1YZBA

Solution structure of the josephin domain of ataxin-3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Machado-Joseph disease protein 1
total genus 48
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1yzbA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1yzbA01
5H5NA 4DV2O 4KHPO 1HNWO 1N33O 3RT3C 2DOSA 4DV0O 4B3MO 2JRIA 5LMUO 1N32O 1HNZO 4DV6O 1N36O 4DR3O 4X64O 2UXCO 3M8AA 2F4VO 4DUZO 1R6TA 1A32A 1X59A 1YZBA 1XMOO 2UXDO 3O65A 4JI1O 4OPHA 4DR2O 4X62O 4LF4O 1XNQO 4B3TO 5BY1A 2ZKOA 4LF9O 2Z0AA 4DR7O 4DV3O 4LF8O 2N74A 4LF6O 4JV5O 1HR0O 4JI2O 1J5EO 2UU9O 1AILA 5FLXN 3R66A 4JI8O 1FJGO 4OX9O 4DV5O 4LFAO 2FKXA 4X66O 2VQEO 1F7YA 1NS1A 4X65O 4DUYO 4LF5O 1I94O 4NXMO 4DV4O 4YY3O 4LFCO 3T1YO 4JI3O 4JI7O 1N34O 4YHHO 2UXBO 1HNXO 1R1BA 4LFBO 1AB3A 4NXNO 4JI4O 1KUQA 4LF7O 4JI6O 4DR6O 3J81N 1IBMO 2DJVA 4OPAA 1FKAO 2UUBO 3T1HO 4B3SO 4GKJO 5BXZA 2VQFO 4A5UB 3SDLA 3JAMN 2E5LO 4K0KO 3J80N 2AGAA 4DR1O 1D2DA 2UUAO 1XMQO 4JI5O 4DV7O 2ZM6O 5LMNO 3OTOO 1G1XB 4DR4O 1IBLO 4JI0O 3J7AU 4AQYO 1IBKO 2LW7A 3F5TA 5IWAO 4DV1O 1XEQA 4JYAO 4GKKO 1XNRO 4B3RO 5BR8O 2UUCO 1FYJA 2HHHO 1DK1A 5A2QN 4DR5O 5IT9N 5LL6Y
chains in the Genus database with same CATH superfamily
3SJCC 2XAQA 1X4TA 1BZKA 3U10A 2QWPB 3RYIB 1H38A 5FNVA 3OTOB 3JALB 2CGNA 2R9MA 1QNMA 3ABKB 1HNZO 1PNKA 2IJIA 1R6TA 4YIOA 4HNAB 3JCZA 2PREA 4PHZA 3O65A 5KX5A 3ASOC 4LNUA 4PA7A 1TU6A 5EC2C 2Q69A 3MAQA 1T5EA 2A3QA 1ME4A 1UFIA 2G8EA 2W6IG 3T4ZA 1NBMG 3A0RA 1BQIA 2FB5A 3FFQA 4C7UA 1MG1A 3TXQA 1Q86W 3C0RA 1IVSA 2E3CA 1LNQA 3KG2A 4BOPA 1Q90D 1S5HC 2F66C 3ZRWA 1YIJV 1V55B 1U9WA 2YJCA 3BC3A 3D8CA 4H37A 1N34B 3MDSA 1QVGU 3JD4A 1B06A 3CCEV 1PPOA 3KX1A 3JASA 4GUNA 2K1EA 3CMAV 4O2AA 2HVJC 2Q4PA 3X2QC 2YJ8A 4NXNO 1U9VA 2CH7A 4LF7O 2LFSA 2K9PA 1PPPA 3L71H 3WG7C 1VQ4V 3OUSA 1O9GA 4G2KA 3EFFK 4BWAA 1AP6A 4WBNB 5EYPA 4OGQB 5D5QA 1DF0A 1WA8A 4YJ3A 3MORA 2OTLV 4PELA 1XMQO 4EFBA 4FFBA 4ASUG 4ZBMA 3BCNA 1JQ0A 4DMYA 1IBMB 2HVKC 3RN4A 5KA5A 4K35A 3STLC 3TRKA 3SJBC 3H7DA 4JYAO 3TGUH 3MD0A 1MZEA 2WAMA 2UXDB 2FMLA 3K79A 3B4SA 3PSEA 4J41A 3E35A 2BDLA 1MNGA 1M5IA 2UUCB 1DK1A 1KBHA 5IT9N 4BOQA 4MM3B 1AR5A 1OCZC 4LF4B 3IC7A 1FFTB 2YJ2A 2ZCEA 1BHBA 3HHIA 4PV1B 5JH7A 1H2KA 1KECA 5IJ9A 3I5DA 2EILB 2H7JA 3JD2A 5CVNB 1M57C 4MVMA 3P5XA 1X59A 4Q6GA 1JOYA 5JJJB 1D5AA 1H2LA 1L8DA 2XOKG 3IV2A 3ASNB 1KXRA 1XL4A 1Y74A 3K59A 4LF9O 4E4EA 5LXTA 3O1GA 1XMOB 2YXLA 3CX5F 4LF9B 2QWNB 2X0LA 2N04A 1AJPA 4TQFA 3JD1A 2UXXA 3WXFA 4MZSA 3W30A 2CH7B 2IH1C 3ABMB 5JQGA 2ZIMA 3W7XA 1YJNV 2JIZG 4KL1A 3A2FA 4LP8A 2HLDG 2UXBB 1SNKA 3JASB 1PV0A 4ZHQB 3QO5A 1VEWA 1QXPA 2DE0X 4NXMB 3TMPA 2A06H 2EILC 4MVUA 4RAIA 4YIPA 4YYVA 2KKWA 1M57B 4JYYA 4UCRA 3V6EA 2HJFC 3IFXA 3MP2A 3TK1A 4DW0A 3JARA 2CGOA 3K9AA 1FAFA 2HFEC 3OF9A 3RYHA 2B9ZA 5IE9A 2V1DA 2OIEA 2E03A 2YEVA 4GKKB 1ICFA 1OCRB 4QJFB 3S3XA 4RUFA 4LF5B 1N8RW 2FTKA 4JI5O 5LXTB 1M56B 1W0KG 3CRRA 1GM9A 3W7TA 5B5EZ 4FK5A 3EXAA 3N4CA 5LGNA 5J2UB 1K7DA 3F5VA 4DV1O 3OMAB 1MEMA 4M0WA 5LHGA 2PY5A 1QHTA 3JAWA 4DK1A 5EK0A 1SKVA 5LP6A 1NPZA 1MS6A 4Q8HA 3D36A 3ZUAA 5CA1A 3T4DA 3T1YB 1KHPA 2ITDC 5H5NA 2ZR2A 5EZYB 5JQGB 3OGCC 3U0ZA 4YJ2B 3WB0A 1S76D 2A79B 2XTAA 4PA4A 1NR7A 2BOBC 3FX7A 5KLVH 1YK7A 4AXLA 2PADA 2KSDA 2WLLA 5KX5B 1QU7A 5B1BB 1NR1A 2OIGA 1CPJA 2GUZA 3CCRV 1M90W 4JTAB 1F2CA 1E1QG 1MIRA 2Y6EA 4JI2B 1N36B 3B2EE 4B3TB 1ME3A 3FYEB 1TAEA 4X1KB 5JZEA 5LOVA 4OELA 4LF6O 5LHIA 2EJRA 1R3JC 3RYCA 2VQFB 5IJ9B 2Y69C 3PRPA 1SERA 1H8HG 3KSEA 1AILA 1HNZB 4DO2A 5IWAB 4FIPA 1GO3F 1BSMA 3SPHA 3CB2A 2AZ2A 2NNUA 4L8JA 2VQEO 1OZ0A 4YHHB 1AR4A 4DUYO 3BABA 4UVCA 3B09A 3SGIA 1SQFA 4X8AA 2HJDA 3E1ZB 4YVAA 1OCOB 2EBOA 1LUWA 2EIMC 3BA9A 1N33B 4PP1A 4QRXA 1S5LZ 4MTXA 3HKEB 2BTOA 1QVFU 4DYLA 4E2LA 5KHIA 4DV6B 2Q68A 4XBFA 3KCYA 1WA8B 4YJ3B 4GX0A 5H2FZ 4WF9V 3PHUA 3QO8A 4IYHA 3H8CA 4OEMA 2LW1A 1WPBA 4N79A 4O4LA 4UUJC 1CQDA 4IL6Z 4DR4O 1PCIA 2DZZA 4MVSA 3BCCH 1IBLO 1W0JG 2JGUA 4JYAB 2LW7A 1G8MA 3L9DA 2HKOA 1JX9A 1GMYA 5BZBA 1FYJA 3ABUA 4LH7A 1TGOA 5FNVB 1EN6A 1OCCC 3OE7G 3OR7C 1BT8A 1QMYA 4BW5A 3GWKC 3SJQC 2HHNA 2HWKA 4MSXA 4EB6A 2DOSA 3CRQA 4R6ZA 3NR7A 4FZ0A 4DK0A 3SPGA 3W31A 4DV1B 2DWDC 5C93A 1ZX3A 1GM7A 1EWMA 3ZRVA 1JR9A 2L6LA 4DR5B 1ATKA 3USVA 1Q6UA 4G27B 2UXDO 4DR4B 4U3FH 5GW7A 3U8EA 4IP3A 1XKGA 3AG1C 3GWOA 2LJ2A 1BQ0A 1IXBA 3HD3A 3IMAA 2EIKC 4PDVA 2X6CA 4QNHB 1SF9A 4TV9B 3NHEA 2H3OA 1CS8A 3E89A 2E74B 1SA0A 1N0JA 5BR8B 5IYCO 3H8BA 1OCCB 1HW7A 4JI1B 3RBZA 1PNLA 1JPXA 4GYCB 5LBQA 2EZOA 3A8TA 1ZCMA 4DV4O 1PPJH 4DMXA 2EULA 5LGTA 3CSXA 1DLBA 4X1IB 1GTOA 3S3WA 1XILA 1AYWA 2HH5A 3KWZA 1HDJA 1JFFA 3ERVA 1Y4HA 1B6QA 2V7QG 4JAVA 4GKJO 1XREA 3JSNA 4MVZA 3I56V 1JCHA 3WXGA 2P06A 2ARYA 5B1AB 2ARHA 5K1XA 1XNQB 1M56C 1YJ9V 4GZRB 2XAFA 2ZM6B 2R9NA 3L74H 4B7KA 3DC5A 3KW9A 1YALA 4W4KA 4FLYA 1VQ6V 1H2MA 1M4UA 2DW4A 2O6XA 4PDRA 1JJOA 1GRJA 3DSQA 3HKCB 1RSOB 4JI0B 3E8BA 3BFRA 4RF0A 4B3MB 4BQVA 1WJZA 2DC6A 4L87A 5FPOA 2C2AA 4I4TA 2B1MA 3MHSA 2F1MA 1Z2GA 1M9NA 1K8AW 4B3MO 1Q5OA 5JH3A 3AG4C 2NQIA 4YYSA 1PKXA 2H94A 5EBMC 2DQ3A 2OTJV 3SYQA 3E22A 1VIBA 5CBGA 3AG2B 4X20B 1IX9A 1BGOA 4LR3A 3BVOA 4B3TO 4IYIA 1X9YA 4FM2A 3MTNA 1W2BU 2G38A 3C3TA 2KQXA 4JYCA 3S3QA 1N32B 4U3JA 4N23A 3RYHB 1AR1B 2QSAA 1GN3A 1EBOA 3MHSC 2F4VB 2P7UA 2QKAA 4UCSA 3A0HZ 4TSFG 2R6NA 