1PPDA

Restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (sulfhydryl proteinase)
molecule keywords 2-HYDROXYETHYL-THIOPAPAIN
publication title Restrained Least-Squares Refinement of the Sulfhydryl Protease Papain to 2.0 Angstroms
pubmed rcsb
source organism Carica papaya
total genus 67
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1984-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1ppdA00
3U8EA 2NQDB 3BCNA 2DZYA 1KHQA 4MZSA 1S4VA 4PADA 5PADA 1O0EA 5CVOB 1MHWA 1AU4A 3O1GA 2R9NA 2R6NA 3O0UA 3CBJA 2DCDA 1PADA 2OZ2A 3LXSA 3ERVA 1VSNA 1SNKA 1NQCA 2DC9A 2WBFX 5CHVA 1TL9A 3TNXA 2PADA 2R9MA 1AYWA 1X9YA 5F02A 3I3TA 3BOWA 2NQGA 4N8WA 2YJ2A 1PE6A 3OVXA 1JQPA 3CH3X 4AXLA 3CH2X 4YYVA 3H6SA 5CHTA 1PBHA 1QDQA 5J94A 4G54A 1NLJA 1AYVA 1EWMA 1BP4A 4YYQA 1QXPA 3PDFA 2E00A 4FJCA 4CDCB 4BQVA 4YYWA 2E03A 1F2CA 3QJ3A 1KXRA 3KKUA 2BDLA 3P5VA 1MEMA 3LFYA 3KX1A 3RVXA 3V6CA 3HHAA 3PNRA 1AYUA 1HUCB 1CTEA 1ME4A 2ACTA 2YJBA 6PADA 1GECE 2FTDA 4N4ZA 1NB3A 2Y5BA 1GLOA 1YALA 1ZIVA 3KW9A 3MORA 2XU5A 2XU1A 4WA6A 2PREA 3D6SA 1PCIA 2FQ9A 2P0RA 3IMAA 3S3RA 1CS8A 7PCKA 9PAPA 3P5UA 2PBHA 2BDZA 4W4UA 1M6DA 1SP4B 3QSDA 4CDEB 2AIMA 1MEGA 5FPWA 2G7YA 1CPJA 3GCBA 3MHSA 5CVNB 1GCBA 4CZWA 4YV8A 2AUXA 3P5XA 5A24A 1GMYA 2FRAA 3F5VA 1YK7A 1PPPA 2FYEA 4X6IA 1TU6A 3V6EA 4YYUA 1CJLA 5JH3A 4CDFB 3MHHA 1ITOA 1KHPA 2F1GA 3NHEA 1PPNA 4PP2E 4QRXA 1PIPA 2DC8A 1DF0A 4HWYA 2IPPB 3KFQA 3QT4A 3HWNA 2B1MA 3IHPA 2DJFB 3WXEA 3H7DA 2R9CA 3H8BA 4AXMA 3PBHA 3N3GA 2E02A 2AYOA 1KFUL 1U9WA 1VJVA 2OULA 1CSBB 2AS8A 4I07A 4KLBA 3PW3A 3K9MA 4N79A 1ATKA 1CV8A 1CVZA 3C9EA 3HHIA 2OP3A 3K8UA 2GFOA 2VHSA 1XKGA 2AU1A 3DF0A 1F29A 2JQFR 3KWBX 1QMYA 1AECA 2GHUA 2DCCA 1STFE 4OEMA 3H89A 3KSEA 3OF9A 4XR7A 4QRVA 1K3BB 1ME3A 1MIRA 1F2AA 1QOLA 3IEJA 1U9XA 4FK5A 1YK8A 1AIMA 1YVBA 1ICFA 4YYRA 2ARYA 1ZCMA 4K7CA 2IBIA 1Q6KA 2FUDA 3CBKA 1U5IA 4P6EA 4BPVA 4QH6A 4BS5A 1IWDA 3M99A 4I04A 3H8CA 2DJGB 3OVZA 3OF8A 4MSXA 2G6DA 4XUIA 3BPMA 2JQGR 4BSQA 4X6HA 4CDDB 3WXFA 1AU0A 3IUTA 1PPDA 2B1NA 4W5CA 2G8JA 1POPA 3F75A 3S3QA 3E1ZB 2AYNA 4BS6A 4DMXA 3AI8A 2HHNA 1EWPA 2CB5A 4X6JA 3BC3A 2E01A 1THEA 2AUZA 2P7UA 1YT7A 4I05A 1A6RA 2VHFA 2F7DA 4PP1A 2FT2A 1MS6A 1CB5A 2H7JA 3K24A 1BY8A 1U9QX 2DCBA 1NL6A 2XU4A 2YJ9A 1TLOA 4FIPA 4DMYA 1AU3A 4QRGA 2DZZA 2HD5A 4RY2A 1PPOA 3WXGA 3OISA 2DCAA 3ZUAA 1NPZA 2G8EA 3N3KA 4MZOA 3USVA 2DC6A 8PCHA 2P86A 5CVMA 2YJCA 2C0YA 4OELA 2R9FA 3P5WA 2AVWA 4Q8HA 3BWKA 1AU2A 3MTNA 2YJ8A 1CQDA 3IOQA 5EF4A 2NQIA 4YYSA 1MDWA 2O6XA 3RVWA 5JA7A 1BQIA 2Y6EA 4PI3A 1EWOA 4W5BA 2HXZA 3N4CA 1Y4HA 1BGOA 1FH0A 4P6GA 1PXVA 3B79A 3I06A 1U9VA 4QBBA 5K16A 3BPFA 1EWLA 4ZUXU 3HD3A 1F2BA 3KWZA 3RVVA 4Q8GA 2DC7A 2XU3A 2NQAA 2R9OA 1EF7A 4YVAA 3IV2A 1KFXL 5EGWA 2FO5A 1DEUA 2FRQA 1NB5A 1Y08A 2CIOA 2PNSA 2ATOA 2HH5A
