1PPDA

Restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
b'IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HYDROXYETHYL-THIOPAPAIN
publication title Restrained Least-Squares Refinement of the Sulfhydryl Protease Papain to 2.0 Angstroms
pubmed rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1984-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppdA00
3IUTA 4XR7A 3PW3A 2XU1A 3OVXA 1A6RA 1EWOA 1MIRA 3IMAA 2YJCA 4CDCB 2R9CA 3IHPA 1SP4B 2AYOA 1GECE 2DC6A 2FUDA 4QBBA 4XUIA 1BY8A 3S3QA 2NQAA 1CQDA 1KHPA 3C9EA 3QSDA 4FIPA 1TLOA 3PBHA 1AU0A 5CHTA 2ARYA 2BDZA 3KKUA 2XU4A 1YVBA 4N8WA 3CH3X 4OELA 1VJVA 3BC3A 5CVMA 1CV8A 5JA7A 4PP1A 1PBHA 2B1NA 1SNKA 4YV8A 1MHWA 2DCDA 2HXZA 3NHEA 1EWPA 2XU3A 1YK7A 1YK8A 3KSEA 3WXFA 4QRVA 1FH0A 3LFYA 3B79A 1NL6A 3BWKA 3N3KA 1ME3A 3LXSA 3TNXA 4PI3A 3GCBA 2FTDA 2E02A 2FYEA 2C0YA 2R9MA 3KW9A 8PCHA 3I06A 3BPMA 1THEA 4BQVA 2YJ8A 1U9QX 4MZSA 1PADA 3RVWA 2Y6EA 3ZUAA 4CZWA 1XKGA 3E1ZB 3OISA 4X6HA 1CPJA 5A24A 1U5IA 1CB5A 5EGWA 3USVA 4PP2E 5CHVA 3OF8A 4I07A 4N4ZA 5JH3A 3BCNA 4G54A 1F2BA 1KXRA 2FRQA 1K3BB 2O6XA 1ZIVA 2PADA 2E01A 2BDLA 1AECA 3MTNA 4X6JA 1CS8A 2E00A 1PCIA 3O1GA 3MHSA 1NLJA 3BOWA 2OP3A 4HWYA 4BS5A 1GCBA 2DC7A 1MS6A 1QOLA 5CVOB 2DC9A 4YVAA 3P5UA 4ZUXU 2NQGA 2DZYA 2YJBA 2OULA 2P0RA 4N79A 3H8CA 4QH6A 1NB5A 6PADA 1DEUA 4X6IA 3KWZA 5EF4A 1JQPA 1AYVA 3F5VA 2IPPB 3H89A 1POPA 2AUZA 4I05A 2FO5A 1CSBB 3P5WA 2FT2A 2Y5BA 2DCCA 1BP4A 2HD5A 2P86A 3IOQA 1EWMA 4Q8HA 3IEJA 3IV2A 1O0EA 3MORA 1VSNA 4BS6A 3KX1A 1YT7A 2WBFX 1NB3A 3N3GA 1PPNA 1YALA 3CBKA 2VHSA 4PADA 5CVNB 2ATOA 2NQIA 4WA6A 4Q8GA 1QDQA 2AYNA 2R9NA 4BSQA 1ITOA 4FJCA 3HWNA 4W4UA 2DZZA 3H8BA 3U8EA 4DMXA 1EWLA 3QT4A 5PADA 2GFOA 1PXVA 4BPVA 2G6DA 3H7DA 2CIOA 2R9FA 1Y08A 4QRGA 1PPPA 1AYWA 1BGOA 2AVWA 4AXLA 1MDWA 1M6DA 3K24A 3OVZA 1CTEA 2XU5A 2F1GA 2JQGR 2G8JA 3CBJA 4YYWA 3V6CA 2DCBA 3QJ3A 1NPZA 1U9WA 1GMYA 3DF0A 1STFE 2AS8A 5K16A 3HHIA 3WXGA 3AI8A 4YYUA 1AYUA 2DJGB 1KFUL 5F02A 3V6EA 1F2AA 1KHQA 1PPDA 4RY2A 1NQCA 2DC8A 4YYRA 1PPOA 2PREA 3I3TA 5J94A 1MEMA 4K7CA 1Q6KA 4FK5A 4KLBA 3KFQA 4MZOA 3RVXA 3HHAA 1AU3A 3S3RA 4CDEB 1TU6A 2FRAA 1F2CA 2OZ2A 2YJ2A 2G7YA 4W5CA 4I04A 1PE6A 4YYVA 2B1MA 2ACTA 3H6SA 2NQDB 2DCAA 3ERVA 1EF7A 4YYQA 4CDDB 3D6SA 1U9XA 1U9VA 2PBHA 2PNSA 3HD3A 3OF9A 1X9YA 1ICFA 2VHFA 3N4CA 3K8UA 1QXPA 2JQFR 1TL9A 1DF0A 1F29A 4P6EA 2F7DA 3MHHA 2P7UA 1CVZA 4OEMA 2R9OA 5FPWA 2CB5A 2HH5A 7PCKA 2HHNA 2R6NA 3P5VA 1HUCB 2YJ9A 3RVVA 1KFXL 1QMYA 1GLOA 1CJLA 4DMYA 2AUXA 1ATKA 2DJFB 1S4VA 2H7JA 4P6GA 2AU1A 3BPFA 3PDFA 4YYSA 1BQIA 3P5XA 1AU4A 4CDFB 3K9MA 1AU2A 2FQ9A 1IWDA 4W5BA 1ZCMA 2AIMA 3M99A 2E03A 1ME4A 3PNRA 1AIMA 3CH2X 2IBIA 4MSXA 3F75A 1Y4HA 4AXMA 1MEGA 1PIPA 3O0UA 2GHUA 9PAPA 2G8EA 3WXEA 4QRXA 3KWBX