3TNXA 3W7SA 1TUBA 1KFXL 4Q8GA 5E79Z 1POPA 1CXZB 3HKEA 2JS3A 3W7WA 1V54B 4F6RA 2BSKA 3N2KB 5KUMA 3K0GA 2IU0A 4CS3A 3E8FA 4DRXA 2YXHA 4TOIA 5F2VO 4I04A 3CS5A 4I7ZB 2L35A 3CCJV 5EGWA 1K3EA 3CC2V 4F6EA 4W5BA 2CTRA 2XAGA 5GONB 2QA4V 3AEIA 3EHBB 1K73W 3G80A 4LH6A 2WWWA 3ZRSA 2R9RB 2V4DA 1BP4A 2DCCA 4DUYB 3J80N 4ZUXU 2FQ9A 3P3PA 3ZHVA 2QKCA 2OZ2A 2RDCA 3G67A 3BHPA 3B8NA 3KFQA 1PL0A 2DYRC 3QVNA 4W4LA 2DN9A 4I55B 2IH3C 4EB6B 4UV9A 6PADA 2QDOA 5CVMA 3CE2A 3ETGA 1MEGA 4J7JA 1Q3EA 1NH2B 1IDSA 2PGGA 1GN6A 1YDXA 1U9QX 1HNWO 1TUBB 4D8BA 4I50A 1PD3A 5KUKA 1QDQA 1SRYA 4I05A 3ZHTA 3PT2A 2Q7GA 2DYSC 1SQXH 1AU2A 1NB5A 1MOFA 4NB5A 3LDDA 4U3JB 4JI8B 1M93A 1QOLA 1A32A 4FFBB 2BDZA 3UO2A 3BPZA 4X62O 2D3OW 2QM4A 1PPNA 1PM9A 2JDIG 2AXTZ 1GH6A 3OISA 1S0VA 1E1RG 1EN5A 3WB2A 4I5SA 4BS5A 5LYJA 2GTSA 2VWJA 4B08A 3VQWA 1GM8A 4G28B 3RFRA 2MK3A 2Y0IA 5AG2A 1HR0O 4BW9A 1QCEA 1VQOV 4PJ0Z 3PHXA 2OCCC 5D5PA 4FM1A 1P7BA 3R66A 5CB4A 3RW0A 3MHHA 1RM1C 4PDMA 4B3RB 1KB9F 3QSDA 1NS1A 4K7CA 1LUVA 3ZMVA 1K5SA 2HD5A 2F23A 4TUYB 5JVDA 4AI8A 1F4NA 1VQKV 2UU9B 1VQNV 5L3BA 4CDCB 3OW2U 1KKCA 1Z5VA 5CMUA 3G6EV 4DR6O 2F1GA 3CEIA 2OT5A 2YJ9A 3CHXA 4RQFA 4TV8A 1CEZA 1K4CC 5IY5B 2CUGA 4X89A 4DV7B 4X1KA 1OCRC 2JJ2G 1K4DC 1XMQB 4PT5A 1IBLB 5KHJA 1D2DA 3SR2C 3AG2C 1ITOA 3DGEA 2AS8A 3ABTA 2ZM6O 2DMXA 4O4IA 4J9ZB 3LUTB 5LMNB 4LF7B 3CYOA 2EZPA 3D6SA 3O9OA 2VRZA 4FLTA 2WLKA 5B1NA 1NU1H 3LDCA 3UT5A 4J7ZA 3BPMA 1QLEC 4H33A 2UUCO 5EZYA 4O4JB 4JI5B 1VF6C 3A0BZ 3U11A 3AK2A 3R65A 2DCAA 2D2CB 5B3SC 3MHHC 2QWOB 2DC9A 4BPVA 5EIBC 4FLUA 4CH4A 3L72H 4X1YB 2Z5UA 4GCZA 1VF7A 2WLJA 2Y5BA 2A9HA 1FH0A 2P6JA 2XU1A 2HEPA 5B1BC 1NTMH 4QH6A 1NTKH 3F5WC 3FYIB 4D8IA 1N4CA 4J11A 4K8ZA 2Y4TA 3UO3A 1HNWB 2LGQA 4UB8Z 4RWUA 1L0NH 2X6AA 3H1IH 4DR7O 1YCIA 3PHWA 1WB8A 3OGIB 3OR6C 3KZIZ 4LWSA 1KP2A 2HR3A 2ZR3A 3K04A 1B04A 4PA3A 2WBFX 3T1CA 2GSMB 1YI2V 4DV5O 1VP7A 1FXHA 1NL6A 4IUMA 3OAAG 2AYNA 4WFGA 3BA8A 4DXWA 1EFRG 2PNSA 2QTOA 1PVJA 1R3LC 3M99B 4NXMO 4EKWA 3CH3X 2JQGR 1CP9A 3H9VA 3T1YO 1N34O 4PI2A 3ETDA 5CB4B 3H1HH 4P30A 1TUEB 1Y6XA 4O2BB 3OEEG 3K9MA 3NXSA 4EFEA 2R9OA 4CC6A 3ZJZA 4MS2A 2YEVB 2EX3A 4JAAA 2E5LB 2DYSB 2RJZA 4B3SO 2XU3A 2FO5A 3I06A 3IGAC 4A5UB 2E5LO 1FPOA 1XOUA 2FL4A 5JCOA 2UUAO 1PPDA 1VARA 1QLNA 3CH2X 2AU1A 4I9QA 4DR1B 5LA6A 1U96A 1EZJA 3DF0A 4QE7A 3OM3B 3FKSG 4PI3A 4P2ZA 1JVMA 3THOA 3JD3A 3GVMA 1XBLA 4UVBA 3X2QB 3RYIA 2ZQMA 4IIJB 2AVWA 2YJBA 4NTWA 2YXYA 1KC8W 4ZOLB 3CWBH 4XR7A 1IWDA 5LOVB 1WN7A 2YSUB 5IJ0A 3LXSA 4X6HA 3DC6A 4NTXA 1KD1W 5IJ0B 2FT2A 4I0XB 4B7EA 1YTFB 4BOUA 3JCUZ 2EIKB 2ZE5A 3CMEV 2ZKOA 3STZC 2QM8A 2FYUH 5JH7B 4JI3B 2LO1A 4MI7A 4BR6A 5IYZA 3CC4V 2N74A 3APQA 2CAZC 3ZMZA 3LNNA 4HZ3A 3PRMA 4RY2A 2QEXV 1ZTEA 2ZDIC 4Z2WA 4JI8O 5KHKA 4FLXA 1MA1A 3AI8A 4RO2A 3G4SV 3E8HA 2FKXA 4X66O 4NXNB 2PI5A 2AUZA 2VHFA 1P84F 2A0LA 5LA6B 3RWRD 3GB7C 2BSKB 3V6CA 3F75A 4X66B 2ADPA 4KFMA 3RYFB 4ZKIA 4NYKA 1CJLA 3E9SA 3CPWU 3K03A 3TETA 1YVBA 3H01A 3ZMTA 4JTCB 2GHYA 2Q67A 4F4LA 2WLHA 5A9GA 1S5JA 3WXEA 2P5OA 1SZTA 4U7NA 4K8XA 3OF8A 2JQFR 4REZA 3H89A 1ROPA 4PP2E 3B79A 2HP8A 4K0KB 4KP4A 2AZ0A 1AYVA 5ITZA 1RPRA 1WP8A 4OXSA 4MTGA 5LMNO 2DQ0A 1I7FA 3ZHRA 3K9SA 1OV9A 1NH2D 4RUEA 3J7AU 5LHHA 2F7DA 1W59A 3F5TA 3ZHUA 3N2GB 3ZNHA 2XUMA 4BIOA 5L3CA 5BR8O 5C8YA 4CH5A 4TUYA 4JI6B 4CZZA 1HR0B 5LP6C 5A2QN 1EN4A 1NVPB 4MTOA 3OD4A 3HKCA 2Y0PA 5KHHA 4WA6A 1ZSPA 3P32A 2PI4A 1P49A 3IEJA 5JJEB 1O0EA 1DF4A 4R7CA 4J10A 1EWLA 1TVKB 2CK3G 4D7SA 5L3FA 4AXMA 5LMUB 4LNUB 4FFKA 1THZA 4X64B 1MDWA 2JVDA 2R9AA 5E6JA 1Y74B 3OEHG 1Y4MA 1KHQA 4DR2O 4LF4O 1GKFA 1U97A 4DUZB 3K0DA 1DGSA 2BTWA 1AI5A 1K33A 3HWNA 2G6DA 1DF5A 2Q9LA 1QQCA 5L3DA 4OW0A 4OVZA 1JJ2U 3PW3A 1SQBH 4XZXA 3OT7A 4JI2O 2UZJA 5EC1C 2ODMA 1M6DA 3BBAA 3ZN1A 5FLXN 3KCXA 4X1IA 2B1GA 4N21A 7PCKA 3AK3A 2BTQB 4WCEV 4IIJA 2J7QC 1DTOA 4P9PA 1ZL8A 4NVPA 5E1AC 2DC8A 1OJHA 1Y08A 2QJ1A 1ZAUA 2LGWA 2GV9A 2PTMA 4IHJA 3ZRXA 2O57A 1QR8A 2EIJB 2OP3A 2JGDA 3K08A 4IT5A 3K24A 2Y48A 1XHXA 5DM6V 1H8EG 8PCHA 4H44B 2DC7A 1GLOA 3IHPA 4JPRA 3HR0A 4GX1A 5EYPB 5KA6A 5GONA 2Y69B 2BTWB 3PNRA 3RVVA 2YIBD 2P67A 3BEHA 2DCDA 2R9FA 1OHHG 2JTCA 2ZNJA 5CBFA 1XI1A 4H13B 5J2TA 2CDYA 4QRVA 3KWBX 2BOCC 4GKKO 4R3DA 1F51A 1H2GA 4J80A 4DR5O 4OVZB 2W6JG 4K3AA 4KHPO 4G54A 3ZRWB 4JI4B 1YSCA 4QE9A 3JAKB 1GAXA 3FB7C 3JATA 4UFZA 2CTQA 4FJCA 3ZN0A 5J2TB 4U7OA 4JF3A 1N36O 3M8AA 4RQEA 3FB6C 1XQ8A 5EBLC 4LBEC 3SYAA 1EM1A 2AUXA 1YF2A 2NN4A 4X20A 4J42A 1CB5A 5K1PA 4HNAA 3VBBA 4PI0A 1GCBA 4TQDA 2WA3A 1Q82W 3I55V 2JGDB 5F02A 1JQPA 4GX2A 4W5CA 3RVZA 4X65B 4OX9O 4LFAO 1SETA 4JYBA 4N8WA 3ICXA 1AVMA 2XT9A 4X65O 4O4HB 1YK8A 1ENVA 3CD6V 3LFYA 1KFUL 3WFVA 4JI3O 2A7WA 3I3TA 4LFBO 3B77A 1YEWA 3BAAA 4QPKA 5CA0B 1KP3A 2HG5C 1NTZH 2RCVA 4FK5C 1SQVH 2QGNA 2CTPA 2XAJA 4WFAV 4FZ1A 3SDLA 1A6RA 2ZNIA 4DR1O 1Y66A 4JASA 1S72V 2WLIB 1MZFA 3LNMB 1VJVA 4DR6B 1JMKC 2XASA 4CH6A 4DRXB 2WLLB 3EVKA 4YYQA 1MABG 3BY6A 3MJ5A 2CB5A 1QLEB 5B66Z 2B1IA 3MTVA 1SESA 1VMGA 5EIBD 1UJWB 5B3SB 5LL6Y 3K58A 5LP6B 2OYQA 1Q81W 3K8UA 3ZMUA 1WPXA 3PBHA 5CN0A 1KYOF 1I08A 5EZSA 1VQ8V 1BGYH 1GMGA 2JRIA 3ZHQA 2DWEC 4I9WA 1N32O 4DR3O 2F4VO 5L3GA 2UXCB 4GT1A 2Q7EA 5EF4A 4OPHA 5KHGA 2WLMA 1TVKA 4P9OA 3C9EA 2ZT9B 2P4VA 4D6TH 3HKBA 3SPJA 3G71V 2X6BA 4JV5O 3CCMV 1XHZA 4CC5A 1P7GA 3M7MX 1J95A 2BCCH 