1YZBA

Solution structure of the josephin domain of ataxin-3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
b'MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Machado-Joseph disease protein 1
publication title The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1yzbA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1yzbA01
3SDLA 5BR8O 1IBKO 3J80N 2UUCO 3O65A 1XEQA 5IT9N 4NXMO 5LL6Y 4DV1O 2ZKOA 4JI1O 5LMNO 4JI6O 4DR4O 4YY3O 1N33O 4B3TO 2HHHO 4LF9O 2F4VO 4K0KO 1AILA 1HR0O 2UXDO 2Z0AA 1J5EO 2UXCO 4AQYO 4LF4O 1KUQA 4DV2O 4JI8O 4DUZO 4DR3O 1IBLO 5BY1A 4LF6O 4JV5O 4JI2O 4GKJO 2DJVA 3F5TA 2VQFO 2UUBO 1I94O 1G1XB 1IBMO 4LF8O 2AGAA 2UXBO 3RT3C 1X59A 4X66O 1YZBA 1HNXO 3OTOO 2UUAO 1R6TA 4DR7O 3JAMN 5FLXN 4B3SO 2UU9O 1N36O 1D2DA 5H5NA 5LMUO 1FKAO 1N32O 1HNZO 1XMOO 3T1YO 1XNQO 1FJGO 4JI4O 4X64O 4DV4O 4DR1O 2ZM6O 4LFCO 5A2QN 2DOSA 4X65O 4LFBO 4DV0O 4A5UB 4JI7O 4NXNO 1AB3A 4LF5O 4GKKO 4LFAO 4OX9O 1R1BA 5IWAO 4LF7O 4JI5O 4YHHO 2FKXA 1F7YA 1N34O 4KHPO 1DK1A 1XNRO 4B3RO 1A32A 3J7AU 4DR2O 2N74A 3J81N 4DV6O 2LW7A 3T1HO 2JRIA 3R66A 4DV7O 1NS1A 4B3MO 4JYAO 5BXZA 4OPHA 4X62O 4DR5O 4DUYO 4DV3O 4JI3O 3M8AA 1FYJA 4JI0O 2E5LO 4DV5O 1XMQO 2VQEO 4OPAA 4DR6O 1HNWO
chains in the Genus database with same CATH superfamily
1M56C 3CX5F 3P32A 4W4LA 4QJFB 1EWMA 1YTFD 4NXMO 3OMNB 1AJQA 3N2KB 3T1CA 3CH2X 1U97A 4X20A 4JYCA 1NH2B 4LF9B 1AP6A 4UUJC 1J5EO 2UXCO 2HFEC 1QVFU 2WLIA 1KUQA 1WN7A 1PPOA 2EBOA 1Z5WA 3AG2C 1VIBA 3CRMA 4QPKA 4IIJB 4TV9A 3CCSV 1DF4A 2DJVA 4I55B 1AYVA 3RYFA 4D7SA 3STLC 3AK2A 5LXTB 2DQ3A 5FL7G 3BHPA 1Y76A 1GN6A 4Z1MG 3RNVA 5EK0A 3RYCB 1GMYA 4RUFA 4DR7O 1HDJA 2E01A 5CBHA 1MIRA 2YJ9A 2P22C 3ABTA 3ABKC 1AROP 4BIUA 5ITZA 4G54A 2GTSA 4JI4O 4HWYA 3QG5A 5A2QN 2ZE8A 2DOSA 1AYWA 3K79A 2PUSA 2BOBC 2EILB 3BWKA 3E89A 1NB3A 2CTQA 1H2NA 3BA9A 4E4EA 4L8JA 3K24A 2XAFA 3OQCA 1K5SA 3L75H 4N8WA 5IJ0A 3FB5C 1H2LA 4B3RO 3B77A 2YI9A 3CC7V 2EIMB 4UCTA 