chains in the Genus database with same CATH superfamily
3IUTA 4XR7A 3PW3A 5JZEA 2XU1A 3OVXA 1A6RA 1EWOA 1MIRA 3IMAA 4XZXA 2YJCA 4CDCB 2R9CA 3IHPA 1SP4B 2AYOA 1GECE 2DC6A 2FUDA 3BY4A 4QBBA 4XUIA 1BY8A 4RKXA 3S3QA 2NQAA 1CQDA 1KHPA 3C9EA 3QSDA 4FIPA 1TLOA 3PBHA 1AU0A 5CHTA 2ARYA 2BDZA 3KKUA 2XU4A 1YVBA 4N8WA 3CH3X 3IFUA 4OELA 1VJVA 3BC3A 5CVMA 1CV8A 5JA7A 4PP1A 1PBHA 2B1NA 1SNKA 4YV8A 1MHWA 2DCDA 2HXZA 3NHEA 1EWPA 1PVJA 2XU3A 1YK7A 1YK8A 3KSEA 3WXFA 4QRVA 3W30A 4BOZA 1FH0A 3LFYA 3B79A 1NL6A 3BWKA 3N3KA 1ME3A 3LXSA 3MTVA 3MP2A 3TNXA 4GUAA 4PI3A 3GCBA 2FTDA 3PHUA 2E02A 2FYEA 2C0YA 2R9MA 3KW9A 8PCHA 3I06A 3BPMA 1THEA 4RF0A 4BQVA 2YJ8A 1U9QX 4WURA 4MZSA 1PADA 3RVWA 2FE8A 2Y6EA 3ZUAA 4CZWA 1XKGA 3E1ZB 3OISA 4X6HA 1CPJA 5A24A 1U5IA 1CB5A 5EGWA 3USVA 4PP2E 4OW0A 3OF8A 5CHVA 4I07A 4N4ZA 5JH3A 3BCNA 4G54A 2Z84A 1F2BA 1KXRA 2FRQA 1K3BB 2O6XA 1YZBA 1ZIVA 2PADA 2E01A 2BDLA 1AECA 3MTNA 4X6JA 1CS8A 3C0RA 2E00A 1PCIA 3O1GA 3MHSA 4MM3B 1NLJA 3BOWA 2OP3A 4HWYA 4BS5A 1GCBA 2DC7A 3MJ5A 1MS6A 1QOLA 5CVOB 2DC9A 4YVAA 3P5UA 4ZUXU 2NQGA 2DZYA 2YJBA 2OULA 2P0RA 2HWKA 4D8IA 3E9SA 4N79A 3H8CA 4QH6A 1NB5A 6PADA 3O65A 1DEUA 4X6IA 3KWZA 5EF4A 1JQPA 4BOQA 2AGAA 4HXDB 3PT2A 1AYVA 3F5VA 2IPPB 2UZJA 3H89A 1POPA 2AUZA 4I05A 2FO5A 1CSBB 3P5WA 1UKFA 2FT2A 2Y5BA 3TRKA 2DCCA 1BP4A 2HD5A 2P86A 3IOQA 1EWMA 4Q8HA 3IEJA 3IV2A 1O0EA 3MORA 1VSNA 5EZSA 4BS6A 3KX1A 1YT7A 2WBFX 1NB3A 3N3GA 4BOPA 1PPNA 1YALA 3CBKA 2VHSA 4PADA 5CVNB 2ATOA 2NQIA 4WA6A 4Q8GA 1QDQA 2AYNA 2R9NA 2BU3A 4BSQA 5E6JA 1ITOA 4FJCA 3HWNA 4W4UA 2DZZA 3H8BA 4D8BA 4P16A 3RNVA 3U8EA 4DMXA 1EWLA 3QT4A 5PADA 2GFOA 1PXVA 4BPVA 2G6DA 4PT5A 3H7DA 2CIOA 2R9FA 1Y08A 4REZA 4QRGA 1PPPA 1AYWA 1BGOA 2J7QC 2AVWA 4AXLA 1MDWA 1M6DA 3K24A 3OVZA 1CTEA 2XU5A 2F1GA 2JQGR 2G8JA 3CBJA 4RF1A 4YYWA 4M0WA 3V6CA 2DCBA 3QJ3A 1NPZA 1U9WA 1GMYA 3DF0A 1STFE 2AS8A 2DOSA 5K16A 3HHIA 3WXGA 3AI8A 4YYUA 1AYUA 2DJGB 5KO3A 1KFUL 5F02A 3V6EA 4R3DA 1F2AA 1KHQA 1PPDA 4RY2A 3BB7A 1NQCA 2DC8A 4YYRA 1PPOA 1DKIA 2PREA 3I3TA 2JRIA 5J94A 4IP3A 3PHXA 1MEMA 5EZQA 4K7CA 1Q6KA 4FK5A 4KLBA 4BOUA 4BOSA 2J7QA 3KFQA 4MZOA 3RVXA 3HHAA 1AU3A 3S3RA 4CDEB 1TU6A 2FRAA 1F2CA 2OZ2A 4RNAA 2YJ2A 2G7YA 4W5CA 4I04A 1PE6A 4ZTBA 