4CDEB 1HUCB 2VS0A 4YYRA 3E86A 2YI8A 1FJGO 3ETEA 3O0UA 3CCQV 5C8YB 1GN2A 1YVWA 3N2GA 1DEUA 2Q73A 4FM0A 1F7YA 1I5YA 4JGSA 5IYBO 1FJGB 3JYCA 1EF7A 2YIAA 4R8CA 1CPYA 4YY3O 1UPGA 3K57A 3Q4HA 2E02A 1R1BA 1KUQA 3FAVA 4JI6O 1WAZA 2BE3A 1ZL8B 1WLEA 4CH3A 3HHAA 3OMIB 4OX9B 1STFE 1CVZA 3BRCA 2Q5ZA 2UUBO 2QM7A 1AIMA 2CIOA 1IBKB 2ILMA 3UKMA 3WG7B 4JV5B 1MSWD 2RNBA 3P3NA 4MVRA 1THEA 1MSDA 4KUMA 2NLJC 5CA0A 1FFXA 3F7VC 4MZOA 5K16A 2UXNA 2EINC 1RPOA 3OFNG 2M7WA 2ZXWB 1K9MW 1CV8A 3DTUB 2H8PC 5HFLA 2FUDA 3ASNC 4NKGB 3UQ8A 4GUAA 3CRAA 3OTOO 4DW1A 4JI0O 3E8GA 3WU2Z 4RKXA 1P4RA 2PYLA 4YY3B 5CHVA 5IWAO 1XEQA 1D5NA 1XNRO 4UB6Z 1UKFA 2E76B 3AG7A 3H1JH 4ICGA 3K5LA 1Q8IA 4UV8A 4DV5B 3CBKA 3OUFA 2OWOA 2HHHO 4F6RB 3ABMC 2UUAB 1G4YB 1F23A 2BTQA 2UUBB 4UCTA 1VF5B 2PZSA 4BS6A 1K34A 1OCZB 2DJGB 2EJ7A 3OQCA 5CA1B 1S4VA 1E79G 3VQYA 3W7UA 1ZIVA 4TWKA 2YC0A 2QKSA 1VQ7V 2GFOA 3OTFA 1IZ3A 4DUZO 3AK1A 4X6JA 1XMOO 3ML0A 2P90A 2W0XA 3QT4A 2Q8VA 3LSSA 9PAPA 4UCOA 4GKJB 2R9CA 2QE7G 4CZWA 3IJ4A 4O4IB 5GTIZ 1XNRB 4QPJA 4WBNA 3T1HB 2DYRB 5FPRA 3GCBA 1L1FA 3SPCA 2M6YA 4RNAA 4DV3B 4LF8B 1NZ6A 1AECA 1J5EO 1N0NA 2UU9O 3FAVB 2P86A 3SYPA 1ZLZA 2PBHA 2RMKB 4HXDB 3ETQA 2ITCC 2WSSG 3ABLC 1Q6HA 3JAWB 1I94O 3VQVA 2YIDA 3RYFA 3PDFA 4JI7O 4MW8A 5JVDB 4NR1A 3CCLV 5IYDO 4XDJA 5J2UA 3J81N 3OVXA 2LFRA 2Y4UA 1WB7A 3QF7A 4WFHA 3T1HO 4MSWC 5J9PC 4BIUA 1FS0G 1V9PA 3SYCA 2P22C 3AG4B 1IXMA 4J9YB 1BMFG 3UCSC 2QR4A 2YICA 4CBCA 1B3QA 4BOZA 1AROP 4IHJB 5IYZB 3B21A 3LSUA 2IBZH 4D7TA 1SS3A 4LFBB 2XNDG 3JARB 4XUIA 2IW5A 3K5OA 4UCVA 4I0XA 1IBKO 1NQCA 1KU9A 1G6UA 3JD0A 1K3BB 1PIPA 3APOA 3JSLA 4ZHQA 4B3SB 1NJIW 5CBHA 2G8JA 4EEQA 4QRGA 3HPLC 1SC5B 2KG7B 3CJHB 1EZVH 3H1KH 3SJAC 5B1OA 1AU4A 4LWSB 2XU5A 1R3KC 1V54C 3QJ3A 1SQGA 1JA8A 1BL8A 2JS5A 4X62B 1YITV 3FD9A 1SZXA 4D8EA 1URFA 3D3QA 1BQZA 2EIMB 3N27A 3ASOB 4W4UA 2ZD9A 4LF6B 3WB1A 4PD4F 3CBJA 1YHQV 2Q7HA 4YJ2A 3ZHSA 1FD9A 3N3KA 4AILC 1O9HA 1NKDA 2GTAA 1PXVA 3BOWA 2F93B 1BY8A 1Y67A 2XAHA 4ZOLA 1F2AA 1V55C 2Q0OC 3RVYA 3KKUA 2Z3YA 2CTWA 4PA9A 3UT5B 4O2BA 3AG3C 1R3IC 1COWG 4HBNA 2ACTA 4O2AB 4FPPA 5GTHZ 2DJFB 2FTDA 5LGUA 1AB3A 2RQ6A 1NT2B 1OCOC 3QG5A 2IPPB 3OVZA 4BOSA 3H6SA 1VQLV 3B40A 2WA4A 4O4LB 4CDDB 3TCUA 1KMIZ 4MTFA 3G6BA 4JZGA 4K0KO 3CCUV 2E00A 3IFUA 1RFYA 3FB5C 4LC1A 1QR9A 2ZXWC 3AG1B 4P16A 1VQ9V 1MMMA 3TJTA 1K97A 4CDFB 4X9QA 3AG3B 1GK9A 2AW9A 1FXKA 3QNEA 1AI7A 3M99A 1IURA 4BSQA 2LQTA 2IM9A 2JEXA 2NR5A 1NQTA 3F7YC 1BE3H 2JEUA 2PUSA 1PBHA 1PNMA 4KXRA 1F29A 4GX5A 4JZ2A 3ABLB 4DV0O 1F2BA 3CC7V 2WLNA 3RYCB 2R72A 5LMUO 1MHWA 4H0LB 4X64O 2E01A 4BIZA 2QWQB 2ATKC 1YZBA 4DR2B 2PYJA 1DKIA 2G7YA 2VQEB 1Q7YW 3LDEA 1AI6A 1H2NA 4CS4A 4MVQA 5BY1A 4YYWA 4PDLA 2GUZB 1YJWV 1M1KW 2JK5C 3P5UA 2YIBA 5PADA 4FLVA 1NVPD 5B1AC 1PP9H 3JALA 2P4KA 4X1YA 2FRQA 1Q43A 3BPFA 1AI4A 1Z5WA 1Y76B 1YT7A 4QBBA 1KKDA 3B8MA 2Q6AA 4WFBV 2PF4E 5H9CA 2IJJA 4DV0B 2KG7A 4PADA 4O4JA 2NQGA 1I94B 2N05A 4FLZA 3D36C 4LFCO 1NLJA 4AHCA 4PA6A 3ZMSA 1Q6KA 1HNXO 4JI4O 2Z84A 3ZIAG 3DXRA 4BAYA 2IBIA 1FKAO 2GHUA 2FE8A 4A5UA 1CTEA 2Q0AA 3IAYA 5BXZA 1S77D 3ZS8C 1ZUQA 5L3EA 3P30A 2YDEA 1TL9A 3BY4A 4TV9A 3T2MA 3HKDB 2ETNA 2ZE7A 3K5MA 5LYJB 3C3SA 5BMVB 5KMGA 3E22B 4ZTBA 3BWKA 2AHZA 5J94A 1XL6A 3SPIA 4LFCB 2C0YA 4AQYB 3CRCA 3H1LH 4QGPA 1R73A 4B3RO 1PL4A 3K5NA 3CP1A 4Z1VA 1AYUA 2OULA 1EWOA 4N4ZA 3VOUA 5JJNB 1R6KA 3ZBHA 1XDCA 3JAKA 1J5EB 4DV2O 2OCHA 1ZWIC 1F4MA 4FLWA 5CHTA 5KO3A 4I50B 4CS2A 2LP7A 1N33O 2DCBA 3QO7A 3L70H 2IJHA 4DV2B 3HB3B 3RVXA 4DV6O 1LR1A 5DECA 1YTFD 3S3RA 2B5UA 5H6RA 5JA7A 2F43G 2FYEA 1VQPV 5KAIZ 2F95B 5JCOC 2Z0AA 3RVWA 4DV3O 4LF8O 1SP4B 1BHAA 2P0RA 4TT3G 4DR3B 2ZE6A 5CA3A 1RSOA 1AJNA 1VF6A 1WNSA 1ORQC 3CRMA 4R50A 4FVMA 4ZI7A 3QTCA 1VQ5V 4Q20A 1VSNA 4NTYA 1PADA 4X6IA 3ABKC 4I55A 3TXSA 2ZDIA 2UXBO 4Z1MG 1L0LH 2EIJC 1R6NA 4HAMA 3N2KA 4ZI7B 1EWPA 2DJVA 2YI9A 4FMTA 1YXBA 1CSBB 2XU4A 3ZX6A 2VWKA 3ZCCA 3PN1A 1HP8A 3BB7A 1QBZA 1PE6A 2JJ1G 1JFFB 4TV8B 1FFXB 2ATOA 2FRAA 3JAMN 4P6EA 5DEDA 5HFMA 5EZQA 4YYUA 2AGAA 3CXCU 3ZEDA 2EINB 3VQXA 3IOQA 1U5IA 4DV7O 1G1XB 1NB3A 1KQSU 1HWYA 4O4HA 3C90A 1I5XA 4MT8A 3IUTA 3JATB 3Q4HB 1TLOA 4GLXA 3K3WA 1US6A 4ZIBA 3SYOA 3L73H 5TISZ 1SA0B 2KB1A 3FB8C 4I4TB 2J7QA 2ZIOA 1RM1B 5FPWA 1K92A 4UXNA 3E2EA 1FXKB 3RT3C 3CCVV 1FXVA 2YS8A 3P5VA 2W0FC 2QWRB 4DR7B 4KHPB 4MW3A 2UXCO 1NI8A 4YV8A 3HKBB 4UVAA 4JI1O 2AYOA 1BS3A 1XNQO 4WFFA 2XHBA 3P5WA 2RN9A 4RF1A 5EBWC 1I0HA 2QTSA 3D3IA 4FJCC 5ITZB 4DV4B 4P6GA 1TA8A 3HKDA 2WPDG 1AJQA 3N3GA 5JWPA 1GN4A 1AP5A 2OCCB 4ABMA 3CCSV 2NQAA 3CXHF 1SQPH 1FXKC 2ADQB 3OMNB 4LF5O 2ZE8A 4FIPC 4X88A 2AHYA 4HYOA 4XDKA 4LFAB 4YHHO 5CVOB 4WFEA 1GECE 4I07A 4WURA 3K06A 2ZINA 2GBOA 2P7TC 4YXWG 2IJKA 1IBMO 2VHSA 4LCUC 4OPAA 2IU3A 3L75H 2AIMA 5FL7G 1AU3A 2GDSA 5BMVA 5KMGB 1H2SB 2WLIA 5DN6G 5H6QA 1Y76A 4KLBA 1Q6IA 2E75B 2VQFO 2CE4A 5IY5C 1AU0A 2MW2B 2NQDB 3RNVA 1RP3B 4JAUA 1WP7A 3LSQA 4JI7B 2HXZA 4IGGA 4UCUA 3RGBA 5IDJA 3IC9A 3PJSK 2X7RB 1SQQH 4HWYA 1HNXB 1XUQA 3DXRB 4JTDB 3UM7A 4J7KA 2R70A 4QIWF 4AQYO 1VQMV 5KAFZ 2R9IA 1U9XA 2B1NA 1BCCH 2BU3A 5A24A 2DZYA 1K5QA 3E83A 1S3JA 2HHHB 4XDLA 2YUAA 3CJHA 4MVOA 3KKYA
chains in the Genus database with same CATH topology
