KSEA 4FIPA 3P5WA 3U8EA 1CPJA 2DC6A 3H6SA 2IPPB 3RVVA 2NQAA 4K7CA 5CHVA 1UKFA 3H7DA 1TLOA 2G8EA 3PRMA 2AUXA 1QOLA 3IV2A 1PVJA 3BBAA 4P16A 3MJ5A 4PP2E 2R9MA 3B21A 4FJCA 3OF9A 4CDDB 4BOSA 4I07A 2BU3A 3BWKA 3CBJA 4MM3B 3QJ3A 3GCBA 4YV8A 3MHHA 5JA7A 3PW3A 4DMXA 2R9CA 4ZTBA 2AS8A 4X6HA 1DKIA 3BOWA 4ZUXU 4D8IA 1PIPA 1KFXL 1Q6KA 4REZA 2YJ2A 2FRQA 2Y6EA 4Q8HA 3IFUA 2H7JA 9PAPA 1NL6A 2DC9A 1AU0A 2R9NA 4OVZA 4BS5A 2G7YA 2OULA 1MS6A 1PBHA 4RNAA 1F2AA 2E03A 2BDLA 2FT2A 1AU3A 4RKXA 2AUZA 3HHIA 3ZUAA 3B79A 3KWBX 2JRIA 3USVA 2G8JA 1PPDA 3BPFA 1AECA 1S4VA 2F1GA 3D6SA 1A6RA 1YZBA 4RY2A 3RNVA 2ACTA 1U5IA 2PBHA 4PT5A 7PCKA 5J94A 2DOSA 3TMPA 1F2BA 3WXGA 4HWYA 1O0EA 5F02A 1GECE 3QSDA 4YVAA 3CH3X 1DEUA 4R3DA 1EWLA 2P7UA 1BP4A 1KFUL 1GLOA 1VJVA 4CZWA 2R9FA 2UZJA 2VHSA 1XKGA 2F7DA 4IP3A 3OVXA 3IHPA 3M99A 3BB7A 1NLJA 1CS8A 2YJBA 3P5UA 3ZNHA 3N3GA 3QT4A 2B1NA 5CHTA 1GCBA 4XUIA 5EF4A 3LXSA 3P5XA 2B1MA 2DCCA 4OVZB 3MHSA 5EGWA 1AYUA 2BTWB 2NQDB 1EWMA 2PREA 3IUTA 3KW9A 4CDFB 4AXLA 1YVBA 4MI7A 3OF8A 1CSBB 4YYSA 8PCHA 1Y08A 3F5VA 1POPA 3TNXA 4MZOA 2AIMA 3MTNA 2JQGR 2DCDA 1MDWA 3HHAA 2DZYA 3K9MA 1PCIA 2HXZA 2PNSA 1KHQA 4BOUA 3K8UA 2E02A 2DCBA
chains in the Genus database with same CATH topology
1PPNA 2NQIA 3WXFA 4I05A 1TL9A 3ERVA 1STFE 4CDCB 2FTDA 3C9EA 1EWOA 1ME4A 4B55A 5PADA 2AYOA 4P6EA 3BPMA 3OISA 2AYNA 1YK8A 3KWZA 4W4UA 1PXVA 1VSNA 2DZZA 2CB5A 1F29A 1FH0A 1YK7A 1BY8A 1SP4B 1HUCB 4YYQA 4YYUA 3KKUA 4WA6A 2DJFB 1ME3A 2YJ9A 1THEA 2P0RA 4YYVA 3MORA 3CH2X 1TU6A 4QRGA 3KX1A 2NQGA 1KXRA 1CQDA 4BSQA 4OEMA 4P6GA 3BC3A 1AU2A 4N8WA 2HHNA 4MSXA 4X6IA 3I3TA 1BQIA 2GHUA 4N4ZA 3RVWA 2XU3A 2WBFX 1ATKA 2OZ2A 1QMYA 2FO5A 4X6JA 2BDZA 1MIRA 4W5CA 1Y4HA 2O6XA 2GFOA 2VFCA 3KFQA 2JQFR 1F2CA 1AU4A 5K16A 5FPWA 2R6NA 1MEMA 2PADA 5A24A 1BGOA 2G6DA 3IOQA 2XU5A 4CDEB 4AXMA 2OP3A 4QRVA 4Q8GA 2YJ8A 4QBBA 1MEGA 4XR7A 3N4CA 4NV7A 3IEJA 3H8CA 5CVOB 1QDQA 4PI3A 1ZIVA 4OELA 