4YYVA 2B1MA 2ACTA 3H6SA 2NQDB 4MI7A 3TMPA 2JTCA 2DCAA 3ERVA 1EF7A 4YYQA 4CDDB 3D6SA 1U9XA 1U9VA 2PBHA 2PNSA 3HD3A 3OF9A 1X9YA 1ICFA 2VHFA 3N4CA 3K8UA 3B21A 1QXPA 2JQFR 1TL9A 4A5UA 3OQCA 1DF0A 1F29A 3PRMA 4P6EA 4D8EA 2F7DA 3MHHA 2P7UA 1CVZA 4OEMA 2R9OA 3PHWA 2BTWA 5FPWA 3PSEA 2CB5A 2HH5A 7PCKA 2HHNA 2R6NA 3P5VA 1HUCB 2YJ9A 3RVVA 1KFXL 1QMYA 1GLOA 1CJLA 4DMYA 2AUXA 3PRPA 1ATKA 2DJFB 1S4VA 2H7JA 4P6GA 3W31A 2AU1A 3BPFA 3PDFA 4YYSA 1BQIA 2BTWB 3P5XA 1AU4A 4CDFB 3K9MA 1AU2A 2FQ9A 4OVZA 1IWDA 4W5BA 4IUMA 1ZCMA 2AIMA 3M99A 2E03A 1ME4A 3PNRA 3ZNHA 1AIMA 3CH2X 2IBIA 4MSXA 3F75A 1Y4HA 4AXMA 1MEGA 1PIPA 3O0UA 2GHUA 9PAPA 2G8EA 3WXEA 4OVZB 4QRXA 3BBAA 3KWBX
chains in the Genus database with same CATH topology
3IUTA 4XR7A 3PW3A 2XU1A 3OVXA 1A6RA 1EWOA 1MIRA 3IMAA 2YJCA 1GX3A 2R9CA 3IHPA 1SP4B 2AYOA 4CDCB 1GECE 2DC6A 2FUDA 4QBBA 4XUIA 1BY8A 3S3QA 2NQAA 1CQDA 1KHPA 3C9EA 3QSDA 4FIPA 1TLOA 3PBHA 1AU0A 5CHTA 2ARYA 2VFBA 2BDZA 3KKUA 2XU4A 1YVBA 4N8WA 3CH3X 4OELA 1VJVA 3BC3A 5CVMA 1CV8A 5JA7A 4PP1A 1PBHA 2B1NA 1SNKA 4YV8A 1MHWA 2DCDA 2HXZA 3NHEA 4B55A 1EWPA 2XU3A 1YK7A 1YK8A 3KSEA 3WXFA 4QRVA 1FH0A 3LFYA 3B79A 1NL6A 3BWKA 3N3KA 1ME3A 3LXSA 3TNXA 4PI3A 3GCBA 2FTDA 2E02A 2FYEA 2C0YA 2R9MA 3KW9A 8PCHA 3I06A 3BPMA 1THEA 4BQVA 2YJ8A 1U9QX 4MZSA 1E2TA 1PADA 3RVWA 2Y6EA 3ZUAA 4CZWA 3LTWA 1XKGA 3E1ZB 3OISA 4X6HA 1CPJA 5A24A 1U5IA 1CB5A 5EGWA 3USVA 4PP2E 5CHVA 3OF8A 4I07A 4N4ZA 5JH3A 3BCNA 4G54A 1F2BA 1KXRA 2FRQA 1K3BB 2O6XA 1ZIVA 2PADA 2E01A 2BDLA 1AECA 3MTNA 4X6JA 1CS8A 2E00A 1PCIA 3O1GA 3MHSA 1NLJA 3BOWA 2OP3A 4HWYA 2BSZA 4BS5A 1GCBA 2DC7A 1MS6A 1QOLA 5CVOB 2DC9A 4YVAA 3P5UA 4ZUXU 2NQGA 2DZYA 2YJBA 2OULA 2P0RA 4N79A 3H8CA 4QH6A 1NB5A 6PADA 1DEUA 4X6IA 3KWZA 5EF4A 1JQPA 1AYVA 3F5VA 2IPPB 4NV7A 3H89A 1POPA 2AUZA 4I05A 4NV8A 2FO5A 1CSBB 3P5WA 2FT2A 2Y5BA 2DCCA 1BP4A 2HD5A 2P86A 3IOQA 1EWMA 4Q8HA 3IEJA 3IV2A 1O0EA 3MORA 1VSNA 4BS6A 3KX1A 1YT7A 2WBFX 1NB3A 3N3GA 1PPNA 1YALA 3CBKA 2VHSA 4PADA 5CVNB 2ATOA 2NQIA 4WA6A 4Q8GA 1QDQA 2AYNA 2R9NA 4BSQA 1ITOA 4FJCA 3HWNA 4W4UA 2DZZA 3H8BA 3U8EA 4DMXA 1EWLA 3QT4A 2VFCA 5PADA 2GFOA 1PXVA 4BPVA 2G6DA 3H7DA 2CIOA 2R9FA 1Y08A 4QRGA 1PPPA 1AYWA 1BGOA 2AVWA 4AXLA 1MDWA 1M6DA 3K24A 3OVZA 1CTEA 2XU5A 2F1GA 2JQGR 2G8JA 3CBJA 4YYWA 3V6CA 2DCBA 3QJ3A 1NPZA 1U9WA 1GMYA 3DF0A 1STFE 2AS8A 4C5PA 5K16A 3HHIA 3WXGA 3AI8A 4YYUA 1AYUA 2DJGB 1KFUL 5F02A 3V6EA 1F2AA 1KHQA 1PPDA 4RY2A 1NQCA 2DC8A 4YYRA 1PPOA 2PREA 3I3TA 5J94A 1MEMA 4K7CA 1Q6KA 