chains in the Genus database with same CATH superfamily
4OW0A 3U8EA 2NQDB 3BCNA 2DZYA 1KHQA 4MZSA 5EZQA 1S4VA 4PADA 5PADA 1O0EA 2BTWA 5CVOB 1MHWA 1AU4A 2J7QA 3O1GA 2R9NA 2R6NA 3O0UA 3CBJA 3BBAA 2DCDA 1PADA 2OZ2A 3LXSA 3ERVA 1VSNA 1SNKA 1NQCA 2DC9A 2WBFX 5CHVA 1TL9A 3TNXA 2PADA 2R9MA 1AYWA 1X9YA 5F02A 3I3TA 3BOWA 2NQGA 4N8WA 2YJ2A 1PE6A 3OVXA 1JQPA 3CH3X 4BOSA 4AXLA 3CH2X 4YYVA 3H6SA 2Z84A 5CHTA 5E6JA 1PBHA 1QDQA 5J94A 4G54A 1NLJA 1AYVA 1EWMA 3PT2A 1BP4A 4YYQA 2HWKA 1QXPA 3PDFA 2E00A 4FJCA 4CDCB 4BQVA 4YYWA 2E03A 1F2CA 3QJ3A 1KXRA 3KKUA 2BDLA 3P5VA 1MEMA 3LFYA 3KX1A 5JZEA 3RVXA 3V6CA 5KO3A 3HHAA 3PNRA 1AYUA 1HUCB 1CTEA 1ME4A 2ACTA 2YJBA 6PADA 1GECE 2FTDA 1PVJA 1NB3A 2Y5BA 1GLOA 4N4ZA 1YALA 1ZIVA 3KW9A 3MORA 2XU5A 2XU1A 4WA6A 2PREA 3D6SA 1PCIA 2FQ9A 2P0RA 3IMAA 3S3RA 1CS8A 3ZNHA 7PCKA 9PAPA 3P5UA 4IP3A 3MTVA 2PBHA 2BDZA 4W4UA 1M6DA 4A5UA 1SP4B 3QSDA 4CDEB 2AIMA 4M0WA 1MEGA 5FPWA 2G7YA 1CPJA 3GCBA 3MHSA 4RKXA 5CVNB 1GCBA 4CZWA 4YV8A 3MP2A 2AUXA 3P5XA 5A24A 1GMYA 2FRAA 3F5VA 1YK7A 1PPPA 2FYEA 4X6IA 1TU6A 3BB7A 3V6EA 4YYUA 1CJLA 5JH3A 4CDFB 3MHHA 4MI7A 1ITOA 1KHPA 2F1GA 3NHEA 1PPNA 4GUAA 4PP2E 4QRXA 1PIPA 2DC8A 1DF0A 4HWYA 4P16A 2IPPB 3KFQA 3QT4A 4RF1A 3HWNA 2B1MA 3IHPA 2DJFB 3WXEA 3H7DA 2R9CA 3H8BA 4AXMA 3PBHA 3N3GA 2E02A 2UZJA 3O65A 2AYOA 1KFUL 1U9WA 3PHWA 1VJVA 2OULA 1CSBB 2AS8A 4I07A 4KLBA 3PW3A 3K9MA 3TMPA 2BTWB 4N79A 1ATKA 1CV8A 1CVZA 3C9EA 3OQCA 3HHIA 2OP3A 4RF0A 3K8UA 2BU3A 4OVZA 2GFOA 2VHSA 1XKGA 2AU1A 3DF0A 3PRPA 3W30A 1F29A 2JQFR 3KWBX 1QMYA 1AECA 2GHUA 4MM3B 2DCCA 1STFE 4OEMA 3H89A 3KSEA 3OF9A 3PHXA 4XR7A 4QRVA 1K3BB 1ME3A 1MIRA 1F2AA 1QOLA 3IEJA 1U9XA 4FK5A 1YK8A 1AIMA 1YVBA 4XZXA 4D8BA 1ICFA 4YYRA 2ARYA 4HXDB 3BY4A 1ZCMA 4K7CA 2IBIA 1Q6KA 2FUDA 3CBKA 1U5IA 4P6EA 4BPVA 4QH6A 4BS5A 1IWDA 4D8EA 4BOZA 3M99A 4I04A 3H8CA 2DJGB 3OVZA 3OF8A 4ZTBA 4MSXA 2G6DA 4XUIA 3W31A 3BPMA 2JQGR 4BSQA 4X6HA 4CDDB 4REZA 3WXFA 1AU0A 3IUTA 3B21A 1PPDA 2B1NA 4W5CA 2G8JA 3C0RA 1POPA 3RNVA 3F75A 3S3QA 3MJ5A 3E1ZB 2AYNA 4BS6A 4DMXA 3AI8A 2HHNA 1EWPA 2CB5A 4X6JA 3BC3A 2E01A 4RNAA 1THEA 2AUZA 2P7UA 4PT5A 1YT7A 3E9SA 4I05A 1A6RA 2VHFA 2F7DA 4PP1A 3IFUA 2FT2A 1MS6A 1CB5A 2FE8A 