1U9WA 2E00A 3CBKA 4W5BA 1CJLA 2ATOA 2C0YA 4QH6A 2R9OA 2ARYA 3N3KA 1PPOA 4PP1A 3NHEA 2E01A 3F75A 3HD3A 1NQCA 1IWDA 3H89A 4FK5A 2FQ9A 3WXEA 3V6CA 1X9YA 2P86A 4KLBA 3PNRA 1PE6A 3AI8A 2DC7A 1EF7A 2Y5BA 6PADA 3DF0A 3V6EA 1QXPA 1KHPA 1ICFA 1YALA 1NB5A 1AYWA 1EWPA 1GMYA 3O0UA 3IMAA 1U9VA 1U9XA 3PBHA 4N79A 2FRAA 4YYWA 2FUDA 1PPPA 4PADA 4MZSA 5CVMA 1YT7A 3LTWA 1NB3A 2XU1A 1CTEA 3K24A 3PDFA 3OVZA 4BQVA 3HWNA 4NV8A 4BS6A 1CV8A 3P5VA 3S3RA 3S3QA 2YJCA 1CVZA 4YYRA 1ITOA 1K3BB 1M6DA 2VHFA 2HH5A 3O1GA 1U9QX 2VFBA 3H8BA 2DCAA 1DF0A 3LFYA 1SNKA 1CB5A 2CIOA 1JQPA 1PADA 1E2TA 2AU1A 4I04A 3E1ZB 2HD5A 2XU4A 5JH3A 1ZCMA 1MHWA 1W4TA 2DC8A 4G54A 1AIMA 2FYEA 1NPZA 3RVXA 4QRXA 2AVWA 3I06A 2DJGB 5CVNB 2IBIA 4BPVA 3BCNA 4DMYA 1AYVA 3KSEA 4FIPA 3P5WA 3U8EA 1CPJA 2DC6A 3H6SA 4GUZA 2IPPB 3RVVA 2NQAA 4K7CA 5CHVA 3H7DA 1TLOA 2G8EA 2AUXA 1QOLA 3IV2A 4PP2E 2R9MA 4FJCA 3OF9A 4CDDB 4I07A 3BWKA 3CBJA 4BGFA 3QJ3A 3GCBA 4YV8A 3MHHA 5JA7A 3PW3A 1GX3A 4DMXA 2R9CA 2AS8A 4X6HA 3BOWA 4ZUXU 1PIPA 1KFXL 1Q6KA 2YJ2A 2FRQA 2Y6EA 4Q8HA 2H7JA 9PAPA 1NL6A 2DC9A 1AU0A 2R9NA 4BS5A 2G7YA 2OULA 1MS6A 1PBHA 1F2AA 2E03A 2BDLA 2FT2A 1AU3A 3D9WA 2AUZA 3HHIA 3ZUAA 3B79A 3KWBX 3USVA 2G8JA 1PPDA 3BPFA 1AECA 1S4VA 2F1GA 3D6SA 1A6RA 4RY2A 2ACTA 1U5IA 2PBHA 7PCKA 5J94A 1F2BA 3WXGA 4HWYA 1O0EA 5F02A 1GECE 3QSDA 4YVAA 3CH3X 1DEUA 4C5PA 1EWLA 2P7UA 1BP4A 1KFUL 1GLOA 1VJVA 4CZWA 2R9FA 2VHSA 1XKGA 2F7DA 3OVXA 3IHPA 3M99A 1NLJA 1CS8A 2YJBA 3P5UA 3N3GA 3QT4A 2B1NA 5CHTA 1GCBA 4XUIA 5EF4A 3LXSA 3P5XA 2B1MA 2DCCA 3MHSA 5EGWA 1AYUA 2NQDB 1EWMA 2PREA 3IUTA 3KW9A 4CDFB 4AXLA 1YVBA 3OF8A 1W5RA 1CSBB 4YYSA 8PCHA 1Y08A 2BSZA 3F5VA 1POPA 3TNXA 4MZOA 2AIMA 1W6FA 3MTNA 2JQGR 2DCDA 1MDWA 3HHAA 2DZYA 3K9MA 1PCIA 2HXZA 2PNSA 1KHQA 3K8UA 2E02A 2DCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPN A;  2NQI A;  3WXF A;  4I05 A;  1TL9 A;  3ERV A;  1STF E;  4CDC B;  2FTD A;  3C9E A;  1EWO A;  1ME4 