4FK5A 4KLBA 3KFQA 4MZOA 3RVXA 3HHAA 1AU3A 3S3RA 4CDEB 1TU6A 2FRAA 1F2CA 2OZ2A 2YJ2A 2G7YA 4W5CA 4I04A 1PE6A 4YYVA 2B1MA 2ACTA 3H6SA 2NQDB 1W6FA 1W5RA 2DCAA 3ERVA 1EF7A 4YYQA 4CDDB 3D6SA 1U9XA 1U9VA 2PBHA 2PNSA 3HD3A 3OF9A 1X9YA 4GUZA 1ICFA 2VHFA 3N4CA 3K8UA 1QXPA 2JQFR 1TL9A 1DF0A 1F29A 4P6EA 4BGFA 2F7DA 3MHHA 2P7UA 1CVZA 4OEMA 2R9OA 5FPWA 2CB5A 2HH5A 7PCKA 2HHNA 2R6NA 1W4TA 3P5VA 1HUCB 2YJ9A 3RVVA 3D9WA 1KFXL 1QMYA 1GLOA 1CJLA 4DMYA 2AUXA 1ATKA 2DJFB 1S4VA 2H7JA 4P6GA 2AU1A 3BPFA 3PDFA 4YYSA 1BQIA 3P5XA 1AU4A 4CDFB 3K9MA 1AU2A 2FQ9A 1IWDA 4W5BA 1ZCMA 2AIMA 3M99A 2E03A 1ME4A 3PNRA 1AIMA 3CH2X 2IBIA 4MSXA 3F75A 1Y4HA 4AXMA 1MEGA 1PIPA 3O0UA 2GHUA 9PAPA 2G8EA 3WXEA 4QRXA 3KWBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IUT A;  4XR7 A;  3PW3 A;  2XU1 A;  3OVX A;  1A6R A;  1EWO A;  1MIR A;  3IMA A;  2YJC A;  4CDC B;  2R9C A;  3IHP A;  1SP4 B;  2AYO A;  1GEC E;  2DC6 A;  2FUD A;  4QBB A;  4XUI A;  1BY8 A;  3S3Q A;  2NQA A;  1CQD A;  1KHP A;  3C9E A;  3QSD A;  4FIP A;  1TLO A;  3PBH A;  1AU0 A;  5CHT A;  2ARY A;  2BDZ A;  3KKU A;  2XU4 A;  1YVB A;  4N8W A;  3CH3 X;  4OEL A;  1VJV A;  3BC3 A;  5CVM A;  1CV8 A;  5JA7 A;  4PP1 A;  1PBH A;  2B1N A;  1SNK A;  4YV8 A;  1MHW A;  2DCD A;  2HXZ A;  3NHE A;  1EWP A;  2XU3 A;  1YK7 A;  1YK8 A;  3KSE A;  3WXF A;  4QRV A;  1FH0 A;  3LFY A;  3B79 A;  1NL6 A;  3BWK A;  3N3K A;  1ME3 A;  3LXS A;  3TNX A;  4PI3 A;  3GCB A;  2FTD A;  2E02 A;  2FYE A;  2C0Y A;  2R9M A;  3KW9 A;  8PCH A;  3I06 A;  3BPM A;  1THE A;  4BQV A;  2YJ8 A;  1U9Q X;  4MZS A;  1PAD A;  3RVW A;  2Y6E A;  3ZUA A;  4CZW A;  1XKG A;  3E1Z B;  3OIS A;  4X6H A;  1CPJ A;  5A24 A;  1U5I A;  1CB5 A;  5EGW A;  3USV A;  4PP2 E;  5CHV A;  3OF8 A;  4I07 A;  4N4Z A;  5JH3 A;  3BCN A;  4G54 A;  1F2B A;  1KXR A;  2FRQ A;  1K3B B;  2O6X A;  1ZIV A;  2PAD A;  2E01 A;  2BDL A;  1AEC A;  3MTN A;  4X6J A;  1CS8 A;  2E00 A;  1PCI A;  3O1G A;  3MHS A;  1NLJ A;  3BOW A;  2OP3 A;  4HWY A;  4BS5 A;  1GCB A;  2DC7 A;  1MS6 A;  1QOL A;  5CVO B;  2DC9 A;  4YVA A;  3P5U A;  4ZUX U;  2NQG A;  2DZY A;  2YJB A;  2OUL A;  2P0R A;  4N79 A;  3H8C A;  4QH6 A;  1NB5 A;  6PAD A;  1DEU A;  4X6I A;  3KWZ A;  5EF4 A;  1JQP A;  1AYV A;  3F5V A;  2IPP B;  3H89 A;  1POP A;  2AUZ A;  4I05 A;  2FO5 A;  1CSB B;  3P5W A;  2FT2 A;  2Y5B A;  2DCC A;  1BP4 A;  2HD5 A;  2P86 A;  3IOQ A;  1EWM A;  4Q8H A;  3IEJ A;  3IV2 A;  1O0E A;  3MOR A;  1VSN A;  4BS6 A;  3KX1 A;  1YT7 A;  2WBF