5H5NA 4DV2O 4KHPO 1HNWO 2J7QA 5KO3A 4D8BA 1N33O 2HWKA 3RT3C 3PT2A 5EZSA 3OQCA 2DOSA 4DV0O 4B3MO 3W31A 2JRIA 5LMUO 1N32O 4D8EA 1HNZO 4DV6O 1N36O 4DR3O 4X64O 2UXCO 3M8AA 2F4VO 4DUZO 1R6TA 1A32A 1X59A 5E6JA 1YZBA 1XMOO 1DKIA 2UXDO 3O65A 4JI1O 4OPHA 4DR2O 4X62O 4D8IA 4LF4O 4BOUA 1XNQO 4B3TO 5BY1A 4RF1A 4IP3A 2ZKOA 4LF9O 2Z0AA 4DR7O 2BTWA 5JZEA 4MI7A 4DV3O 4LF8O 2N74A 4LF6O 3PHWA 4JV5O 4OW0A 4RNAA 1HR0O 4OVZA 3C0RA 4XZXA 3PRPA 3PRMA 4JI2O 2UZJA 3PHXA 1J5EO 2UU9O 1AILA 3BBAA 5FLXN 3W30A 3R66A 4JI8O 4BOPA 1FJGO 4OX9O 4DV5O 4LFAO 4HXDB 4IUMA 2J7QC 2FKXA 4X66O 2VQEO 1F7YA 1NS1A 4X65O 4DUYO 4LF5O 1PVJA 1I94O 4NXMO 4DV4O 4YY3O 4LFCO 3T1YO 4JI3O 3TMPA 4JI7O 1N34O 4YHHO 2UXBO 1HNXO 1R1BA 4LFBO 4WURA 1AB3A 3E9SA 4NXNO 4JI4O 1KUQA 4LF7O 2Z84A 4JI6O 4DR6O 4BOSA 3MP2A 3J81N 1IBMO 2DJVA 4OPAA 1FKAO 2FE8A 4A5UA 2UUBO 3T1HO 3BB7A 4B3SO 4GKJO 5BXZA 4REZA 2VQFO 4A5UB 3SDLA 3RNVA 3JAMN 2E5LO 4K0KO 3PHUA 3BY4A 4BOZA 5EZQA 3IFUA 4PT5A 3J80N 2AGAA 4DR1O 1D2DA 2UUAO 1XMQO 4JI5O 3B21A 2BTWB 4DV7O 4ZTBA 2ZM6O 5LMNO 4GUAA 2JTCA 3OTOO 1G1XB 4DR4O 1IBLO 4P16A 4JI0O 3J7AU 4RKXA 3TRKA 3MJ5A 4AQYO 1IBKO 2LW7A 3F5TA 5IWAO 4DV1O 1XEQA 4JYAO 4GKKO 1XNRO 1UKFA 4M0WA 4R3DA 2BU3A 3ZNHA 3MTVA 4B3RO 5BR8O 3PSEA 2UUCO 1FYJA 2HHHO 1DK1A 5A2QN 4DR5O 5IT9N 5LL6Y 4OVZB 4BOQA 4RF0A 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H5N A;  4DV2 O;  4KHP O;  1HNW O;  1N33 O;  3RT3 C;  2DOS A;  4DV0 O;  4B3M O;  2JRI A;  5LMU O;  1N32 O;  1HNZ O;  4DV6 O;  1N36 O;  4DR3 O;  4X64 O;  2UXC O;  3M8A A;  2F4V O;  4DUZ O;  1R6T A;  1A32 A;  1X59 A;  1YZB A;  1XMO O;  2UXD O;  3O65 A;  4JI1 O;  4OPH A;  4DR2 O;  4X62 O;  4LF4 O;  1XNQ O;  4B3T O;  5BY1 A;  2ZKO A;  4LF9 O;  2Z0A A;  4DR7 O;  4DV3 O;  4LF8 O;  2N74 A;  4LF6 O;  4JV5 O;  1HR0 O;  4JI2 O;  1J5E O;  2UU9 O;  1AIL A;  5FLX N;  3R66 A;  4JI8 O;  1FJG O;  4OX9 O;  4DV5 O;  4LFA O;  2FKX A;  4X66 O;  2VQE O;  1F7Y A;  1NS1 A;  4X65 O;  4DUY O;  4LF5 O;  1I94 O;  4NXM O;  4DV4 O;  4YY3 O;  4LFC O;  3T1Y O;  4JI3 O;  4JI7 O;  1N34 O;  4YHH O;  2UXB O;  1HNX O;  1R1B A;  4LFB O;  1AB3 A;  4NXN O;  4JI4 O;  1KUQ A;  4LF7 O;  4JI6 O;  4DR6 O;  3J81 N;  1IBM O;  2DJV A;  4OPA A;  1FKA O;  2UUB O;  3T1H O;  4B3S O;  4GKJ O;  5BXZ A;  2VQF O;  4A5U B;  3SDL A;  3JAM N;  2E5L O;  4K0K O;  3J80 N;  2AGA A;  4DR1 O;  1D2D A;  2UUA O;  1XMQ O;  4JI5 O;  4DV7 O;  2ZM6 O;  5LMN O;  3OTO O;  1G1X B;  4DR4 O;  1IBL O;  4JI0 O;  3J7A U;  4AQY O;  1IBK O;  2LW7 A;  3F5T A;  5IWA O;  4DV1 O;  1XEQ A;  4JYA O;  4GKK O;  1XNR O;  4B3R O;  5BR8 O;  2UUC O;  1FYJ A;  2HHH O;  1DK1 A;  5A2Q N;  4DR5 O;  5IT9 N;  5LL6 Y; 
#chains in the Genus database with same CATH topology
 3SJC C;  2XAQ A;  1X4T A;  1BZK A;  3U10 A;  2QWP B;  3RYI B;  1H38 A;  5FNV A;  3OTO B;  3JAL B;  2CGN A;  2R9M A;  1QNM A;  3ABK B;  1HNZ O;  1PNK A;  2IJI A;  1R6T A;  4YIO A;  4HNA B;  3JCZ A;  2PRE A;  4PHZ A;  3O65 A;  5KX5 A;  3ASO C;  4LNU A;  4PA7 A;  1TU6 A;  5EC2 C;  2Q69 A;  3MAQ A;  1T5E A;  2A3Q A;  1ME4 A;  1UFI A;  2G8E A;  2W6I G;  3T4Z A;  1NBM G;  3A0R A;  1BQI A;  2FB5 A;  3FFQ A;  4C7U A;  1MG1 A;  3TXQ A;  1Q86 W;  3C0R A;  1IVS A;  2E3C A;  1LNQ A;  3KG2 A;  4BOP A;  1Q90 D;  1S5H C;  2F66 C;  3ZRW A;  1YIJ V;  1V55 B;  1U9W A;  2YJC A;  3BC3 A;  3D8C A;  4H37 A;  1N34 B;  3MDS A;  1QVG U;  3JD4 A;  1B06 A;  3CCE V;  1PPO A;  3KX1 A;  3JAS A;  4GUN A;  2K1E A;  3CMA V;  4O2A A;  2HVJ C;  2Q4P A;  3X2Q C;  2YJ8 A;  4NXN O;  1U9V A;  2CH7 A;  4LF7 O;  2LFS A;  2K9P A;  1PPP A;  3L71 H;  3WG7 C;  1VQ4 V;  3OUS A;  1O9G A;  4G2K A;  3EFF K;  4BWA A;  1AP6 A;  4WBN B;  5EYP A;  4OGQ B;  5D5Q A;  1DF0 A;  1WA8 A;  4YJ3 A;  3MOR A;  2OTL V;  4PEL A;  1XMQ O;  4EFB A;  4FFB A;  4ASU G;  4ZBM A;  3BCN A;  1JQ0 A;  4DMY A;  1IBM B;  2HVK C;  3RN4 A;  5KA5 A;  4K35 A;  3STL C;  3TRK A;  3SJB C;  3H7D A;  4JYA O;  3TGU H;  3MD0 A;  1MZE A;  2WAM A;  2UXD B;  2FML A;  3K79 A;  3B4S A;  3PSE A;  4J41 A;  3E35 A;  2BDL A;  1MNG A;  1M5I A;  2UUC B;  1DK1 A;  1KBH A;  5IT9 N;  4BOQ A;  4MM3 B;  1AR5 A;  1OCZ C;  4LF4 B;  3IC7 A;  1FFT B;  2YJ2 A;  2ZCE A;  1BHB A;  3HHI A;  4PV1 B;  5JH7 A;  1H2K A;  1KEC A;  5IJ9 A;  3I5D A;  2EIL B;  2H7J A;  3JD2 A;  5CVN B;  1M57 C;  4MVM A;  3P5X A;  1X59 A;  4Q6G A;  1JOY A;  5JJJ B;  1D5A A;  1H2L A;  1L8D A;  2XOK G;  3IV2 A;  3ASN B;  1KXR A;  1XL4 A;  1Y74 A;  3K59 A;  4LF9 O;  4E4E A;  5LXT A;  3O1G A;  1XMO B;  2YXL A;  3CX5 F;  4LF9 B;  2QWN B;  2X0L A;  2N04 A;  1AJP A;  4TQF A;  3JD1 A;  2UXX A;  3WXF A;  4MZS A;  3W30 A;  2CH7 B;  2IH1 C;  3ABM B;  5JQG A;  2ZIM A;  3W7X A;  1YJN V;  2JIZ G;  4KL1 A;  3A2F A;  4LP8 A;  2HLD G;  2UXB B;  1SNK A;  3JAS B;  1PV0 A;  4ZHQ B;  3QO5 A;  1VEW A;  1QXP A;  2DE0 X;  4NXM B;  3TMP A;  2A06 H;  2EIL C;  4MVU A;  4RAI A;  4YIP A;  4YYV A;  2KKW A;  1M57 B;  4JYY A;  4UCR A;  3V6E A;  2HJF C;  3IFX A;  3MP2 A;  3TK1 A;  4DW0 A;  3JAR A;  2CGO A;  3K9A A;  1FAF A;  2HFE C;  3OF9 A;  3RYH A;  2B9Z A;  5IE9 A;  2V1D A;  2OIE A;  2E03 A;  2YEV A;  4GKK B;  1ICF A;  1OCR B;  4QJF B;  3S3X A;  4RUF A;  4LF5 B;  1N8R W;  2FTK A;  4JI5 O;  5LXT B;  1M56 B;  1W0K G;  3CRR A;  1GM9 A;  3W7T A;  5B5E Z;  4FK5 A;  3EXA A;  3N4C A;  5LGN A;  5J2U B;  1K7D A;  3F5V A;  4DV1 O;  3OMA B;  