A;  5PAD A;  2AYO A;  4P6E A;  3BPM A;  3OIS A;  2AYN A;  1YK8 A;  3KWZ A;  4W4U A;  1PXV A;  1VSN A;  2DZZ A;  2CB5 A;  1F29 A;  1FH0 A;  1YK7 A;  1BY8 A;  1SP4 B;  1HUC B;  4YYQ A;  4YYU A;  3KKU A;  4WA6 A;  2DJF B;  1ME3 A;  2YJ9 A;  1THE A;  2P0R A;  4YYV A;  3MOR A;  3CH2 X;  1TU6 A;  4QRG A;  3KX1 A;  2NQG A;  1KXR A;  1CQD A;  4BSQ A;  4OEM A;  4P6G A;  3BC3 A;  1AU2 A;  4N8W A;  2HHN A;  4MSX A;  4X6I A;  3I3T A;  1BQI A;  2GHU A;  4N4Z A;  3RVW A;  2XU3 A;  2WBF X;  1ATK A;  2OZ2 A;  1QMY A;  2FO5 A;  4X6J A;  2BDZ A;  1MIR A;  4W5C A;  1Y4H A;  2O6X A;  2GFO A;  3KFQ A;  2JQF R;  1F2C A;  1AU4 A;  5K16 A;  5FPW A;  2R6N A;  1MEM A;  2PAD A;  5A24 A;  1BGO A;  2G6D A;  3IOQ A;  2XU5 A;  4CDE B;  4AXM A;  2OP3 A;  4QRV A;  4Q8G A;  2YJ8 A;  4QBB A;  1MEG A;  4XR7 A;  3N4C A;  3IEJ A;  3H8C A;  5CVO B;  1QDQ A;  4PI3 A;  1ZIV A;  4OEL A;  1U9W A;  2E00 A;  3CBK A;  4W5B A;  1CJL A;  2ATO A;  2C0Y A;  4QH6 A;  2R9O A;  2ARY A;  3N3K A;  1PPO A;  4PP1 A;  3NHE A;  2E01 A;  3F75 A;  3HD3 A;  1NQC A;  1IWD A;  3H89 A;  4FK5 A;  2FQ9 A;  3WXE A;  3V6C A;  1X9Y A;  2P86 A;  4KLB A;  3PNR A;  1PE6 A;  3AI8 A;  2DC7 A;  1EF7 A;  2Y5B A;  6PAD A;  3DF0 A;  3V6E A;  1QXP A;  1KHP A;  1ICF A;  1YAL A;  1NB5 A;  1AYW A;  1EWP A;  1GMY A;  3O0U A;  3IMA A;  1U9V A;  1U9X A;  3PBH A;  4N79 A;  2FRA A;  4YYW A;  2FUD A;  1PPP A;  4PAD A;  4MZS A;  5CVM A;  1YT7 A;  1NB3 A;  2XU1 A;  1CTE A;  3K24 A;  3PDF A;  3OVZ A;  4BQV A;  3HWN A;  4BS6 A;  1CV8 A;  3P5V A;  3S3R A;  3S3Q A;  2YJC A;  1CVZ A;  4YYR A;  1ITO A;  1K3B B;  1M6D A;  2VHF A;  2HH5 A;  3O1G A;  1U9Q X;  3H8B A;  2DCA A;  1DF0 A;  3LFY A;  1SNK A;  1CB5 A;  2CIO A;  1JQP A;  1PAD A;  2AU1 A;  4I04 A;  3E1Z B;  2HD5 A;  2XU4 A;  5JH3 A;  1ZCM A;  1MHW A;  2DC8 A;  4G54 A;  1AIM A;  2FYE A;  1NPZ A;  3RVX A;  4QRX A;  2AVW A;  3I06 A;  2DJG B;  5CVN B;  