1UKFA 2H7JA 3K24A 1BY8A 1U9QX 2DCBA 1NL6A 2XU4A 2YJ9A 4IUMA 1TLOA 4FIPA 4DMYA 1AU3A 4QRGA 2DZZA 2HD5A 4RY2A 1PPOA 3WXGA 3OISA 2DCAA 1DKIA 3ZUAA 1NPZA 5EZSA 2G8EA 4WURA 3N3KA 4MZOA 3USVA 3PHUA 2DC6A 8PCHA 2P86A 5CVMA 2AGAA 2YJCA 2C0YA 4OELA 4R3DA 2R9FA 3P5WA 2AVWA 4Q8HA 3BWKA 2DOSA 1AU2A 3MTNA 3PSEA 2YJ8A 3PRMA 1CQDA 3IOQA 5EF4A 2NQIA 4YYSA 1MDWA 4D8IA 4BOQA 2O6XA 3RVWA 5JA7A 1BQIA 2Y6EA 4PI3A 1EWOA 4W5BA 2HXZA 3N4CA 1Y4HA 1BGOA 1FH0A 1YZBA 4P6GA 2JRIA 1PXVA 3B79A 3I06A 2JTCA 1U9VA 4QBBA 5K16A 3BPFA 1EWLA 4ZUXU 3HD3A 1F2BA 4OVZB 3KWZA 4BOPA 3RVVA 4BOUA 2J7QC 4Q8GA 2DC7A 2XU3A 2NQAA 2R9OA 1EF7A 4YVAA 3IV2A 3TRKA 1KFXL 5EGWA 2FO5A 1DEUA 2FRQA 1NB5A 1Y08A 2CIOA 2PNSA 2ATOA 2HH5A
chains in the Genus database with same CATH topology
3U8EA 2NQDB 3BCNA 2DZYA 1KHQA 4MZSA 1S4VA 4PADA 5PADA 1O0EA 5CVOB 1MHWA 1AU4A 3O1GA 2R9NA 2R6NA 3O0UA 4C5PA 3CBJA 2DCDA 1PADA 2OZ2A 3LXSA 3ERVA 1VSNA 1SNKA 1NQCA 2DC9A 2WBFX 5CHVA 1TL9A 3TNXA 2PADA 2R9MA 1AYWA 1X9YA 5F02A 3I3TA 3BOWA 2NQGA 4N8WA 2YJ2A 1PE6A 3OVXA 1JQPA 3CH3X 4AXLA 3CH2X 2VFBA 4YYVA 3H6SA 5CHTA 1PBHA 1QDQA 5J94A 4G54A 1NLJA 1AYVA 1EWMA 1BP4A 4YYQA 1QXPA 3PDFA 2E00A 4FJCA 4CDCB 4BQVA 4YYWA 2E03A 1F2CA 3QJ3A 1KXRA 3KKUA 2BDLA 3P5VA 1MEMA 3LFYA 3KX1A 3RVXA 3V6CA 3HHAA 3PNRA 1AYUA 1HUCB 1CTEA 1ME4A 2ACTA 2YJBA 6PADA 1GECE 2FTDA 4N4ZA 1NB3A 2Y5BA 1GLOA 1YALA 1ZIVA 3KW9A 3MORA 2XU5A 2XU1A 4WA6A 2PREA 3D6SA 1PCIA 2FQ9A 2P0RA 3IMAA 3S3RA 1CS8A 7PCKA 9PAPA 3P5UA 4NV7A 2PBHA 2BDZA 4W4UA 1M6DA 1SP4B 3QSDA 4CDEB 2AIMA 3D9WA 1MEGA 5FPWA 2G7YA 1CPJA 3GCBA 3MHSA 5CVNB 1GCBA 4CZWA 4YV8A 2AUXA 3P5XA 5A24A 1GMYA 2FRAA 3F5VA 1YK7A 1PPPA 2FYEA 4X6IA 1TU6A 3V6EA 4YYUA 1CJLA 5JH3A 4CDFB 3MHHA 1ITOA 1KHPA 2F1GA 3NHEA 1PPNA 4PP2E 4QRXA 1PIPA 2DC8A 4GUZA 1DF0A 4HWYA 1W6FA 2IPPB 3KFQA 3QT4A 3HWNA 2B1MA 3IHPA 2DJFB 3WXEA 3H7DA 2R9CA 3H8BA 4AXMA 2VFCA 3PBHA 3N3GA 2E02A 2AYOA 1KFUL 1U9WA 1VJVA 2OULA 1CSBB 2AS8A 4I07A 4KLBA 3PW3A 3K9MA 4N79A 1ATKA 1CV8A 1CVZA 3C9EA 3HHIA 1W5RA 2OP3A 3K8UA 4NV8A 2GFOA 2VHSA 1XKGA 2AU1A 3DF0A 1F29A 2JQFR 3KWBX 1QMYA 1AECA 2GHUA 2DCCA 1STFE 4OEMA 3H89A 3KSEA 3OF9A 4XR7A 4QRVA 1K3BB 1ME3A 1MIRA 1F2AA 1W4TA 1QOLA 3IEJA 1U9XA 4FK5A 1YK8A 1AIMA 1YVBA 1ICFA 4YYRA 2ARYA 1ZCMA 4K7CA 2IBIA 1Q6KA 2FUDA 3CBKA 1U5IA 4P6EA 4BPVA 4QH6A 4BS5A 1IWDA 3M99A 4I04A 3H8CA 2DJGB 3OVZA 3OF8A 4MSXA 2G6DA 4XUIA 3BPMA 2JQGR 4BSQA 4X6HA 4CDDB 3WXFA 1AU0A 3IUTA 1GX3A 1PPDA 2B1NA 4W5CA 2G8JA 1POPA 3F75A 3S3QA 3E1ZB 2AYNA 4BS6A 