1MEM A;  4M0W A;  5LHG A;  2PY5 A;  1QHT A;  3JAW A;  4DK1 A;  5EK0 A;  1SKV A;  5LP6 A;  1NPZ A;  1MS6 A;  4Q8H A;  3D36 A;  3ZUA A;  5CA1 A;  3T4D A;  3T1Y B;  1KHP A;  2ITD C;  5H5N A;  2ZR2 A;  5EZY B;  5JQG B;  3OGC C;  3U0Z A;  4YJ2 B;  3WB0 A;  1S76 D;  2A79 B;  2XTA A;  4PA4 A;  1NR7 A;  2BOB C;  3FX7 A;  5KLV H;  1YK7 A;  4AXL A;  2PAD A;  2KSD A;  2WLL A;  5KX5 B;  1QU7 A;  5B1B B;  1NR1 A;  2OIG A;  1CPJ A;  2GUZ A;  3CCR V;  1M90 W;  4JTA B;  1F2C A;  1E1Q G;  1MIR A;  2Y6E A;  4JI2 B;  1N36 B;  3B2E E;  4B3T B;  1ME3 A;  3FYE B;  1TAE A;  4X1K B;  5JZE A;  5LOV A;  4OEL A;  4LF6 O;  5LHI A;  2EJR A;  1R3J C;  3RYC A;  2VQF B;  5IJ9 B;  2Y69 C;  3PRP A;  1SER A;  1H8H G;  3KSE A;  1AIL A;  1HNZ B;  4DO2 A;  5IWA B;  4FIP A;  1GO3 F;  1BSM A;  3SPH A;  3CB2 A;  2AZ2 A;  2NNU A;  4L8J A;  2VQE O;  1OZ0 A;  4YHH B;  1AR4 A;  4DUY O;  3BAB A;  4UVC A;  3B09 A;  3SGI A;  1SQF A;  4X8A A;  2HJD A;  3E1Z B;  4YVA A;  1OCO B;  2EBO A;  1LUW A;  2EIM C;  3BA9 A;  1N33 B;  4PP1 A;  4QRX A;  1S5L Z;  4MTX A;  3HKE B;  2BTO A;  1QVF U;  4DYL A;  4E2L A;  5KHI A;  4DV6 B;  2Q68 A;  4XBF A;  3KCY A;  1WA8 B;  4YJ3 B;  4GX0 A;  5H2F Z;  4WF9 V;  3PHU A;  3QO8 A;  4IYH A;  3H8C A;  4OEM A;  2LW1 A;  1WPB A;  4N79 A;  4O4L A;  4UUJ C;  1CQD A;  4IL6 Z;  4DR4 O;  1PCI A;  2DZZ A;  4MVS A;  3BCC H;  1IBL O;  1W0J G;  2JGU A;  4JYA B;  2LW7 A;  1G8M A;  3L9D A;  2HKO A;  1JX9 A;  1GMY A;  5BZB A;  1FYJ A;  3ABU A;  4LH7 A;  1TGO A;  5FNV B;  1EN6 A;  1OCC C;  3OE7 G;  3OR7 C;  1BT8 A;  1QMY A;  4BW5 A;  3GWK C;  3SJQ C;  2HHN A;  2HWK A;  4MSX A;  4EB6 A;  2DOS A;  3CRQ A;  4R6Z A;  3NR7 A;  4FZ0 A;  4DK0 A;  3SPG A;  3W31 A;  4DV1 B;  2DWD C;  5C93 A;  1ZX3 A;  1GM7 A;  1EWM A;  3ZRV A;  1JR9 A;  2L6L A;  4DR5 B;  1ATK A;  3USV A;  1Q6U A;  4G27 B;  2UXD O;  4DR4 B;  4U3F H;  5GW7 A;  3U8E A;  4IP3 A;  1XKG A;  3AG1 C;  3GWO A;  2LJ2 A;  1BQ0 A;  1IXB A;  3HD3 A;  3IMA A;  2EIK C;  4PDV A;  2X6C A;  4QNH B;  1SF9 A;  4TV9 B;  3NHE A;  2H3O A;  1CS8 A;  3E89 A;  2E74 B;  1SA0 A;  1N0J A;  5BR8 B;  5IYC O;  3H8B A;  1OCC B;  1HW7 A;  4JI1 B;  3RBZ A;  1PNL A;  1JPX A;  4GYC B;  5LBQ A;  2EZO A;  3A8T A;  1ZCM A;  4DV4 O;  1PPJ H;  4DMX A;  2EUL A;  5LGT A;  3CSX A;  1DLB A;  4X1I B;  1GTO A;  3S3W A;  1XIL A;  1AYW A;  2HH5 A;  3KWZ A;  1HDJ A;  1JFF A;  3ERV A;  1Y4H A;  1B6Q A;  2V7Q G;  4JAV A;  4GKJ O;  1XRE A;  3JSN A;  4MVZ A;  3I56 V;  1JCH A;  3WXG A;  2P06 A;  2ARY A;  5B1A B;  2ARH A;  5K1X A;  1XNQ B;  1M56 C;  1YJ9 V;  4GZR B;  2XAF A;  2ZM6 B;  2R9N A;  3L74 H;  4B7K A;  3DC5 A;  3KW9 A;  1YAL A;  4W4K A;  4FLY A;  1VQ6 V;  1H2M A;  1M4U A;  2DW4 A;  2O6X A;  4PDR A;  1JJO A;  1GRJ A;  3DSQ A;  3HKC B;  1RSO B;  4JI0 B;  3E8B A;  3BFR A;  4RF0 A;  4B3M B;  4BQV A;  1WJZ A;  2DC6 A;  4L87 A;  5FPO A;  2C2A A;  4I4T A;  2B1M A;  3MHS A;  2F1M A;  1Z2G A;  1M9N A;  1K8A W;  4B3M O;  1Q5O A;  5JH3 A;  3AG4 C;  2NQI A;  4YYS A;  1PKX A;  2H94 A;  5EBM C;  2DQ3 A;  2OTJ V;  3SYQ A;  3E22 A;  1VIB A;  5CBG A;  3AG2 B;  4X20 B;  1IX9 A;  1BGO A;  4LR3 A;  3BVO A;  4B3T O;  4IYI A;  1X9Y A;  4FM2 A;  3MTN A;  1W2B U;  2G38 A;  3C3T A;  2KQX A;  4JYC A;  3S3Q A;  1N32 B;  4U3J A;  4N23 A;  3RYH B;  1AR1 B;  2QSA A;  1GN3 A;  1EBO A;  3MHS C;  2F4V B;  2P7U A;  2QKA A;  4UCS A;  3A0H Z;  4TSF G;  2R6N A;  3TNX A;  3W7S A;  1TUB A;  1KFX L;  4Q8G A;  5E79 Z;  1POP A;  1CXZ B;  3HKE A;  2JS3 A;  3W7W A;  1V54 B;  4F6R A;  2BSK A;  3N2K B;  5KUM A;  3K0G A;  2IU0 A;  4CS3 A;  3E8F A;  4DRX A;  2YXH A;  4TOI A;  5F2V O;  4I04 A;  3CS5 A;  4I7Z B;  2L35 A;  3CCJ V;  5EGW A;  1K3E A;  3CC2 V;  4F6E A;  4W5B A;  2CTR A;  2XAG A;  5GON B;  2QA4 V;  3AEI A;  3EHB B;  1K73 W;  3G80 A;  4LH6 A;  2WWW A;  3ZRS A;  2R9R B;  2V4D A;  1BP4 A;  2DCC A;  4DUY B;  3J80 N;  4ZUX U;  2FQ9 A;  3P3P A;  3ZHV A;  2QKC A;  2OZ2 A;  2RDC A;  3G67 A;  3BHP A;  3B8N A;  3KFQ A;  1PL0 A;  2DYR C;  3QVN A;  4W4L A;  2DN9 A;  4I55 B;  2IH3 C;  4EB6 B;  4UV9 A;  6PAD A;  2QDO A;  5CVM A;  3CE2 A;  3ETG A;  1MEG A;  4J7J A;  1Q3E A;  1NH2 B;  1IDS A;  2PGG A;  1GN6 A;  1YDX A;  1U9Q X;  1HNW O;  1TUB B;  4D8B A;  4I50 A;  1PD3 A;  5KUK A;  1QDQ A;  1SRY A;  4I05 A;  3ZHT A;  3PT2 A;  2Q7G A;  2DYS C;  1SQX H;  1AU2 A;  1NB5 A;  1MOF A;  4NB5 A;  3LDD A;  4U3J B;  4JI8 B;  1M93 A;  1QOL A;  1A32 A;  4FFB B;  2BDZ A;  3UO2 A;  3BPZ A;  4X62 O;  2D3O W;  2QM4 A;  1PPN A;  1PM9 A;  2JDI G;  2AXT Z;  1GH6 A;  3OIS A;  1S0V A;  1E1R G;  1EN5 A;  3WB2 A;  4I5S A;  4BS5 A;  5LYJ A;  2GTS A;  2VWJ A;  4B08 A;  3VQW A;  1GM8 A;  4G28 B;  3RFR A;  2MK3 A;  2Y0I A;  5AG2 A;  1HR0 O;  4BW9 A;  1QCE A;  1VQO V;  4PJ0 Z;  3PHX A;  2OCC C;  5D5P A;  4FM1 A;  1P7B A;  3R66 A;  5CB4 A;  3RW0 A;  3MHH A;  1RM1 C;  4PDM A;  4B3R B;  1KB9 F;  3QSD A;  1NS1 A;  4K7C A;  1LUV A;  3ZMV A;  1K5S A;  2HD5 A;  2F23 A;  4TUY B;  5JVD A;  4AI8 A;  1F4N A;  1VQK V;  2UU9 B;  1VQN V;  5L3B A;  4CDC B;  3OW2 U;  1KKC A;  1Z5V A;  5CMU A;  3G6E V;  4DR6 O;  2F1G A;  3CEI A;  2OT5 A;  2YJ9 A;  3CHX A;  4RQF A;  4TV8 A;  1CEZ A;  1K4C C;  5IY5 B;  2CUG A;  4X89 A;  4DV7 B;  4X1K A;  1OCR C;  