2IBI A;  4BPV A;  3BCN A;  4DMY A;  1AYV A;  3KSE A;  4FIP A;  3P5W A;  3U8E A;  1CPJ A;  2DC6 A;  3H6S A;  2IPP B;  3RVV A;  2NQA A;  4K7C A;  5CHV A;  3H7D A;  1TLO A;  2G8E A;  2AUX A;  1QOL A;  3IV2 A;  4PP2 E;  2R9M A;  4FJC A;  3OF9 A;  4CDD B;  4I07 A;  3BWK A;  3CBJ A;  3QJ3 A;  3GCB A;  4YV8 A;  3MHH A;  5JA7 A;  3PW3 A;  4DMX A;  2R9C A;  2AS8 A;  4X6H A;  3BOW A;  4ZUX U;  1PIP A;  1KFX L;  1Q6K A;  2YJ2 A;  2FRQ A;  2Y6E A;  4Q8H A;  2H7J A;  9PAP A;  1NL6 A;  2DC9 A;  1AU0 A;  2R9N A;  4BS5 A;  2G7Y A;  2OUL A;  1MS6 A;  1PBH A;  1F2A A;  2E03 A;  2BDL A;  2FT2 A;  1AU3 A;  2AUZ A;  3HHI A;  3ZUA A;  3B79 A;  3KWB X;  3USV A;  2G8J A;  1PPD A;  3BPF A;  1AEC A;  1S4V A;  2F1G A;  3D6S A;  1A6R A;  4RY2 A;  2ACT A;  1U5I A;  2PBH A;  7PCK A;  5J94 A;  1F2B A;  3WXG A;  4HWY A;  1O0E A;  5F02 A;  1GEC E;  3QSD A;  4YVA A;  3CH3 X;  1DEU A;  1EWL A;  2P7U A;  1BP4 A;  1KFU L;  1GLO A;  1VJV A;  4CZW A;  2R9F A;  2VHS A;  1XKG A;  2F7D A;  3OVX A;  3IHP A;  3M99 A;  1NLJ A;  1CS8 A;  2YJB A;  3P5U A;  3N3G A;  3QT4 A;  2B1N A;  5CHT A;  1GCB A;  4XUI A;  5EF4 A;  3LXS A;  3P5X A;  2B1M A;  2DCC A;  3MHS A;  5EGW A;  1AYU A;  2NQD B;  1EWM A;  2PRE A;  3IUT A;  3KW9 A;  4CDF B;  4AXL A;  1YVB A;  3OF8 A;  1CSB B;  4YYS A;  8PCH A;  1Y08 A;  3F5V A;  1POP A;  3TNX A;  4MZO A;  2AIM A;  3MTN A;  2JQG R;  2DCD A;  1MDW A;  3HHA A;  2DZY A;  3K9M A;  1PCI A;  2HXZ A;  2PNS A;  1KHQ A;  3K8U A;  2E02 A;  2DCB A; 
#chains in the Genus database with same CATH topology
 2FE8 A;  1PPN A;  2NQI A;  3WXF A;  4I05 A;  1TL9 A;  3ERV A;  1STF E;  4CDC B;  2FTD A;  3C9E A;  1EWO A;  3OQC A;  1ME4 A;  2HWK A;  5PAD A;  2AYO A;  4P6E A;  3BPM A;  3OIS A;  3MP2 A;  2AYN A;  1YK8 A;  3KWZ A;  4W4U A;  1PXV A;  1VSN A;  2DZZ A;  2CB5 A;  1F29 A;  4OW0 A;  1FH0 A;  1YK7 A;  1BY8 A;  1SP4 B;  1HUC B;  4YYQ A;  2J7Q A;  3C0R