3H1HH 1GTOA 1YHQV 3JATA 4NTYA 1CXZB 1QQCA 1FXVA 2UXDB 2Q7EA 4KL1A 5A24A 3FD9A 2B1GA 4MVRA 4LF6B 5CB4B 1IBKO 4QH6A 1OCOB 4XZXA 3TJTA 1PP9H 4I9WA 1YDXA 4DV1O 3CCLV 4I50A 4OXSA 4O4IB 3THOA 3K57A 4UVAA 4HBNA 4YY3O 2UUAB 1COWG 3TCUA 4W4KA 3SPJA 1N36B 1WAZA 5CVOB 2XU3A 1WB8A 4ZOLB 1KFXL 2ZINA 4DR3O 2FRAA 1ZAUA 1VMGA 4I4TB 2DYSB 2IU3A 2GV9A 4DR1B 2ZM6B 2ZDIC 3D6SA 3P30A 3TMPA 2LQTA 2HWKA 2BDLA 1FFXB 4X66O 4DMXA 4KLBA 1PNKA 1HNXO 4YYQA 4KFMA 4GX2A 3A0BZ 2LP7A 2C0YA 5FLXN 1XOUA 1ATKA 1CV8A 4MTXA 2R9FA 2ETNA 3K5MA 5JZEA 1UFIA 2JQFR 5IYBO 5EIBD 2DZZA 4FLWA 2EILC 4FK5C 2PNSA 4Z1VA 4MT8A 2HD5A 2DWEC 2ADPA 2F66C 3P5WA 3BBAA 4X62B 4WFFA 2GTAA 5KA5A 1FXKA 5EYPA 1ZSPA 1WPBA 2HEPA 2EIMC 3N27A 5JH7A 1TUEB 1TAEA 1XNRB 2N04A 2QR4A 3CMEV 1PPPA 2ZXWB 3B8NA 4U3JB 2R9RB 2ZNIA 3N3KA 2BCCH 5GTIZ 4X89A 5FPOA 5LGTA 4M0WA 3K5LA 4QIWF 4PDVA 3W30A 2A3QA 1YCIA 9PAPA 3OEHG 1BQIA 4OPHA 1KYOF 3MTNA 4JI0B 5KUMA 1V9PA 5KAIZ 3JSLA 4XUIA 1OCOC 5JWPA 2CH7B 4PELA 3HHIA 1ZWIC 2AW9A 2F93B 2Y0PA 1EZVH 2NQDB 4LWSA 1BHAA 3AG3B 2GUZA 3SDLA 3E86A 3M99A 4AHCA 1CB5A 1XEQA 1OCRB 4QE7A 3LDEA 1Z2GA 2NNUA 3WB1A 1NKDA 4HXDB 2IJIA 1TUBB 3N2GA 3SYOA 4Q6GA 2HHHO 4IL6Z 1SS3A 1HR0O 1GH6A 3V6CA 2CIOA 3G80A 2WBFX 2YEVA 1JPXA 3P3NA 2YIDA 2DYSC 1AIMA 4MSWC 2Z84A 2XU4A 1YK7A 4J11A 2YJBA 2HH5A 5GONA 2QM7A 3DC6A 3OF8A 2ZT9B 2JGDB 2LFRA 4X65B 2MK3A 5CHTA 5L3GA 1YZBA 1KHPA 2O57A 3CB2A 4X1YA 2BSKA 1NBMG 2AYOA 3OGCC 2XT9A 3F7YC 3PT2A 2LW1A 4Q8GA 1QNMA 3K5NA 4G2KA 3EVKA 1AYUA 3MJ5A 1BY8A 4D8BA 3K3WA 1BS3A 3K0GA 4LFAO 3BRCA 2XAGA 1W0KG 4JYAB 4KUMA 4DR5B 2JJ1G 2P6JA 3QSDA 2ZXWC 3L72H 2WLLB 4KXRA 1BGOA 2J7QA 4UB6Z 1N0JA 2DE0X 4H0LB 5GTHZ 5CA1B 4FLVA 2DCBA 1B3QA 1L0NH 2FMLA 4LCUC 3PBHA 2NN4A 1YEWA 3TRKA 4NXMB 4F6EA 1SNKA 5KX5A 3U10A 3KZIZ 3ZMVA 1G4YB 4K35A 4BS5A 3RYHA 3RVZA 1FFTB 1J5EB 2UXCB 2OYQA 3M8AA 2FYEA 3KWBX 3LXSA 3AG3C 2G6DA 3HKBB 3KW9A 4OPAA 1OCRC 1BQZA 5IYZA 5LGUA 1SQBH 1SQQH 2PTMA 3JD3A 1R73A 