2JJ2 G;  1K4D C;  1XMQ B;  4PT5 A;  1IBL B;  5KHJ A;  1D2D A;  3SR2 C;  3AG2 C;  1ITO A;  3DGE A;  2AS8 A;  3ABT A;  2ZM6 O;  2DMX A;  4O4I A;  4J9Z B;  3LUT B;  5LMN B;  4LF7 B;  3CYO A;  2EZP A;  3D6S A;  3O9O A;  2VRZ A;  4FLT A;  2WLK A;  5B1N A;  1NU1 H;  3LDC A;  3UT5 A;  4J7Z A;  3BPM A;  1QLE C;  4H33 A;  2UUC O;  5EZY A;  4O4J B;  4JI5 B;  1VF6 C;  3A0B Z;  3U11 A;  3AK2 A;  3R65 A;  2DCA A;  2D2C B;  5B3S C;  3MHH C;  2QWO B;  2DC9 A;  4BPV A;  5EIB C;  4FLU A;  4CH4 A;  3L72 H;  4X1Y B;  2Z5U A;  4GCZ A;  1VF7 A;  2WLJ A;  2Y5B A;  2A9H A;  1FH0 A;  2P6J A;  2XU1 A;  2HEP A;  5B1B C;  1NTM H;  4QH6 A;  1NTK H;  3F5W C;  3FYI B;  4D8I A;  1N4C A;  4J11 A;  4K8Z A;  2Y4T A;  3UO3 A;  1HNW B;  2LGQ A;  4UB8 Z;  4RWU A;  1L0N H;  2X6A A;  3H1I H;  4DR7 O;  1YCI A;  3PHW A;  1WB8 A;  3OGI B;  3OR6 C;  3KZI Z;  4LWS A;  1KP2 A;  2HR3 A;  2ZR3 A;  3K04 A;  1B04 A;  4PA3 A;  2WBF X;  3T1C A;  2GSM B;  1YI2 V;  4DV5 O;  1VP7 A;  1FXH A;  1NL6 A;  4IUM A;  3OAA G;  2AYN A;  4WFG A;  3BA8 A;  4DXW A;  1EFR G;  2PNS A;  2QTO A;  1PVJ A;  1R3L C;  3M99 B;  4NXM O;  4EKW A;  3CH3 X;  2JQG R;  1CP9 A;  3H9V A;  3T1Y O;  1N34 O;  4PI2 A;  3ETD A;  5CB4 B;  3H1H H;  4P30 A;  1TUE B;  1Y6X A;  4O2B B;  3OEE G;  3K9M A;  3NXS A;  4EFE A;  2R9O A;  4CC6 A;  3ZJZ A;  4MS2 A;  2YEV B;  2EX3 A;  4JAA A;  2E5L B;  2DYS B;  2RJZ A;  4B3S O;  2XU3 A;  2FO5 A;  3I06 A;  3IGA C;  4A5U B;  2E5L O;  1FPO A;  1XOU A;  2FL4 A;  5JCO A;  2UUA O;  1PPD A;  1VAR A;  1QLN A;  3CH2 X;  2AU1 A;  4I9Q A;  4DR1 B;  5LA6 A;  1U96 A;  1EZJ A;  3DF0 A;  4QE7 A;  3OM3 B;  3FKS G;  4PI3 A;  4P2Z A;  1JVM A;  3THO A;  3JD3 A;  3GVM A;  1XBL A;  4UVB A;  3X2Q B;  3RYI A;  2ZQM A;  4IIJ B;  2AVW A;  2YJB A;  4NTW A;  2YXY A;  1KC8 W;  4ZOL B;  3CWB H;  4XR7 A;  1IWD A;  5LOV B;  1WN7 A;  2YSU B;  5IJ0 A;  3LXS A;  4X6H A;  3DC6 A;  4NTX A;  1KD1 W;  5IJ0 B;  2FT2 A;  4I0X B;  4B7E A;  1YTF B;  4BOU A;  3JCU Z;  2EIK B;  2ZE5 A;  3CME V;  2ZKO A;  3STZ C;  2QM8 A;  2FYU H;  5JH7 B;  4JI3 B;  2LO1 A;  4MI7 A;  4BR6 A;  5IYZ A;  3CC4 V;  2N74 A;  3APQ A;  2CAZ C;  3ZMZ A;  3LNN A;  4HZ3 A;  3PRM A;  4RY2 A;  2QEX V;  1ZTE A;  2ZDI C;  4Z2W A;  4JI8 O;  5KHK A;  4FLX A;  1MA1 A;  3AI8 A;  4RO2 A;  3G4S V;  3E8H A;  2FKX A;  4X66 O;  4NXN B;  2PI5 A;  2AUZ A;  2VHF A;  1P84 F;  2A0L A;  5LA6 B;  3RWR D;  3GB7 C;  2BSK B;  3V6C A;  3F75 A;  4X66 B;  2ADP A;  4KFM A;  3RYF B;  4ZKI A;  4NYK A;  1CJL A;  3E9S A;  3CPW U;  3K03 A;  3TET A;  1YVB A;  3H01 A;  3ZMT A;  4JTC B;  2GHY A;  2Q67 A;  4F4L A;  2WLH A;  5A9G A;  1S5J A;  3WXE A;  2P5O A;  1SZT A;  4U7N A;  4K8X A;  3OF8 A;  2JQF R;  4REZ A;  3H89 A;  1ROP A;  4PP2 E;  3B79 A;  2HP8 A;  4K0K B;  4KP4 A;  2AZ0 A;  1AYV A;  5ITZ A;  1RPR A;  1WP8 A;  4OXS A;  4MTG A;  5LMN O;  2DQ0 A;  1I7F A;  3ZHR A;  3K9S A;  1OV9 A;  1NH2 D;  4RUE A;  3J7A U;  5LHH A;  2F7D A;  1W59 A;  3F5T A;  3ZHU A;  3N2G B;  3ZNH A;  2XUM A;  4BIO A;  5L3C A;  5BR8 O;  5C8Y A;  4CH5 A;  4TUY A;  4JI6 B;  4CZZ A;  1HR0 B;  5LP6 C;  5A2Q N;  1EN4 A;  1NVP B;  4MTO A;  3OD4 A;  3HKC A;  2Y0P A;  5KHH A;  4WA6 A;  1ZSP A;  3P32 A;  2PI4 A;  1P49 A;  3IEJ A;  5JJE B;  1O0E A;  1DF4 A;  4R7C A;  4J10 A;  1EWL A;  1TVK B;  2CK3 G;  4D7S A;  5L3F A;  4AXM A;  5LMU B;  4LNU B;  4FFK A;  1THZ A;  4X64 B;  1MDW A;  2JVD A;  2R9A A;  5E6J A;  1Y74 B;  3OEH G;  1Y4M A;  1KHQ A;  4DR2 O;  4LF4 O;  1GKF A;  1U97 A;  4DUZ B;  3K0D A;  1DGS A;  2BTW A;  1AI5 A;  1K33 A;  3HWN A;  2G6D A;  1DF5 A;  2Q9L A;  1QQC A;  5L3D A;  4OW0 A;  4OVZ A;  1JJ2 U;  3PW3 A;  1SQB H;  4XZX A;  3OT7 A;  4JI2 O;  2UZJ A;  5EC1 C;  2ODM A;  1M6D A;  3BBA A;  3ZN1 A;  5FLX N;  3KCX A;  4X1I A;  2B1G A;  4N21 A;  7PCK A;  3AK3 A;  2BTQ B;  4WCE V;  4IIJ A;  2J7Q C;  1DTO A;  4P9P A;  1ZL8 A;  4NVP A;  5E1A C;  2DC8 A;  1OJH A;  1Y08 A;  2QJ1 A;  1ZAU A;  2LGW A;  2GV9 A;  2PTM A;  4IHJ A;  3ZRX A;  2O57 A;  1QR8 A;  2EIJ B;  2OP3 A;  2JGD A;  3K08 A;  4IT5 A;  3K24 A;  2Y48 A;  1XHX A;  5DM6 V;  1H8E G;  8PCH A;  4H44 B;  2DC7 A;  1GLO A;  3IHP A;  4JPR A;  3HR0 A;  4GX1 A;  5EYP B;  5KA6 A;  5GON A;  2Y69 B;  2BTW B;  3PNR A;  3RVV A;  2YIB D;  2P67 A;  3BEH A;  2DCD A;  2R9F A;  1OHH G;  2JTC A;  2ZNJ A;  5CBF A;  1XI1 A;  4H13 B;  5J2T A;  2CDY A;  4QRV A;  3KWB X;  2BOC C;  4GKK O;  4R3D A;  1F51 A;  1H2G A;  4J80 A;  4DR5 O;  4OVZ B;  2W6J G;  4K3A A;  4KHP O;  4G54 A;  3ZRW B;  4JI4 B;  1YSC A;  4QE9 A;  3JAK B;  1GAX A;  3FB7 C;  3JAT A;  4UFZ A;  2CTQ A;  4FJC A;  3ZN0 A;  5J2T B;  4U7O A;  4JF3 A;  1N36 O;  3M8A A;  4RQE A;  3FB6 C;  1XQ8 A;  5EBL C;  4LBE C;  3SYA A;  1EM1 A;  2AUX A;  1YF2 A;  2NN4 A;  4X20 A;  4J42 A;  1CB5 A;  5K1P A;  4HNA A;  3VBB A;  4PI0 A;  1GCB A;  4TQD A;  2WA3 A;  1Q82 W;  3I55 V;  2JGD B;  5F02 A;  1JQP A;  4GX2 A;  4W5C A;  3RVZ A;  4X65 B;  4OX9 O;  4LFA O;  1SET A;  4JYB A;  4N8W A;  3ICX A;  1AVM A;  2XT9 A;  4X65 O;  4O4H B;  1YK8 A;  1ENV A;  3CD6 V;  3LFY A;  1KFU L;  3WFV A;  4JI3 O;  2A7W A;  3I3T A;  4LFB O;  3B77 A;  1YEW A;  3BAA A;  4QPK A;  5CA0 B;  1KP3 A;  2HG5 C;  1NTZ H;  2RCV A;  4FK5 C;  1SQV H;  2QGN A;  2CTP A;  