X;  1NB3 A;  3N3G A;  1PPN A;  1YAL A;  3CBK A;  2VHS A;  4PAD A;  5CVN B;  2ATO A;  2NQI A;  4WA6 A;  4Q8G A;  1QDQ A;  2AYN A;  2R9N A;  4BSQ A;  1ITO A;  4FJC A;  3HWN A;  4W4U A;  2DZZ A;  3H8B A;  3U8E A;  4DMX A;  1EWL A;  3QT4 A;  5PAD A;  2GFO A;  1PXV A;  4BPV A;  2G6D A;  3H7D A;  2CIO A;  2R9F A;  1Y08 A;  4QRG A;  1PPP A;  1AYW A;  1BGO A;  2AVW A;  4AXL A;  1MDW A;  1M6D A;  3K24 A;  3OVZ A;  1CTE A;  2XU5 A;  2F1G A;  2JQG R;  2G8J A;  3CBJ A;  4YYW A;  3V6C A;  2DCB A;  3QJ3 A;  1NPZ A;  1U9W A;  1GMY A;  3DF0 A;  1STF E;  2AS8 A;  5K16 A;  3HHI A;  3WXG A;  3AI8 A;  4YYU A;  1AYU A;  2DJG B;  1KFU L;  5F02 A;  3V6E A;  1F2A A;  1KHQ A;  1PPD A;  4RY2 A;  1NQC A;  2DC8 A;  4YYR A;  1PPO A;  2PRE A;  3I3T A;  5J94 A;  1MEM A;  4K7C A;  1Q6K A;  4FK5 A;  4KLB A;  3KFQ A;  4MZO A;  3RVX A;  3HHA A;  1AU3 A;  3S3R A;  4CDE B;  1TU6 A;  2FRA A;  1F2C A;  2OZ2 A;  2YJ2 A;  2G7Y A;  4W5C A;  4I04 A;  1PE6 A;  4YYV A;  2B1M A;  2ACT A;  3H6S A;  2NQD B;  2DCA A;  3ERV A;  1EF7 A;  4YYQ A;  4CDD B;  3D6S A;  1U9X A;  1U9V A;  2PBH A;  2PNS A;  3HD3 A;  3OF9 A;  1X9Y A;  1ICF A;  2VHF A;  3N4C A;  3K8U A;  1QXP A;  2JQF R;  1TL9 A;  1DF0 A;  1F29 A;  4P6E A;  2F7D A;  3MHH A;  2P7U A;  1CVZ A;  4OEM A;  2R9O A;  5FPW A;  2CB5 A;  2HH5 A;  7PCK A;  2HHN A;  2R6N A;  3P5V A;  1HUC B;  2YJ9 A;  3RVV A;  1KFX L;  1QMY A;  1GLO A;  1CJL A;  4DMY A;  2AUX A;  1ATK A;  2DJF B;  1S4V A;  2H7J A;  4P6G A;  2AU1 A;  3BPF A;  3PDF A;  4YYS A;  1BQI A;  3P5X A;  1AU4 A;  4CDF B;  3K9M A;  1AU2 A;  2FQ9 A;  1IWD A;  4W5B A;  1ZCM A;  2AIM A;  3M99 A;  2E03 A;  1ME4 A;  3PNR A;  1AIM A;  3CH2 X;  2IBI A;  4MSX A;  3F75 A;  1Y4H A;  4AXM A;  1MEG A;  1PIP A;  3O0U A;  2GHU A;  9PAP A;  2G8E A;  3WXE A;  4QRX A;  3KWB X; 
#chains in the Genus database with same CATH topology
 3IUT A;  4XR7 A;  3PW3 A;  5JZE A;  2XU1 A;  3OVX A;  1A6R A;  1EWO A;  1MIR A;  3IMA A;  4XZX A;  2YJC A;  4CDC B;  2R9C A;  3IHP A;  1SP4 B;  2AYO A;  1GEC E;  2DC6 A;  2FUD A;  3BY4 A;  4QBB A;  4XUI A;  1BY8 A;  4RKX A;  3S3Q A;  2NQA A;  1CQD A;  1KHP A;  3C9E A;  3QSD A;  4FIP A;  1TLO A;  3PBH A;  1AU0 A;  5CHT A;  2ARY A;  2BDZ A;  3KKU A;  2XU4 A;  1YVB A;  4N8W A;  3CH3 X;  3IFU A;  4OEL A;  1VJV A;  3BC3 A;  5CVM A;  1CV8 A;  5JA7 A;  4PP1 A;  1PBH A;  2B1N A;  1SNK A;  4YV8 A;  1MHW A;  2DCD A;  2HXZ A;  3NHE A;  1EWP A;  1PVJ A;  2XU3 A;  1YK7 A;  1YK8 A;  3KSE