A;  4YYU A;  3KKU A;  4WA6 A;  2DJF B;  3W31 A;  1ME3 A;  2YJ9 A;  1THE A;  4RF1 A;  2P0R A;  4YYV A;  3MOR A;  3CH2 X;  1TU6 A;  4QRG A;  3KX1 A;  2NQG A;  1KXR A;  1CQD A;  4BSQ A;  4OEM A;  4P6G A;  3BC3 A;  1AU2 A;  4N8W A;  2HHN A;  4MSX A;  4X6I A;  3I3T A;  1BQI A;  2GHU A;  4N4Z A;  3RVW A;  2XU3 A;  2WBF X;  1ATK A;  2OZ2 A;  1QMY A;  2FO5 A;  4XZX A;  4X6J A;  2BDZ A;  5EZQ A;  1MIR A;  3O65 A;  4W5C A;  1Y4H A;  2O6X A;  2GFO A;  3KFQ A;  2JQF R;  1F2C A;  1AU4 A;  5K16 A;  5KO3 A;  5FPW A;  2R6N A;  1MEM A;  2PAD A;  5A24 A;  2AGA A;  1BGO A;  2G6D A;  3IOQ A;  4A5U A;  2XU5 A;  4CDE B;  4AXM A;  2OP3 A;  4QRV A;  4Q8G A;  2YJ8 A;  4QBB A;  1MEG A;  4XR7 A;  3N4C A;  3IEJ A;  3H8C A;  5CVO B;  1QDQ A;  4PI3 A;  1ZIV A;  4OEL A;  1U9W A;  2E00 A;  5E6J A;  3CBK A;  3PHU A;  5JZE A;  4GUA A;  4W5B A;  1CJL A;  2ATO A;  3E9S A;  3PRP A;  2C0Y A;  4QH6 A;  2R9O A;  2ARY A;  3N3K A;  1PPO A;  4PP1 A;  3NHE A;  2E01 A;  3F75 A;  3HD3 A;  1NQC A;  1IWD A;  3H89 A;  4FK5 A;  2FQ9 A;  3WXE A;  3V6C A;  1X9Y A;  2P86 A;  3W30 A;  4KLB A;  3PNR A;  1PE6 A;  3PT2 A;  3AI8 A;  2DC7 A;  1EF7 A;  4BOQ A;  2Y5B A;  6PAD A;  3BY4 A;  3DF0 A;  3V6E A;  3PHW A;  1QXP A;  1KHP A;  1ICF A;  1YAL A;  4D8B A;  1AYW A;  1NB5 A;  1EWP A;  1GMY A;  3O0U A;  3IMA A;  1U9V A;  1U9X A;  3PBH A;  3TRK A;  4HXD B;  2FRA A;  4N79 A;  4YYW A;  2FUD A;  1PPP A;  4PAD A;  4MZS A;  5CVM A;  1YT7 A;  1NB3 A;  2XU1 A;  1CTE A;  3K24 A;  3PDF A;  4WUR A;  3OVZ A;  3PSE A;  4BQV A;  3HWN A;  4BS6 A;  1CV8 A;  3P5V A;  3S3R A;  3S3Q A;  2YJC A;  1CVZ A;  4YYR A;  1ITO A;  1K3B B;  1M6D A;  2VHF A;  2HH5 A;  3O1G A;  4BOP A;  1U9Q X;  4M0W A;  3H8B A;  2DCA A;  3PHX A;  1DF0 A;  3LFY A;  2J7Q C;  1SNK A;  1CB5 A;  4RF0 A;  5EZS A;  2CIO A;  1JQP A;  1PAD A;  2AU1 A;  4I04 A;  3E1Z B;  2HD5 A;  4BOZ A;  2XU4 A;  5JH3 A;  1ZCM A;  4D8E A;  