2XAJ A;  4WFA V;  4FZ1 A;  3SDL A;  1A6R A;  2ZNI A;  4DR1 O;  1Y66 A;  4JAS A;  1S72 V;  2WLI B;  1MZF A;  3LNM B;  1VJV A;  4DR6 B;  1JMK C;  2XAS A;  4CH6 A;  4DRX B;  2WLL B;  3EVK A;  4YYQ A;  1MAB G;  3BY6 A;  3MJ5 A;  2CB5 A;  1QLE B;  5B66 Z;  2B1I A;  3MTV A;  1SES A;  1VMG A;  5EIB D;  1UJW B;  5B3S B;  5LL6 Y;  3K58 A;  5LP6 B;  2OYQ A;  1Q81 W;  3K8U A;  3ZMU A;  1WPX A;  3PBH A;  5CN0 A;  1KYO F;  1I08 A;  5EZS A;  1VQ8 V;  1BGY H;  1GMG A;  2JRI A;  3ZHQ A;  2DWE C;  4I9W A;  1N32 O;  4DR3 O;  2F4V O;  5L3G A;  2UXC B;  4GT1 A;  2Q7E A;  5EF4 A;  4OPH A;  5KHG A;  2WLM A;  1TVK A;  4P9O A;  3C9E A;  2ZT9 B;  2P4V A;  4D6T H;  3HKB A;  3SPJ A;  3G71 V;  2X6B A;  4JV5 O;  3CCM V;  1XHZ A;  4CC5 A;  1P7G A;  3M7M X;  1J95 A;  2BCC H;  4CDE B;  1HUC B;  2VS0 A;  4YYR A;  3E86 A;  2YI8 A;  1FJG O;  3ETE A;  3O0U A;  3CCQ V;  5C8Y B;  1GN2 A;  1YVW A;  3N2G A;  1DEU A;  2Q73 A;  4FM0 A;  1F7Y A;  1I5Y A;  4JGS A;  5IYB O;  1FJG B;  3JYC A;  1EF7 A;  2YIA A;  4R8C A;  1CPY A;  4YY3 O;  1UPG A;  3K57 A;  3Q4H A;  2E02 A;  1R1B A;  1KUQ A;  3FAV A;  4JI6 O;  1WAZ A;  2BE3 A;  1ZL8 B;  1WLE A;  4CH3 A;  3HHA A;  3OMI B;  4OX9 B;  1STF E;  1CVZ A;  3BRC A;  2Q5Z A;  2UUB O;  2QM7 A;  1AIM A;  2CIO A;  1IBK B;  2ILM A;  3UKM A;  3WG7 B;  4JV5 B;  1MSW D;  2RNB A;  3P3N A;  4MVR A;  1THE A;  1MSD A;  4KUM A;  2NLJ C;  5CA0 A;  1FFX A;  3F7V C;  4MZO A;  5K16 A;  2UXN A;  2EIN C;  1RPO A;  3OFN G;  2M7W A;  2ZXW B;  1K9M W;  1CV8 A;  3DTU B;  2H8P C;  5HFL A;  2FUD A;  3ASN C;  4NKG B;  3UQ8 A;  4GUA A;  3CRA A;  3OTO O;  4DW1 A;  4JI0 O;  3E8G A;  3WU2 Z;  4RKX A;  1P4R A;  2PYL A;  4YY3 B;  5CHV A;  5IWA O;  1XEQ A;  1D5N A;  1XNR O;  4UB6 Z;  1UKF A;  2E76 B;  3AG7 A;  3H1J H;  4ICG A;  3K5L A;  1Q8I A;  4UV8 A;  4DV5 B;  3CBK A;  3OUF A;  2OWO A;  2HHH O;  4F6R B;  3ABM C;  2UUA B;  1G4Y B;  1F23 A;  2BTQ A;  2UUB B;  4UCT A;  1VF5 B;  2PZS A;  4BS6 A;  1K34 A;  1OCZ B;  2DJG B;  2EJ7 A;  3OQC A;  5CA1 B;  1S4V A;  1E79 G;  3VQY A;  3W7U A;  1ZIV A;  4TWK A;  2YC0 A;  2QKS A;  1VQ7 V;  2GFO A;  3OTF A;  1IZ3 A;  4DUZ O;  3AK1 A;  4X6J A;  1XMO O;  3ML0 A;  2P90 A;  2W0X A;  3QT4 A;  2Q8V A;  3LSS A;  9PAP A;  4UCO A;  4GKJ B;  2R9C A;  2QE7 G;  4CZW A;  3IJ4 A;  4O4I B;  5GTI Z;  1XNR B;  4QPJ A;  4WBN A;  3T1H B;  2DYR B;  5FPR A;  3GCB A;  1L1F A;  3SPC A;  2M6Y A;  4RNA A;  4DV3 B;  4LF8 B;  1NZ6 A;  1AEC A;  1J5E O;  1N0N A;  2UU9 O;  3FAV B;  2P86 A;  3SYP A;  1ZLZ A;  2PBH A;  2RMK B;  4HXD B;  3ETQ A;  2ITC C;  2WSS G;  3ABL C;  1Q6H A;  3JAW B;  1I94 O;  3VQV A;  2YID A;  3RYF A;  3PDF A;  4JI7 O;  4MW8 A;  5JVD B;  4NR1 A;  3CCL V;  5IYD O;  4XDJ A;  5J2U A;  3J81 N;  3OVX A;  2LFR A;  2Y4U A;  1WB7 A;  3QF7 A;  4WFH A;  3T1H O;  4MSW C;  5J9P C;  4BIU A;  1FS0 G;  1V9P A;  3SYC A;  2P22 C;  3AG4 B;  1IXM A;  4J9Y B;  1BMF G;  3UCS C;  2QR4 A;  2YIC A;  4CBC A;  1B3Q A;  4BOZ A;  1ARO P;  4IHJ B;  5IYZ B;  3B21 A;  3LSU A;  2IBZ H;  4D7T A;  1SS3 A;  4LFB B;  2XND G;  3JAR B;  4XUI A;  2IW5 A;  3K5O A;  4UCV A;  4I0X A;  1IBK O;  1NQC A;  1KU9 A;  1G6U A;  3JD0 A;  1K3B B;  1PIP A;  3APO A;  3JSL A;  4ZHQ A;  4B3S B;  1NJI W;  5CBH A;  2G8J A;  4EEQ A;  4QRG A;  3HPL C;  1SC5 B;  2KG7 B;  3CJH B;  1EZV H;  3H1K H;  3SJA C;  5B1O A;  1AU4 A;  4LWS B;  2XU5 A;  1R3K C;  1V54 C;  3QJ3 A;  1SQG A;  1JA8 A;  1BL8 A;  2JS5 A;  4X62 B;  1YIT V;  3FD9 A;  1SZX A;  4D8E A;  1URF A;  3D3Q A;  1BQZ A;  2EIM B;  3N27 A;  3ASO B;  4W4U A;  2ZD9 A;  4LF6 B;  3WB1 A;  4PD4 F;  3CBJ A;  1YHQ V;  2Q7H A;  4YJ2 A;  3ZHS A;  1FD9 A;  3N3K A;  4AIL C;  1O9H A;  1NKD A;  2GTA A;  1PXV A;  3BOW A;  2F93 B;  1BY8 A;  1Y67 A;  2XAH A;  4ZOL A;  1F2A A;  1V55 C;  2Q0O C;  3RVY A;  3KKU A;  2Z3Y A;  2CTW A;  4PA9 A;  3UT5 B;  4O2B A;  3AG3 C;  1R3I C;  1COW G;  4HBN A;  2ACT A;  4O2A B;  4FPP A;  5GTH Z;  2DJF B;  2FTD A;  5LGU A;  1AB3 A;  2RQ6 A;  1NT2 B;  1OCO C;  3QG5 A;  2IPP B;  3OVZ A;  4BOS A;  3H6S A;  1VQL V;  3B40 A;  2WA4 A;  4O4L B;  4CDD B;  3TCU A;  1KMI Z;  4MTF A;  3G6B A;  4JZG A;  4K0K O;  3CCU V;  2E00 A;  3IFU A;  1RFY A;  3FB5 C;  4LC1 A;  1QR9 A;  2ZXW C;  3AG1 B;  4P16 A;  1VQ9 V;  1MMM A;  3TJT A;  1K97 A;  4CDF B;  4X9Q A;  3AG3 B;  1GK9 A;  2AW9 A;  1FXK A;  3QNE A;  1AI7 A;  3M99 A;  1IUR A;  4BSQ A;  2LQT A;  2IM9 A;  2JEX A;  2NR5 A;  1NQT A;  3F7Y C;  1BE3 H;  2JEU A;  2PUS A;  1PBH A;  1PNM A;  4KXR A;  1F29 A;  4GX5 A;  4JZ2 A;  3ABL B;  4DV0 O;  1F2B A;  3CC7 V;  2WLN A;  3RYC B;  2R72 A;  5LMU O;  1MHW A;  4H0L B;  4X64 O;  2E01 A;  4BIZ A;  2QWQ B;  2ATK C;  1YZB A;  4DR2 B;  2PYJ A;  1DKI A;  2G7Y A;  2VQE B;  1Q7Y W;  3LDE A;  1AI6 A;  1H2N A;  4CS4 A;  4MVQ A;  5BY1 A;  4YYW A;  4PDL A;  2GUZ B;  1YJW V;  1M1K W;  2JK5 C;  3P5U A;  2YIB A;  5PAD A;  4FLV A;  1NVP D;  5B1A C;  1PP9 H;  3JAL A;  2P4K A;  4X1Y A;  2FRQ A;  1Q43 A;  3BPF A;  1AI4 A;  1Z5W A;  1Y76 B;  1YT7 A;  4QBB A;  1KKD A;  3B8M A;  2Q6A A;  4WFB V;  2PF4 E;  5H9C A;  2IJJ A;  4DV0 B;  2KG7 A;  4PAD A;  4O4J A;  2NQG A;  1I94 B;  2N05 A;  4FLZ A;  3D36 C;  4LFC O;  1NLJ A;  4AHC A;  4PA6 A;  3ZMS A;  1Q6K A;  1HNX O;  4JI4 O;  