A;  3WXF A;  4QRV A;  3W30 A;  4BOZ A;  1FH0 A;  3LFY A;  3B79 A;  1NL6 A;  3BWK A;  3N3K A;  1ME3 A;  3LXS A;  3MTV A;  3MP2 A;  3TNX A;  4GUA A;  4PI3 A;  3GCB A;  2FTD A;  3PHU A;  2E02 A;  2FYE A;  2C0Y A;  2R9M A;  3KW9 A;  8PCH A;  3I06 A;  3BPM A;  1THE A;  4RF0 A;  4BQV A;  2YJ8 A;  1U9Q X;  4WUR A;  4MZS A;  1PAD A;  3RVW A;  2FE8 A;  2Y6E A;  3ZUA A;  4CZW A;  1XKG A;  3E1Z B;  3OIS A;  4X6H A;  1CPJ A;  5A24 A;  1U5I A;  1CB5 A;  5EGW A;  3USV A;  4PP2 E;  4OW0 A;  3OF8 A;  5CHV A;  4I07 A;  4N4Z A;  5JH3 A;  3BCN A;  4G54 A;  2Z84 A;  1F2B A;  1KXR A;  2FRQ A;  1K3B B;  2O6X A;  1YZB A;  1ZIV A;  2PAD A;  2E01 A;  2BDL A;  1AEC A;  3MTN A;  4X6J A;  1CS8 A;  3C0R A;  2E00 A;  1PCI A;  3O1G A;  3MHS A;  4MM3 B;  1NLJ A;  3BOW A;  2OP3 A;  4HWY A;  4BS5 A;  1GCB A;  2DC7 A;  3MJ5 A;  1MS6 A;  1QOL A;  5CVO B;  2DC9 A;  4YVA A;  3P5U A;  4ZUX U;  2NQG A;  2DZY A;  2YJB A;  2OUL A;  2P0R A;  2HWK A;  4D8I A;  3E9S A;  4N79 A;  3H8C A;  4QH6 A;  1NB5 A;  6PAD A;  3O65 A;  1DEU A;  4X6I A;  3KWZ A;  5EF4 A;  1JQP A;  4BOQ A;  2AGA A;  4HXD B;  3PT2 A;  1AYV A;  3F5V A;  2IPP B;  2UZJ A;  3H89 A;  1POP A;  2AUZ A;  4I05 A;  2FO5 A;  1CSB B;  3P5W A;  1UKF A;  2FT2 A;  2Y5B A;  3TRK A;  2DCC A;  1BP4 A;  2HD5 A;  2P86 A;  3IOQ A;  1EWM A;  4Q8H A;  3IEJ A;  3IV2 A;  1O0E A;  3MOR A;  1VSN A;  5EZS A;  4BS6 A;  3KX1 A;  1YT7 A;  2WBF X;  1NB3 A;  3N3G A;  4BOP A;  1PPN A;  1YAL A;  3CBK A;  2VHS A;  4PAD A;  5CVN B;  2ATO A;  2NQI A;  4WA6 A;  4Q8G A;  1QDQ A;  2AYN A;  2R9N A;  2BU3 A;  4BSQ A;  5E6J A;  1ITO A;  4FJC A;  3HWN A;  4W4U A;  2DZZ A;  3H8B A;  4D8B A;  4P16 A;  3RNV A;  3U8E A;  4DMX A;  1EWL A;  3QT4 A;  5PAD A;  2GFO A;  1PXV A;  4BPV A;  2G6D A;  4PT5 A;  3H7D A;  2CIO A;  2R9F A;  1Y08 A;  4REZ A;  4QRG A;  1PPP A;  1AYW A;  1BGO A;  2J7Q C;  2AVW A;  4AXL A;  1MDW A;  1M6D A;  3K24 A;  3OVZ A;  1CTE A;  2XU5 A;  2F1G A;  2JQG R;  2G8J A;  3CBJ A;  4RF1 A;  4YYW A;  4M0W A;  3V6C A;  2DCB A;  3QJ3 A;  1NPZ A;  1U9W A;  1GMY A;  3DF0 A;  1STF E;  2AS8 A;  2DOS A;  5K16 A;  3HHI A;  3WXG A;  3AI8 A;  4YYU A;  1AYU A;  2DJG B;  5KO3 A;  1KFU L;  5F02 A;  3V6E A;  4R3D A;  1F2A A;  1KHQ A;  1PPD A;  4RY2 A;  3BB7 A;  1NQC A;  2DC8 A;  4YYR A;  1PPO A;  1DKI A;  2PRE A;  3I3T A;  2JRI A;  5J94 A;  4IP3 A;  3PHX A;  1MEM A;  5EZQ A;  4K7C A;  1Q6K A;  4FK5 A;  4KLB A;  4BOU A;  4BOS A;  2J7Q A;  3KFQ A;  4MZO A;  3RVX