4DMXA 3AI8A 2HHNA 1EWPA 2CB5A 4X6JA 3BC3A 2E01A 1THEA 2AUZA 2P7UA 1E2TA 1YT7A 4I05A 1A6RA 2VHFA 2F7DA 4PP1A 2FT2A 1MS6A 1CB5A 2H7JA 3K24A 1BY8A 1U9QX 2DCBA 1NL6A 2XU4A 2YJ9A 1TLOA 4FIPA 4DMYA 1AU3A 4QRGA 2DZZA 2HD5A 4RY2A 1PPOA 3WXGA 3OISA 2DCAA 3ZUAA 1NPZA 2G8EA 3N3KA 4MZOA 3USVA 2DC6A 8PCHA 2P86A 5CVMA 2YJCA 2C0YA 4OELA 2R9FA 3P5WA 2AVWA 4Q8HA 3BWKA 1AU2A 3MTNA 2YJ8A 1CQDA 3IOQA 5EF4A 2NQIA 4YYSA 1MDWA 2O6XA 3RVWA 5JA7A 1BQIA 2Y6EA 4PI3A 1EWOA 4W5BA 2HXZA 3N4CA 1Y4HA 1BGOA 1FH0A 4P6GA 1PXVA 3B79A 3I06A 1U9VA 4QBBA 5K16A 3BPFA 1EWLA 4ZUXU 3HD3A 4B55A 4BGFA 1F2BA 3KWZA 3RVVA 4Q8GA 2DC7A 2XU3A 2NQAA 2R9OA 1EF7A 4YVAA 3IV2A 1KFXL 5EGWA 2FO5A 1DEUA 2BSZA 2FRQA 1NB5A 3LTWA 1Y08A 2CIOA 2PNSA 2ATOA 2HH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8E A;  2NQD B;  3BCN A;  2DZY A;  1KHQ A;  4MZS A;  1S4V A;  4PAD A;  5PAD A;  1O0E A;  5CVO B;  1MHW A;  1AU4 A;  3O1G A;  2R9N A;  2R6N A;  3O0U A;  3CBJ A;  2DCD A;  1PAD A;  2OZ2 A;  3LXS A;  3ERV A;  1VSN A;  1SNK A;  1NQC A;  2DC9 A;  2WBF X;  5CHV A;  1TL9 A;  3TNX A;  2PAD A;  2R9M A;  1AYW A;  1X9Y A;  5F02 A;  3I3T A;  3BOW A;  2NQG A;  4N8W A;  2YJ2 A;  1PE6 A;  3OVX A;  1JQP A;  3CH3 X;  4AXL A;  3CH2 X;  4YYV A;  3H6S A;  5CHT A;  1PBH A;  1QDQ A;  5J94 A;  4G54 A;  1NLJ A;  1AYV A;  1EWM A;  1BP4 A;  4YYQ A;  1QXP A;  3PDF A;  2E00 A;  4FJC A;  4CDC B;  4BQV A;  4YYW A;  2E03 A;  1F2C A;  3QJ3 A;  1KXR A;  3KKU A;  2BDL A;  3P5V A;  1MEM A;  3LFY A;  3KX1 A;  3RVX A;  3V6C A;  3HHA A;  3PNR A;  1AYU A;  1HUC B;  1CTE A;  1ME4 A;  2ACT A;  2YJB A;  6PAD A;  1GEC E;  2FTD A;  4N4Z A;  1NB3 A;  2Y5B A;  1GLO A;  1YAL A;  1ZIV A;  3KW9 A;  3MOR A;  2XU5 A;  2XU1 A;  4WA6 A;  2PRE A;  3D6S A;  1PCI A;  2FQ9 A;  2P0R A;  3IMA A;  3S3R A;  1CS8 A;  7PCK A;  9PAP A;  3P5U A;  2PBH A;  2BDZ A;  4W4U A;  1M6D A;  1SP4 B;  3QSD A;  4CDE B;  2AIM A;  1MEG A;  5FPW A;  2G7Y A;  1CPJ A;  3GCB A;  3MHS A;  5CVN B;  1GCB A;  4CZW A;  4YV8 A;  2AUX A;  3P5X A;  5A24 A;  1GMY A;  2FRA A;  3F5V A;  1YK7 A;  1PPP A;  2FYE A;  4X6I A;  1TU6 A;  3V6E A;  4YYU A;  1CJL A;  5JH3 A;  4CDF B;  3MHH A;  1ITO A;  1KHP A;  2F1G A;  3NHE A;  1PPN A;  4PP2 E;  4QRX A;  1PIP A;  2DC8 A;  1DF0 A;  4HWY A;  2IPP B;  3KFQ A;  3QT4 A;  3HWN A;  2B1M A;  3IHP A;  2DJF B;  3WXE A;  3H7D A;  2R9C A;  3H8B A;  4AXM A;  3PBH A;  3N3G A;  2E02 A;  2AYO A;  1KFU L;  1U9W A;  1VJV A;  2OUL A;  1CSB B;  2AS8 A;  4I07 A;  4KLB