1MHW A;  2DC8 A;  4G54 A;  2JTC A;  1AIM A;  2FYE A;  3MTV A;  2Z84 A;  4IUM A;  1NPZ A;  3RVX A;  4QRX A;  2AVW A;  3I06 A;  2DJG B;  5CVN B;  2BTW A;  2IBI A;  4BPV A;  3BCN A;  4DMY A;  1AYV A;  3KSE A;  4FIP A;  3P5W A;  3U8E A;  1CPJ A;  2DC6 A;  3H6S A;  2IPP B;  3RVV A;  2NQA A;  4K7C A;  5CHV A;  1UKF A;  3H7D A;  1TLO A;  2G8E A;  3PRM A;  2AUX A;  1QOL A;  3IV2 A;  1PVJ A;  3BBA A;  4P16 A;  3MJ5 A;  4PP2 E;  2R9M A;  3B21 A;  4FJC A;  3OF9 A;  4CDD B;  4BOS A;  4I07 A;  2BU3 A;  3BWK A;  3CBJ A;  4MM3 B;  3QJ3 A;  3GCB A;  4YV8 A;  3MHH A;  5JA7 A;  3PW3 A;  4DMX A;  2R9C A;  4ZTB A;  2AS8 A;  4X6H A;  1DKI A;  3BOW A;  4ZUX U;  4D8I A;  1PIP A;  1KFX L;  1Q6K A;  4REZ A;  2YJ2 A;  2FRQ A;  2Y6E A;  4Q8H A;  3IFU A;  2H7J A;  9PAP A;  1NL6 A;  2DC9 A;  1AU0 A;  2R9N A;  4OVZ A;  4BS5 A;  2G7Y A;  2OUL A;  1MS6 A;  1PBH A;  4RNA A;  1F2A A;  2E03 A;  2BDL A;  2FT2 A;  1AU3 A;  4RKX A;  2AUZ A;  3HHI A;  3ZUA A;  3B79 A;  3KWB X;  2JRI A;  3USV A;  2G8J A;  1PPD A;  3BPF A;  1AEC A;  1S4V A;  2F1G A;  3D6S A;  1A6R A;  1YZB A;  4RY2 A;  3RNV A;  2ACT A;  1U5I A;  2PBH A;  4PT5 A;  7PCK A;  5J94 A;  2DOS A;  3TMP A;  1F2B A;  3WXG A;  4HWY A;  1O0E A;  5F02 A;  1GEC E;  3QSD A;  4YVA A;  3CH3 X;  1DEU A;  4R3D A;  1EWL A;  2P7U A;  1BP4 A;  1KFU L;  1GLO A;  1VJV A;  4CZW A;  2R9F A;  2UZJ A;  2VHS A;  1XKG A;  2F7D A;  4IP3 A;  3OVX A;  3IHP A;  3M99 A;  3BB7 A;  1NLJ A;  1CS8 A;  2YJB A;  3P5U A;  3ZNH A;  3N3G A;  3QT4 A;  2B1N A;  5CHT A;  1GCB A;  4XUI A;  5EF4 A;  3LXS A;  3P5X A;  2B1M A;  2DCC A;  4OVZ B;  3MHS A;  5EGW A;  1AYU A;  2BTW B;  2NQD B;  1EWM A;  2PRE A;  3IUT A;  3KW9 A;  4CDF B;  4AXL A;  1YVB A;  4MI7 A;  3OF8 A;  1CSB B;  4YYS A;  8PCH A;  1Y08 A;  3F5V A;  1POP A;  3TNX A;  4MZO A;  2AIM A;  3MTN A;  2JQG R;  2DCD A;  1MDW A;  3HHA A;  2DZY A;  3K9M A;  1PCI A;  2HXZ A;  2PNS A;  1KHQ A;  4BOU A;  3K8U A;  2E02 A;  2DCB A; 