2Z84 A;  3ZIA G;  3DXR A;  4BAY A;  2IBI A;  1FKA O;  2GHU A;  2FE8 A;  4A5U A;  1CTE A;  2Q0A A;  3IAY A;  5BXZ A;  1S77 D;  3ZS8 C;  1ZUQ A;  5L3E A;  3P30 A;  2YDE A;  1TL9 A;  3BY4 A;  4TV9 A;  3T2M A;  3HKD B;  2ETN A;  2ZE7 A;  3K5M A;  5LYJ B;  3C3S A;  5BMV B;  5KMG A;  3E22 B;  4ZTB A;  3BWK A;  2AHZ A;  5J94 A;  1XL6 A;  3SPI A;  4LFC B;  2C0Y A;  4AQY B;  3CRC A;  3H1L H;  4QGP A;  1R73 A;  4B3R O;  1PL4 A;  3K5N A;  3CP1 A;  4Z1V A;  1AYU A;  2OUL A;  1EWO A;  4N4Z A;  3VOU A;  5JJN B;  1R6K A;  3ZBH A;  1XDC A;  3JAK A;  1J5E B;  4DV2 O;  2OCH A;  1ZWI C;  1F4M A;  4FLW A;  5CHT A;  5KO3 A;  4I50 B;  4CS2 A;  2LP7 A;  1N33 O;  2DCB A;  3QO7 A;  3L70 H;  2IJH A;  4DV2 B;  3HB3 B;  3RVX A;  4DV6 O;  1LR1 A;  5DEC A;  1YTF D;  3S3R A;  2B5U A;  5H6R A;  5JA7 A;  2F43 G;  2FYE A;  1VQP V;  5KAI Z;  2F95 B;  5JCO C;  2Z0A A;  3RVW A;  4DV3 O;  4LF8 O;  1SP4 B;  1BHA A;  2P0R A;  4TT3 G;  4DR3 B;  2ZE6 A;  5CA3 A;  1RSO A;  1AJN A;  1VF6 A;  1WNS A;  1ORQ C;  3CRM A;  4R50 A;  4FVM A;  4ZI7 A;  3QTC A;  1VQ5 V;  4Q20 A;  1VSN A;  4NTY A;  1PAD A;  4X6I A;  3ABK C;  4I55 A;  3TXS A;  2ZDI A;  2UXB O;  4Z1M G;  1L0L H;  2EIJ C;  1R6N A;  4HAM A;  3N2K A;  4ZI7 B;  1EWP A;  2DJV A;  2YI9 A;  4FMT A;  1YXB A;  1CSB B;  2XU4 A;  3ZX6 A;  2VWK A;  3ZCC A;  3PN1 A;  1HP8 A;  3BB7 A;  1QBZ A;  1PE6 A;  2JJ1 G;  1JFF B;  4TV8 B;  1FFX B;  2ATO A;  2FRA A;  3JAM N;  4P6E A;  5DED A;  5HFM A;  5EZQ A;  4YYU A;  2AGA A;  3CXC U;  3ZED A;  2EIN B;  3VQX A;  3IOQ A;  1U5I A;  4DV7 O;  1G1X B;  1NB3 A;  1KQS U;  1HWY A;  4O4H A;  3C90 A;  1I5X A;  4MT8 A;  3IUT A;  3JAT B;  3Q4H B;  1TLO A;  4GLX A;  3K3W A;  1US6 A;  4ZIB A;  3SYO A;  3L73 H;  5TIS Z;  1SA0 B;  2KB1 A;  3FB8 C;  4I4T B;  2J7Q A;  2ZIO A;  1RM1 B;  5FPW A;  1K92 A;  4UXN A;  3E2E A;  1FXK B;  3RT3 C;  3CCV V;  1FXV A;  2YS8 A;  3P5V A;  2W0F C;  2QWR B;  4DR7 B;  4KHP B;  4MW3 A;  2UXC O;  1NI8 A;  4YV8 A;  3HKB B;  4UVA A;  4JI1 O;  2AYO A;  1BS3 A;  1XNQ O;  4WFF A;  2XHB A;  3P5W A;  2RN9 A;  4RF1 A;  5EBW C;  1I0H A;  2QTS A;  3D3I A;  4FJC C;  5ITZ B;  4DV4 B;  4P6G A;  1TA8 A;  3HKD A;  2WPD G;  1AJQ A;  3N3G A;  5JWP A;  1GN4 A;  1AP5 A;  2OCC B;  4ABM A;  3CCS V;  2NQA A;  3CXH F;  1SQP H;  1FXK C;  2ADQ B;  3OMN B;  4LF5 O;  2ZE8 A;  4FIP C;  4X88 A;  2AHY A;  4HYO A;  4XDK A;  4LFA B;  4YHH O;  5CVO B;  4WFE A;  1GEC E;  4I07 A;  4WUR A;  3K06 A;  2ZIN A;  2GBO A;  2P7T C;  4YXW G;  2IJK A;  1IBM O;  2VHS A;  4LCU C;  4OPA A;  2IU3 A;  3L75 H;  2AIM A;  5FL7 G;  1AU3 A;  2GDS A;  5BMV A;  5KMG B;  1H2S B;  2WLI A;  5DN6 G;  5H6Q A;  1Y76 A;  4KLB A;  1Q6I A;  2E75 B;  2VQF O;  2CE4 A;  5IY5 C;  1AU0 A;  2MW2 B;  2NQD B;  3RNV A;  1RP3 B;  4JAU A;  1WP7 A;  3LSQ A;  4JI7 B;  2HXZ A;  4IGG A;  4UCU A;  3RGB A;  5IDJ A;  3IC9 A;  3PJS K;  2X7R B;  1SQQ H;  4HWY A;  1HNX B;  1XUQ A;  3DXR B;  4JTD B;  3UM7 A;  4J7K A;  2R70 A;  4QIW F;  4AQY O;  1VQM V;  5KAF Z;  2R9I A;  1U9X A;  2B1N A;  1BCC H;  2BU3 A;  5A24 A;  2DZY A;  1K5Q A;  3E83 A;  1S3J A;  2HHH B;  4XDL A;  2YUA A;  3CJH A;  4MVO A;  3KKY A; 
#chains in the Genus database with same CATH homology
 5H5N A;  4DV2 O;  4KHP O;  1HNW O;  2J7Q A;  5KO3 A;  4D8B A;  1N33 O;  2HWK A;  3RT3 C;  3PT2 A;  5EZS A;  3OQC A;  2DOS A;  4DV0 O;  4B3M O;  3W31 A;  2JRI A;  5LMU O;  1N32 O;  4D8E A;  1HNZ O;  4DV6 O;  1N36 O;  4DR3 O;  4X64 O;  2UXC O;  3M8A A;  2F4V O;  4DUZ O;  1R6T A;  1A32 A;  1X59 A;  5E6J A;  1YZB A;  1XMO O;  1DKI A;  2UXD O;  3O65 A;  4JI1 O;  4OPH A;  4DR2 O;  4X62 O;  4D8I A;  4LF4 O;  4BOU A;  1XNQ O;  4B3T O;  5BY1 A;  4RF1 A;  4IP3 A;  2ZKO A;  4LF9 O;  2Z0A A;  4DR7 O;  2BTW A;  5JZE A;  4MI7 A;  4DV3 O;  4LF8 O;  2N74 A;  4LF6 O;  3PHW A;  4JV5 O;  4OW0 A;  4RNA A;  1HR0 O;  4OVZ A;  3C0R A;  4XZX A;  3PRP A;  3PRM A;  4JI2 O;  2UZJ A;  3PHX A;  1J5E O;  2UU9 O;  1AIL A;  3BBA A;  5FLX N;  3W30 A;  3R66 A;  4JI8 O;  4BOP A;  1FJG O;  4OX9 O;  4DV5 O;  4LFA O;  4HXD B;  4IUM A;  2J7Q C;  2FKX A;  4X66 O;  2VQE O;  1F7Y A;  1NS1 A;  4X65 O;  4DUY O;  4LF5 O;  1PVJ A;  1I94 O;  4NXM O;  4DV4 O;  4YY3 O;  4LFC O;  3T1Y O;  4JI3 O;  3TMP A;  4JI7 O;  1N34 O;  4YHH O;  2UXB O;  1HNX O;  1R1B A;  4LFB O;  4WUR A;  1AB3 A;  3E9S A;  4NXN O;  4JI4 O;  1KUQ A;  4LF7 O;  2Z84 A;  4JI6 O;  4DR6 O;  4BOS A;  3MP2 A;  3J81 N;  1IBM O;  2DJV A;  4OPA A;  1FKA O;  2FE8 A;  4A5U A;  2UUB O;  3T1H O;  3BB7 A;  4B3S O;  4GKJ O;  5BXZ A;  4REZ A;  2VQF O;  4A5U B;  3SDL A;  3RNV A;  3JAM N;  2E5L O;  4K0K O;  3PHU A;  3BY4 A;  4BOZ A;  5EZQ A;  3IFU A;  4PT5 A;  3J80 N;  2AGA A;  4DR1 O;  1D2D A;  2UUA O;  1XMQ O;  4JI5 O;  3B21 A;  2BTW B;  4DV7 O;  4ZTB A;  2ZM6 O;  5LMN O;  4GUA A;  2JTC A;  3OTO O;  1G1X B;  4DR4 O;  1IBL O;  4P16 A;  4JI0 O;  3J7A U;  4RKX A;  3TRK A;  3MJ5 A;  4AQY O;  1IBK O;  2LW7 A;  3F5T A;  5IWA O;  4DV1 O;  1XEQ A;  4JYA O;  4GKK O;  1XNR O;  1UKF A;  4M0W A;  4R3D A;  2BU3 A;  3ZNH A;  3MTV A;  4B3R O;  5BR8 O;  3PSE A;  2UUC O;  1FYJ A;  2HHH O;  1DK1 A;  5A2Q N;  4DR5 O;  5IT9 N;  5LL6 Y;  4OVZ B;  4BOQ A;  4RF0 A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...