A;  3PW3 A;  3K9M A;  4N79 A;  1ATK A;  1CV8 A;  1CVZ A;  3C9E A;  3HHI A;  2OP3 A;  3K8U A;  2GFO A;  2VHS A;  1XKG A;  2AU1 A;  3DF0 A;  1F29 A;  2JQF R;  3KWB X;  1QMY A;  1AEC A;  2GHU A;  2DCC A;  1STF E;  4OEM A;  3H89 A;  3KSE A;  3OF9 A;  4XR7 A;  4QRV A;  1K3B B;  1ME3 A;  1MIR A;  1F2A A;  1QOL A;  3IEJ A;  1U9X A;  4FK5 A;  1YK8 A;  1AIM A;  1YVB A;  1ICF A;  4YYR A;  2ARY A;  1ZCM A;  4K7C A;  2IBI A;  1Q6K A;  2FUD A;  3CBK A;  1U5I A;  4P6E A;  4BPV A;  4QH6 A;  4BS5 A;  1IWD A;  3M99 A;  4I04 A;  3H8C A;  2DJG B;  3OVZ A;  3OF8 A;  4MSX A;  2G6D A;  4XUI A;  3BPM A;  2JQG R;  4BSQ A;  4X6H A;  4CDD B;  3WXF A;  1AU0 A;  3IUT A;  1PPD A;  2B1N A;  4W5C A;  2G8J A;  1POP A;  3F75 A;  3S3Q A;  3E1Z B;  2AYN A;  4BS6 A;  4DMX A;  3AI8 A;  2HHN A;  1EWP A;  2CB5 A;  4X6J A;  3BC3 A;  2E01 A;  1THE A;  2AUZ A;  2P7U A;  1YT7 A;  4I05 A;  1A6R A;  2VHF A;  2F7D A;  4PP1 A;  2FT2 A;  1MS6 A;  1CB5 A;  2H7J A;  3K24 A;  1BY8 A;  1U9Q X;  2DCB A;  1NL6 A;  2XU4 A;  2YJ9 A;  1TLO A;  4FIP A;  4DMY A;  1AU3 A;  4QRG A;  2DZZ A;  2HD5 A;  4RY2 A;  1PPO A;  3WXG A;  3OIS A;  2DCA A;  3ZUA A;  1NPZ A;  2G8E A;  3N3K A;  4MZO A;  3USV A;  2DC6 A;  8PCH A;  2P86 A;  5CVM A;  2YJC A;  2C0Y A;  4OEL A;  2R9F A;  3P5W A;  2AVW A;  4Q8H A;  3BWK A;  1AU2 A;  3MTN A;  2YJ8 A;  1CQD A;  3IOQ A;  5EF4 A;  2NQI A;  4YYS A;  1MDW A;  2O6X A;  3RVW A;  5JA7 A;  1BQI A;  2Y6E A;  4PI3 A;  1EWO A;  4W5B A;  2HXZ A;  3N4C A;  1Y4H A;  1BGO A;  1FH0 A;  4P6G A;  1PXV A;  3B79 A;  3I06 A;  1U9V A;  4QBB A;  5K16 A;  3BPF A;  1EWL A;  4ZUX U;  3HD3 A;  1F2B A;  3KWZ A;  3RVV A;  4Q8G A;  2DC7 A;  2XU3 A;  2NQA A;  2R9O A;  1EF7 A;  4YVA A;  3IV2 A;  1KFX L;  5EGW A;  2FO5 A;  1DEU A;  2FRQ A;  1NB5 A;  1Y08 A;  2CIO A;  2PNS A;  2ATO A;  2HH5 A; 
#chains in the Genus database with same CATH topology
 4OW0 A;  3U8E A;  2NQD B;  3BCN A;  2DZY A;  1KHQ A;  4MZS A;  5EZQ A;  1S4V A;  4PAD A;  5PAD A;  1O0E A;  2BTW A;  5CVO B;  1MHW A;  1AU4 A;  2J7Q A;  3O1G A;  2R9N A;  2R6N A;  3O0U A;  3CBJ A;  3BBA A;  2DCD A;  1PAD A;  2OZ2 A;  3LXS A;  3ERV A;  1VSN A;  1SNK A;  1NQC A;  2DC9 A;  2WBF X;  5CHV A;  1TL9 A;  3TNX A;  2PAD A;  2R9M A;  1AYW A;  1X9Y A;  5F02 A;  3I3T A;  3BOW A;  2NQG A;  4N8W A;  2YJ2 A;  1PE6 A;  3OVX A;  1JQP A;  3CH3 X;  4BOS A;  4AXL A;  3CH2 X;  4YYV A;  3H6S A;  2Z84 A;  5CHT A;  5E6J A;  1PBH A;  1QDQ A;  5J94 A;  4G54 A;  1NLJ A;  