A;  3HHA A;  1AU3 A;  3S3R A;  4CDE B;  1TU6 A;  2FRA A;  1F2C A;  2OZ2 A;  4RNA A;  2YJ2 A;  2G7Y A;  4W5C A;  4I04 A;  1PE6 A;  4ZTB A;  4YYV A;  2B1M A;  2ACT A;  3H6S A;  2NQD B;  4MI7 A;  3TMP A;  2JTC A;  2DCA A;  3ERV A;  1EF7 A;  4YYQ A;  4CDD B;  3D6S A;  1U9X A;  1U9V A;  2PBH A;  2PNS A;  3HD3 A;  3OF9 A;  1X9Y A;  1ICF A;  2VHF A;  3N4C A;  3K8U A;  3B21 A;  1QXP A;  2JQF R;  1TL9 A;  4A5U A;  3OQC A;  1DF0 A;  1F29 A;  3PRM A;  4P6E A;  4D8E A;  2F7D A;  3MHH A;  2P7U A;  1CVZ A;  4OEM A;  2R9O A;  3PHW A;  2BTW A;  5FPW A;  3PSE A;  2CB5 A;  2HH5 A;  7PCK A;  2HHN A;  2R6N A;  3P5V A;  1HUC B;  2YJ9 A;  3RVV A;  1KFX L;  1QMY A;  1GLO A;  1CJL A;  4DMY A;  2AUX A;  3PRP A;  1ATK A;  2DJF B;  1S4V A;  2H7J A;  4P6G A;  3W31 A;  2AU1 A;  3BPF A;  3PDF A;  4YYS A;  1BQI A;  2BTW B;  3P5X A;  1AU4 A;  4CDF B;  3K9M A;  1AU2 A;  2FQ9 A;  4OVZ A;  1IWD A;  4W5B A;  4IUM A;  1ZCM A;  2AIM A;  3M99 A;  2E03 A;  1ME4 A;  3PNR A;  3ZNH A;  1AIM A;  3CH2 X;  2IBI A;  4MSX A;  3F75 A;  1Y4H A;  4AXM A;  1MEG A;  1PIP A;  3O0U A;  2GHU A;  9PAP A;  2G8E A;  3WXE A;  4OVZ B;  4QRX A;  3BBA A;  3KWB X; 
#chains in the Genus database with same CATH homology
 3IUT A;  4XR7 A;  3PW3 A;  2XU1 A;  3OVX A;  1A6R A;  1EWO A;  1MIR A;  3IMA A;  2YJC A;  1GX3 A;  2R9C A;  3IHP A;  1SP4 B;  2AYO A;  4CDC B;  1GEC E;  2DC6 A;  2FUD A;  4QBB A;  4XUI A;  1BY8 A;  3S3Q A;  2NQA A;  1CQD A;  1KHP A;  3C9E A;  3QSD A;  4FIP A;  1TLO A;  3PBH A;  1AU0 A;  5CHT A;  2ARY A;  2VFB A;  2BDZ A;  3KKU A;  2XU4 A;  1YVB A;  4N8W A;  3CH3 X;  4OEL A;  1VJV A;  3BC3 A;  5CVM A;  1CV8 A;  5JA7 A;  4PP1 A;  1PBH A;  2B1N A;  1SNK A;  4YV8 A;  1MHW A;  2DCD A;  2HXZ A;  3NHE A;  4B55 A;  1EWP A;  2XU3 A;  1YK7 A;  1YK8 A;  3KSE A;  3WXF A;  4QRV A;  1FH0 A;  3LFY A;  3B79 A;  1NL6 A;  3BWK A;  3N3K A;  1ME3 A;  3LXS A;  3TNX A;  4PI3 A;  3GCB A;  2FTD A;  2E02 A;  2FYE A;  2C0Y A;  2R9M A;  3KW9 A;  8PCH A;  3I06 A;  3BPM A;  1THE A;  4BQV A;  2YJ8 A;  1U9Q X;  4MZS A;  1E2T A;  1PAD A;  3RVW A;  2Y6E A;  3ZUA A;  4CZW A;  3LTW A;  1XKG A;  3E1Z B;  3OIS A;  4X6H A;  1CPJ A;  5A24 A;  1U5I A;  1CB5 A;  5EGW A;  3USV A;  4PP2 E;  5CHV A;  3OF8 A;  4I07 A;  4N4Z A;  5JH3 A;  3BCN A;  4G54 A;  1F2B A;  1KXR A;  2FRQ A;  1K3B B;  2O6X A;  1ZIV A;  2PAD A;  2E01 A;  2BDL A;  1AEC A;  3MTN A;  4X6J A;  1CS8 A;  2E00 A;  1PCI A;  3O1G A;  3MHS A;  1NLJ A;  3BOW A;  2OP3 