1NQCA 4WFAV 3ZRSA 2UUCO 2QWOB 2F7DA 1QMYA 4OVZB 5LOVA 4LNUA 2X6CA 4QE9A 4B3TO 4DR7B 2B9ZA 4JASA 1NTZH 4DV2O 4X6IA 1AU3A 3HR0A 1XL6A 3CCMV 2JEXA 2YJ8A 2ZNJA 2OULA 4RUEA 2PBHA 2R6NA 5LHHA 4FM2A 1NU1H 4JI4B 1T5EA 3QTCA 3IV2A 4BOUA 5L3EA 4ZKIA 3IFXA 4GYCB 3LSSA 1SA0A 2CDYA 3U11A 5CHVA 1A6RA 1MEGA 2QKCA 4TQDA 3IAYA 3DXRB 4J41A 5JJJB 3ETQA 1PPNA 3GWOA 4N21A 2ODMA 1H38A 4J7KA 1GKFA 4TV8A 4B3RB 4GLXA 2QE7G 4NR1A 5BZBA 3WB0A 1AP5A 3IC9A 3QF7A 3ZUAA 4AI8A 1QHTA 1SQPH 3U8EA 1CP9A 2JEUA 2QSAA 3CJHB 5CVMA 3IC7A 4GZRB 5EZYA 4GKKO 1RFYA 1K33A 5CVNB 3LNNA 4I5SA 1F51A 3ZN0A 4NVPA 1AR5A 5IJ9B 2IU0A 4AXMA 4FJCA 4WFHA 2OCCB 3JAKA 1DF0A 4PA6A 4MVQA 3OMAB 1IBKB 1PE6A 3CYOA 1QLEB 2G8JA 3O0UA 1SC5B 1AR4A 3OFNG 3E35A 3OR7C 3WXEA 1Y4MA 3CSXA 3D8CA 4DV1B 1PPJH 1XREA 2EZOA 2P86A 2C2AA 3IGAC 4YIPA 3ZHSA 2VWKA 4H33A 3Q4HA 4X1IB 1NQTA 1BHBA 3K03A 1XMQO 5BMVA 2BTWA 5CMUA 3CRQA 5B1NA 1K9MW 1AR1B 4CDFB 3WXFA 4DR3B 2FT2A 1Y08A 4IUMA 2ZIMA 1H8EG 1PNMA 3P5VA 4CH3A 1SQXH 2FO5A 4DW0A 5JH3A 4X66B 2WLHA 4YJ3A 4J10A 4JI6O 2EINB 1HNXB 1W2BU 4GUNA 3E8HA 4YYSA 1Q7YW 1VQ4V 4PI3A 3E8BA 4OW0A 4P6GA 4AQYO 2E3CA 1VQNV 1BQ0A 2NQAA 4P6EA 4YXWG 4N79A 3O9OA 3JARB 1MABG 3K9SA 1MEMA 1OJHA 2IJKA 2KG7B 4WFBV 1NH2D 2Z5UA 1GN2A 5K1PA 1U5IA 2JTCA 1U9VA 2R9OA 2NQIA 1I0HA 1K4DC 5EC1C 1BT8A 4XDKA 1K73W 2H3OA 3S3QA 2CTPA 3AK1A 3C90A 1PL0A 2O6XA 2OP3A 3CC2V 1R3IC 5LHGA 2QA4V 2N05A 5J2TA 1BL8A 3QJ3A 1Q6HA 2ZR2A 4RQEA 3W7UA 2HHNA 4IHJA 3C3SA 4FZ0A 3GVMA 1F2AA 2YI8A 4DV0O 4A5UB 3JASA 3K9MA 1AB3A 4LF5O 3TGUH 2OCCC 3F5VA 3BCCH 3ZHUA 2ZCEA 5B1AB 4LF7O 4H37A 4YJ2A 1QLEC 2EIKB 5LBQA 1MSWD 4PP1A 1WA8B 4PDMA 1UJWB 2D3OW 1Y6XA 2ZR3A 2QWRB 1D5AA 2ITDC 4RO2A 4DK0A 2Q69A 3ZMZA 1M93A 2G7YA 1VF6C 1CJLA 1KHQA 4F6RB 1NS1A 1CS8A 1XHZA 1THEA 3RYCA 1P49A 1U9QX 2HHHB 1HR0B 1NB5A 3QNEA 2BTQB 3IJ4A 1F29A 2DW4A 1ZL8A 2Q7HA 1OZ0A 2GSMB 2HVKC 1I5XA 2P5OA 4O2BA 3SR2C 4O4LA 3CC4V 4BOZA 4MZOA 1YT7A 5CA3A 3JCUZ 5H2FZ 4X1KB 