1AYV A;  1EWM A;  3PT2 A;  1BP4 A;  4YYQ A;  2HWK A;  1QXP A;  3PDF A;  2E00 A;  4FJC A;  4CDC B;  4BQV A;  4YYW A;  2E03 A;  1F2C A;  3QJ3 A;  1KXR A;  3KKU A;  2BDL A;  3P5V A;  1MEM A;  3LFY A;  3KX1 A;  5JZE A;  3RVX A;  3V6C A;  5KO3 A;  3HHA A;  3PNR A;  1AYU A;  1HUC B;  1CTE A;  1ME4 A;  2ACT A;  2YJB A;  6PAD A;  1GEC E;  2FTD A;  1PVJ A;  1NB3 A;  2Y5B A;  1GLO A;  4N4Z A;  1YAL A;  1ZIV A;  3KW9 A;  3MOR A;  2XU5 A;  2XU1 A;  4WA6 A;  2PRE A;  3D6S A;  1PCI A;  2FQ9 A;  2P0R A;  3IMA A;  3S3R A;  1CS8 A;  3ZNH A;  7PCK A;  9PAP A;  3P5U A;  4IP3 A;  3MTV A;  2PBH A;  2BDZ A;  4W4U A;  1M6D A;  4A5U A;  1SP4 B;  3QSD A;  4CDE B;  2AIM A;  4M0W A;  1MEG A;  5FPW A;  2G7Y A;  1CPJ A;  3GCB A;  3MHS A;  4RKX A;  5CVN B;  1GCB A;  4CZW A;  4YV8 A;  3MP2 A;  2AUX A;  3P5X A;  5A24 A;  1GMY A;  2FRA A;  3F5V A;  1YK7 A;  1PPP A;  2FYE A;  4X6I A;  1TU6 A;  3BB7 A;  3V6E A;  4YYU A;  1CJL A;  5JH3 A;  4CDF B;  3MHH A;  4MI7 A;  1ITO A;  1KHP A;  2F1G A;  3NHE A;  1PPN A;  4GUA A;  4PP2 E;  4QRX A;  1PIP A;  2DC8 A;  1DF0 A;  4HWY A;  4P16 A;  2IPP B;  3KFQ A;  3QT4 A;  4RF1 A;  3HWN A;  2B1M A;  3IHP A;  2DJF B;  3WXE A;  3H7D A;  2R9C A;  3H8B A;  4AXM A;  3PBH A;  3N3G A;  2E02 A;  2UZJ A;  3O65 A;  2AYO A;  1KFU L;  1U9W A;  3PHW A;  1VJV A;  2OUL A;  1CSB B;  2AS8 A;  4I07 A;  4KLB A;  3PW3 A;  3K9M A;  3TMP A;  2BTW B;  4N79 A;  1ATK A;  1CV8 A;  1CVZ A;  3C9E A;  3OQC A;  3HHI A;  2OP3 A;  4RF0 A;  3K8U A;  2BU3 A;  4OVZ A;  2GFO A;  2VHS A;  1XKG A;  2AU1 A;  3DF0 A;  3PRP A;  3W30 A;  1F29 A;  2JQF R;  3KWB X;  1QMY A;  1AEC A;  2GHU A;  4MM3 B;  2DCC A;  1STF E;  4OEM A;  3H89 A;  3KSE A;  3OF9 A;  3PHX A;  4XR7 A;  4QRV A;  1K3B B;  1ME3 A;  1MIR A;  1F2A A;  1QOL A;  3IEJ A;  1U9X A;  4FK5 A;  1YK8 A;  1AIM A;  1YVB A;  4XZX A;  4D8B A;  1ICF A;  4YYR A;  2ARY A;  4HXD B;  3BY4 A;  1ZCM A;  4K7C A;  2IBI A;  1Q6K A;  2FUD A;  3CBK A;  1U5I A;  4P6E A;  4BPV A;  4QH6 A;  4BS5 A;  1IWD A;  4D8E A;  4BOZ A;  3M99 A;  4I04 A;  3H8C A;  2DJG B;  3OVZ A;  3OF8 A;  4ZTB A;  4MSX A;  2G6D A;  4XUI A;  3W31 A;  3BPM A;  2JQG R;  4BSQ A;  4X6H A;  4CDD B;  4REZ A;  3WXF A;  1AU0 A;  3IUT A;  3B21 A;  1PPD A;  2B1N A;  4W5C A;  2G8J A;  3C0R A;  1POP A;  3RNV A;  3F75 A;  3S3Q A;  3MJ5 A;  3E1Z B;  2AYN A;  4BS6 A;  4DMX A;  3AI8 A;  2HHN A;  1EWP A;  2CB5 A;  4X6J A;  3BC3 A;  2E01 A;  4RNA A;  1THE A;  2AUZ A;  2P7U A;  4PT5 A;  1YT7 