A;  4HWY A;  2BSZ A;  4BS5 A;  1GCB A;  2DC7 A;  1MS6 A;  1QOL A;  5CVO B;  2DC9 A;  4YVA A;  3P5U A;  4ZUX U;  2NQG A;  2DZY A;  2YJB A;  2OUL A;  2P0R A;  4N79 A;  3H8C A;  4QH6 A;  1NB5 A;  6PAD A;  1DEU A;  4X6I A;  3KWZ A;  5EF4 A;  1JQP A;  1AYV A;  3F5V A;  2IPP B;  4NV7 A;  3H89 A;  1POP A;  2AUZ A;  4I05 A;  4NV8 A;  2FO5 A;  1CSB B;  3P5W A;  2FT2 A;  2Y5B A;  2DCC A;  1BP4 A;  2HD5 A;  2P86 A;  3IOQ A;  1EWM A;  4Q8H A;  3IEJ A;  3IV2 A;  1O0E A;  3MOR A;  1VSN A;  4BS6 A;  3KX1 A;  1YT7 A;  2WBF X;  1NB3 A;  3N3G A;  1PPN A;  1YAL A;  3CBK A;  2VHS A;  4PAD A;  5CVN B;  2ATO A;  2NQI A;  4WA6 A;  4Q8G A;  1QDQ A;  2AYN A;  2R9N A;  4BSQ A;  1ITO A;  4FJC A;  3HWN A;  4W4U A;  2DZZ A;  3H8B A;  3U8E A;  4DMX A;  1EWL A;  3QT4 A;  2VFC A;  5PAD A;  2GFO A;  1PXV A;  4BPV A;  2G6D A;  3H7D A;  2CIO A;  2R9F A;  1Y08 A;  4QRG A;  1PPP A;  1AYW A;  1BGO A;  2AVW A;  4AXL A;  1MDW A;  1M6D A;  3K24 A;  3OVZ A;  1CTE A;  2XU5 A;  2F1G A;  2JQG R;  2G8J A;  3CBJ A;  4YYW A;  3V6C A;  2DCB A;  3QJ3 A;  1NPZ A;  1U9W A;  1GMY A;  3DF0 A;  1STF E;  2AS8 A;  4C5P A;  5K16 A;  3HHI A;  3WXG A;  3AI8 A;  4YYU A;  1AYU A;  2DJG B;  1KFU L;  5F02 A;  3V6E A;  1F2A A;  1KHQ A;  1PPD A;  4RY2 A;  1NQC A;  2DC8 A;  4YYR A;  1PPO A;  2PRE A;  3I3T A;  5J94 A;  1MEM A;  4K7C A;  1Q6K A;  4FK5 A;  4KLB A;  3KFQ A;  4MZO A;  3RVX A;  3HHA A;  1AU3 A;  3S3R A;  4CDE B;  1TU6 A;  2FRA A;  1F2C A;  2OZ2 A;  2YJ2 A;  2G7Y A;  4W5C A;  4I04 A;  1PE6 A;  4YYV A;  2B1M A;  2ACT A;  3H6S A;  2NQD B;  1W6F A;  1W5R A;  2DCA A;  3ERV A;  1EF7 A;  4YYQ A;  4CDD B;  3D6S A;  1U9X A;  1U9V A;  2PBH A;  2PNS A;  3HD3 A;  3OF9 A;  1X9Y A;  4GUZ A;  1ICF A;  2VHF A;  3N4C A;  3K8U A;  1QXP A;  2JQF R;  1TL9 A;  1DF0 A;  1F29 A;  4P6E A;  4BGF A;  2F7D A;  3MHH A;  2P7U A;  1CVZ A;  4OEM A;  2R9O A;  5FPW A;  2CB5 A;  2HH5 A;  7PCK A;  2HHN A;  2R6N A;  1W4T A;  3P5V A;  1HUC B;  2YJ9 A;  3RVV A;  3D9W A;  1KFX L;  1QMY A;  1GLO A;  1CJL A;  4DMY A;  2AUX A;  1ATK A;  2DJF B;  1S4V A;  2H7J A;  4P6G A;  2AU1 A;  3BPF A;  3PDF A;  4YYS A;  1BQI A;  3P5X A;  1AU4 A;  4CDF B;  3K9M A;  1AU2 A;  2FQ9 A;  1IWD A;  4W5B A;  1ZCM A;  2AIM A;  3M99 A;  2E03 A;  1ME4 A;  3PNR A;  1AIM A;  3CH2 X;  2IBI A;  4MSX A;  3F75 A;  1Y4H A;  4AXM A;  1MEG A;  1PIP A;  3O0U A;  2GHU A;  9PAP A;  2G8E A;  3WXE A;  4QRX A;  3KWB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...