#chains in the Genus database with same CATH homology
 1PPN A;  2NQI A;  3WXF A;  4I05 A;  1TL9 A;  3ERV A;  1STF E;  4CDC B;  2FTD A;  3C9E A;  1EWO A;  1ME4 A;  4B55 A;  5PAD A;  2AYO A;  4P6E A;  3BPM A;  3OIS A;  2AYN A;  1YK8 A;  3KWZ A;  4W4U A;  1PXV A;  1VSN A;  2DZZ A;  2CB5 A;  1F29 A;  1FH0 A;  1YK7 A;  1BY8 A;  1SP4 B;  1HUC B;  4YYQ A;  4YYU A;  3KKU A;  4WA6 A;  2DJF B;  1ME3 A;  2YJ9 A;  1THE A;  2P0R A;  4YYV A;  3MOR A;  3CH2 X;  1TU6 A;  4QRG A;  3KX1 A;  2NQG A;  1KXR A;  1CQD A;  4BSQ A;  4OEM A;  4P6G A;  3BC3 A;  1AU2 A;  4N8W A;  2HHN A;  4MSX A;  4X6I A;  3I3T A;  1BQI A;  2GHU A;  4N4Z A;  3RVW A;  2XU3 A;  2WBF X;  1ATK A;  2OZ2 A;  1QMY A;  2FO5 A;  4X6J A;  2BDZ A;  1MIR A;  4W5C A;  1Y4H A;  2O6X A;  2GFO A;  2VFC A;  3KFQ A;  2JQF R;  1F2C A;  1AU4 A;  5K16 A;  5FPW A;  2R6N A;  1MEM A;  2PAD A;  5A24 A;  1BGO A;  2G6D A;  3IOQ A;  2XU5 A;  4CDE B;  4AXM A;  2OP3 A;  4QRV A;  4Q8G A;  2YJ8 A;  4QBB A;  1MEG A;  4XR7 A;  3N4C A;  4NV7 A;  3IEJ A;  3H8C A;  5CVO B;  1QDQ A;  4PI3 A;  1ZIV A;  4OEL A;  1U9W A;  2E00 A;  3CBK A;  4W5B A;  1CJL A;  2ATO A;  2C0Y A;  4QH6 A;  2R9O A;  2ARY A;  3N3K A;  1PPO A;  4PP1 A;  3NHE A;  2E01 A;  3F75 A;  3HD3 A;  1NQC A;  1IWD A;  3H89 A;  4FK5 A;  2FQ9 A;  3WXE A;  3V6C A;  1X9Y A;  2P86 A;  4KLB A;  3PNR A;  1PE6 A;  3AI8 A;  2DC7 A;  1EF7 A;  2Y5B A;  6PAD A;  3DF0 A;  3V6E A;  1QXP A;  1KHP A;  1ICF A;  1YAL A;  1NB5 A;  1AYW A;  1EWP A;  1GMY A;  3O0U A;  3IMA A;  1U9V A;  1U9X A;  3PBH A;  4N79 A;  2FRA A;  4YYW A;  2FUD A;  1PPP A;  4PAD A;  4MZS A;  5CVM A;  1YT7 A;  3LTW A;  1NB3 A;  2XU1 A;  1CTE A;  3K24 A;  3PDF A;  3OVZ A;  4BQV A;  3HWN A;  4NV8 A;  4BS6 A;  1CV8 A;  3P5V A;  3S3R A;  3S3Q A;  2YJC A;  1CVZ A;  4YYR A;  1ITO A;  1K3B B;  1M6D A;  2VHF A;  2HH5 A;  3O1G A;  1U9Q X;  