A;  3E9S A;  4I05 A;  1A6R A;  2VHF A;  2F7D A;  4PP1 A;  3IFU A;  2FT2 A;  1MS6 A;  1CB5 A;  2FE8 A;  1UKF A;  2H7J A;  3K24 A;  1BY8 A;  1U9Q X;  2DCB A;  1NL6 A;  2XU4 A;  2YJ9 A;  4IUM A;  1TLO A;  4FIP A;  4DMY A;  1AU3 A;  4QRG A;  2DZZ A;  2HD5 A;  4RY2 A;  1PPO A;  3WXG A;  3OIS A;  2DCA A;  1DKI A;  3ZUA A;  1NPZ A;  5EZS A;  2G8E A;  4WUR A;  3N3K A;  4MZO A;  3USV A;  3PHU A;  2DC6 A;  8PCH A;  2P86 A;  5CVM A;  2AGA A;  2YJC A;  2C0Y A;  4OEL A;  4R3D A;  2R9F A;  3P5W A;  2AVW A;  4Q8H A;  3BWK A;  2DOS A;  1AU2 A;  3MTN A;  3PSE A;  2YJ8 A;  3PRM A;  1CQD A;  3IOQ A;  5EF4 A;  2NQI A;  4YYS A;  1MDW A;  4D8I A;  4BOQ A;  2O6X A;  3RVW A;  5JA7 A;  1BQI A;  2Y6E A;  4PI3 A;  1EWO A;  4W5B A;  2HXZ A;  3N4C A;  1Y4H A;  1BGO A;  1FH0 A;  1YZB A;  4P6G A;  2JRI A;  1PXV A;  3B79 A;  3I06 A;  2JTC A;  1U9V A;  4QBB A;  5K16 A;  3BPF A;  1EWL A;  4ZUX U;  3HD3 A;  1F2B A;  4OVZ B;  3KWZ A;  4BOP A;  3RVV A;  4BOU A;  2J7Q C;  4Q8G A;  2DC7 A;  2XU3 A;  2NQA A;  2R9O A;  1EF7 A;  4YVA A;  3IV2 A;  3TRK A;  1KFX L;  5EGW A;  2FO5 A;  1DEU A;  2FRQ A;  1NB5 A;  1Y08 A;  2CIO A;  2PNS A;  2ATO A;  2HH5 A; 
#chains in the Genus database with same CATH homology
 3U8E A;  2NQD B;  3BCN A;  2DZY A;  1KHQ A;  4MZS A;  1S4V A;  4PAD A;  5PAD A;  1O0E A;  5CVO B;  1MHW A;  1AU4 A;  3O1G A;  2R9N A;  2R6N A;  3O0U A;  4C5P A;  3CBJ A;  2DCD A;  1PAD A;  2OZ2 A;  3LXS A;  3ERV A;  1VSN A;  1SNK A;  1NQC A;  2DC9 A;  2WBF X;  5CHV A;  1TL9 A;  3TNX A;  2PAD A;  2R9M A;  1AYW A;  1X9Y A;  5F02 A;  3I3T A;  3BOW A;  2NQG A;  4N8W A;  2YJ2 A;  1PE6 A;  3OVX A;  1JQP A;  3CH3 X;  4AXL A;  3CH2 X;  2VFB A;  4YYV A;  3H6S A;  5CHT A;  1PBH A;  1QDQ A;  5J94 A;  4G54 A;  1NLJ A;  1AYV A;  1EWM A;  1BP4 A;  4YYQ A;  1QXP A;  3PDF A;  2E00 A;  4FJC A;  4CDC B;  4BQV A;  4YYW A;  2E03 A;  1F2C A;  3QJ3 A;  1KXR A;  3KKU A;  2BDL A;  3P5V A;  1MEM A;  3LFY A;  3KX1 A;  3RVX A;  3V6C A;  3HHA A;  3PNR A;  1AYU A;  1HUC B;  1CTE A;  1ME4 A;  2ACT A;  2YJB A;  6PAD A;  1GEC E;  2FTD A;  4N4Z A;  1NB3 A;  2Y5B A;  1GLO A;  1YAL A;  1ZIV A;  3KW9 A;  3MOR A;  2XU5 A;  2XU1 A;  4WA6 A;  2PRE A;  3D6S A;  1PCI A;  2FQ9 A;  2P0R A;  3IMA A;  3S3R A;  1CS8 A;  7PCK A;  9PAP A;  3P5U A;  4NV7 A;  2PBH A;  2BDZ A;  4W4U A;  1M6D A;  1SP4 B;  3QSD A;  4CDE B;  2AIM A;  3D9W A;  1MEG A;  5FPW A;  2G7Y A;  1CPJ A;  3GCB A;  3MHS A;  5CVN B;  1GCB A;  4CZW A;  4YV8 A;  