2VFB A;  3H8B A;  2DCA A;  1DF0 A;  3LFY A;  1SNK A;  1CB5 A;  2CIO A;  1JQP A;  1PAD A;  1E2T A;  2AU1 A;  4I04 A;  3E1Z B;  2HD5 A;  2XU4 A;  5JH3 A;  1ZCM A;  1MHW A;  1W4T A;  2DC8 A;  4G54 A;  1AIM A;  2FYE A;  1NPZ A;  3RVX A;  4QRX A;  2AVW A;  3I06 A;  2DJG B;  5CVN B;  2IBI A;  4BPV A;  3BCN A;  4DMY A;  1AYV A;  3KSE A;  4FIP A;  3P5W A;  3U8E A;  1CPJ A;  2DC6 A;  3H6S A;  4GUZ A;  2IPP B;  3RVV A;  2NQA A;  4K7C A;  5CHV A;  3H7D A;  1TLO A;  2G8E A;  2AUX A;  1QOL A;  3IV2 A;  4PP2 E;  2R9M A;  4FJC A;  3OF9 A;  4CDD B;  4I07 A;  3BWK A;  3CBJ A;  4BGF A;  3QJ3 A;  3GCB A;  4YV8 A;  3MHH A;  5JA7 A;  3PW3 A;  1GX3 A;  4DMX A;  2R9C A;  2AS8 A;  4X6H A;  3BOW A;  4ZUX U;  1PIP A;  1KFX L;  1Q6K A;  2YJ2 A;  2FRQ A;  2Y6E A;  4Q8H A;  2H7J A;  9PAP A;  1NL6 A;  2DC9 A;  1AU0 A;  2R9N A;  4BS5 A;  2G7Y A;  2OUL A;  1MS6 A;  1PBH A;  1F2A A;  2E03 A;  2BDL A;  2FT2 A;  1AU3 A;  3D9W A;  2AUZ A;  3HHI A;  3ZUA A;  3B79 A;  3KWB X;  3USV A;  2G8J A;  1PPD A;  3BPF A;  1AEC A;  1S4V A;  2F1G A;  3D6S A;  1A6R A;  4RY2 A;  2ACT A;  1U5I A;  2PBH A;  7PCK A;  5J94 A;  1F2B A;  3WXG A;  4HWY A;  1O0E A;  5F02 A;  1GEC E;  3QSD A;  4YVA A;  3CH3 X;  1DEU A;  4C5P A;  1EWL A;  2P7U A;  1BP4 A;  1KFU L;  1GLO A;  1VJV A;  4CZW A;  2R9F A;  2VHS A;  1XKG A;  2F7D A;  3OVX A;  3IHP A;  3M99 A;  1NLJ A;  1CS8 A;  2YJB A;  3P5U A;  3N3G A;  3QT4 A;  2B1N A;  5CHT A;  1GCB A;  4XUI A;  5EF4 A;  3LXS A;  3P5X A;  2B1M A;  2DCC A;  3MHS A;  5EGW A;  1AYU A;  2NQD B;  1EWM A;  2PRE A;  3IUT A;  3KW9 A;  4CDF B;  4AXL A;  1YVB A;  3OF8 A;  1W5R A;  1CSB B;  4YYS A;  8PCH A;  1Y08 A;  2BSZ A;  3F5V A;  1POP A;  3TNX A;  4MZO A;  2AIM A;  1W6F A;  3MTN A;  2JQG R;  2DCD A;  1MDW A;  3HHA A;  2DZY A;  3K9M A;  1PCI A;  2HXZ A;  2PNS A;  1KHQ A;  3K8U A;  2E02 A;  2DCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...