2AUX A;  3P5X A;  5A24 A;  1GMY A;  2FRA A;  3F5V A;  1YK7 A;  1PPP A;  2FYE A;  4X6I A;  1TU6 A;  3V6E A;  4YYU A;  1CJL A;  5JH3 A;  4CDF B;  3MHH A;  1ITO A;  1KHP A;  2F1G A;  3NHE A;  1PPN A;  4PP2 E;  4QRX A;  1PIP A;  2DC8 A;  4GUZ A;  1DF0 A;  4HWY A;  1W6F A;  2IPP B;  3KFQ A;  3QT4 A;  3HWN A;  2B1M A;  3IHP A;  2DJF B;  3WXE A;  3H7D A;  2R9C A;  3H8B A;  4AXM A;  2VFC A;  3PBH A;  3N3G A;  2E02 A;  2AYO A;  1KFU L;  1U9W A;  1VJV A;  2OUL A;  1CSB B;  2AS8 A;  4I07 A;  4KLB A;  3PW3 A;  3K9M A;  4N79 A;  1ATK A;  1CV8 A;  1CVZ A;  3C9E A;  3HHI A;  1W5R A;  2OP3 A;  3K8U A;  4NV8 A;  2GFO A;  2VHS A;  1XKG A;  2AU1 A;  3DF0 A;  1F29 A;  2JQF R;  3KWB X;  1QMY A;  1AEC A;  2GHU A;  2DCC A;  1STF E;  4OEM A;  3H89 A;  3KSE A;  3OF9 A;  4XR7 A;  4QRV A;  1K3B B;  1ME3 A;  1MIR A;  1F2A A;  1W4T A;  1QOL A;  3IEJ A;  1U9X A;  4FK5 A;  1YK8 A;  1AIM A;  1YVB A;  1ICF A;  4YYR A;  2ARY A;  1ZCM A;  4K7C A;  2IBI A;  1Q6K A;  2FUD A;  3CBK A;  1U5I A;  4P6E A;  4BPV A;  4QH6 A;  4BS5 A;  1IWD A;  3M99 A;  4I04 A;  3H8C A;  2DJG B;  3OVZ A;  3OF8 A;  4MSX A;  2G6D A;  4XUI A;  3BPM A;  2JQG R;  4BSQ A;  4X6H A;  4CDD B;  3WXF A;  1AU0 A;  3IUT A;  1GX3 A;  1PPD A;  2B1N A;  4W5C A;  2G8J A;  1POP A;  3F75 A;  3S3Q A;  3E1Z B;  2AYN A;  4BS6 A;  4DMX A;  3AI8 A;  2HHN A;  1EWP A;  2CB5 A;  4X6J A;  3BC3 A;  2E01 A;  1THE A;  2AUZ A;  2P7U A;  1E2T A;  1YT7 A;  4I05 A;  1A6R A;  2VHF A;  2F7D A;  4PP1 A;  2FT2 A;  1MS6 A;  1CB5 A;  2H7J A;  3K24 A;  1BY8 A;  1U9Q X;  2DCB A;  1NL6 A;  2XU4 A;  2YJ9 A;  1TLO A;  4FIP A;  4DMY A;  1AU3 A;  4QRG A;  2DZZ A;  2HD5 A;  4RY2 A;  1PPO A;  3WXG A;  3OIS A;  2DCA A;  3ZUA A;  1NPZ A;  2G8E A;  3N3K A;  4MZO A;  3USV A;  2DC6 A;  8PCH A;  2P86 A;  5CVM A;  2YJC A;  2C0Y A;  4OEL A;  2R9F A;  3P5W A;  2AVW A;  4Q8H A;  3BWK A;  1AU2 A;  3MTN A;  2YJ8 A;  1CQD A;  3IOQ A;  5EF4 A;  2NQI A;  4YYS A;  1MDW A;  2O6X A;  3RVW A;  5JA7 A;  1BQI A;  2Y6E A;  4PI3 A;  1EWO A;  4W5B A;  2HXZ A;  3N4C A;  1Y4H A;  1BGO A;  1FH0 A;  4P6G A;  1PXV A;  3B79 A;  3I06 A;  1U9V A;  4QBB A;  5K16 A;  3BPF A;  1EWL A;  4ZUX U;  3HD3 A;  4B55 A;  4BGF A;  1F2B A;  3KWZ A;  3RVV A;  4Q8G A;  2DC7 A;  2XU3 A;  2NQA A;  2R9O A;  1EF7 A;  4YVA A;  3IV2 A;  1KFX L;  5EGW A;  2FO5 A;  1DEU A;  2BSZ A;  2FRQ A;  1NB5 A;  3LTW A;  1Y08 A;  2CIO A;  2PNS A;  2ATO A;  2HH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...