3O65A 4J7ZA 3MHHA 2EINC 2WAMA 5EC2C 4EFEA 4O2AB 2ATKC 1ENVA 4K0KO 4TUYA 4BWAA 2OCHA 2DC9A 4DRXB 2NR5A 2EJRA 2YSUB 1NPZA 1W59A 3USVA 3SPCA 2PGGA 5K16A 2Q67A 5AG2A 5BY1A 3OVZA 4JI2O 4G28B 2PF4E 2YIAA 2VQFO 1I94O 4ZHQA 4LF8O 3A2FA 4FFBA 3UCSC 2NQGA 4LFAB 3OTOB 4UV9A 1NI8A 5PADA 4I07A 1SP4B 4FIPC 1MOFA 3I56V 2R9IA 2H7JA 3H1JH 5EBWC 2X6BA 3RWRD 5H5NA 5K1XA 2A9HA 1ICFA 1YVBA 3ZRWA 1HNZB 2F1GA 1FJGO 3I3TA 4R6ZA 3D36C 4CBCA 5FNVB 4NTWA 4WBNA 5B1AC 1NT2B 4FLZA 4BSQA 3OTFA 2EIKC 1YSCA 1PPDA 3ZJZA 1YVWA 2VHSA 5FPWA 3L9DA 2W0FC 1M9NA 4RWUA 4CC5A 1DK1A 3LFYA 1BCCH 4BW5A 4BIOA 2UUCB 5CA0A 3K8UA 4MVZA 1EFRG 5LP6B 1PL4A 2JRIA 4MVMA 3RVYA 2VHFA 2R72A 2KSDA 4B3TB 2AS8A 1WJZA 2QGNA 4JI3O 1U96A 4Q20A 4DV2B 1N4CA 2HP8A 4TWKA 1RSOB 2AUXA 3PDFA 3MHSA 1VF5B 1N33O 3PHXA 5KUKA 1XBLA 3ZNHA 4QGPA 4CH4A 4PHZA 2JJ2G 3BY4A 5BR8B 1R3LC 3OT7A 1QOLA 3PRPA 1CPYA 3RVXA 2ZKOA 4JI1O 3FB8C 5LMNO 2JIZG 2Q0OC 4DR4O 3FFQA 4UCUA 4GCZA 4FFKA 1ZUQA 5JVDB 2YC0A 3CCEV 2PI5A 4LC1A 1EF7A 2CB5A 4J9ZB 2KQXA 1P4RA 3FB6C 3NXSA 4O4HA 1KKDA 4JPRA 3ZCCA 1IBLB 1LNQA 3AI8A 4BOPA 2ILMA 1IBMO 4HNAA 1KC8W 2IJHA 1AU4A 2DJGB 4X20B 4GKKB 1OCCB 2P0RA 3CXHF 2FRQA 2WLIB 1Q43A 1VQ7V 2JQGR 1D2DA 3O1GA 1G6UA 3RYIA 1MDWA 1UKFA 2G8EA 3EHBB 2RNBA 4JTAB 1N32B 4TV9B 2Q7GA 4DV4O 4RY2A 3RYFB 4JF3A 1ORQC 2PY5A 1HUCB 3A8TA 2PYJA 3UQ8A 4LFBO 1Y76B 4MSXA 3MAQA 5IWAO 1DGSA 2QTOA 4JI5O 1M6DA 1ZCMA 1GCBA 1XMQB 3VQVA 5JCOC 4XDJA 1CSBB 2KKWA 1JQ0A 1YI2V 3NHEA 5E6JA 2FYUH 5LP6C 1JR9A 5ITZB 3RVWA 2F1MA 1Q3EA 2EULA 2PYLA 3AG4B 3BEHA 2Y4TA 1Y66A 4DV7O 1DF5A 4JI6B 1ZLZA 4U7NA 1K8AW 1PXVA 2A7WA 2K1EA 1EWPA 4AQYB 1DTOA 3S3XA 1H2KA 2E74B 4CDEB 5IJ0B 1TLOA 4UCSA 5HFLA 4JTCB 4JYYA 4UCVA 2ATOA 4E2LA 3IUTA 4PADA 2Q8VA 4K7CA 5IT9N 1UPGA 4ICGA 5LL6Y 4PA7A 3JATB 4ABMA 4B08A 1YITV 3HKCA 1AILA 2OIEA 4LF4O 4I9QA 1AU0A 1TVKA 2FUDA 4I0XA 3JD0A 3BPMA 5LA6A 1Y67A 3VBBA 2XU1A 3F7VC 5CBGA 4EFBA 1O9GA 1P7GA 3F5TA 2AVWA 4UXNA 1O0EA 2UUBO 1OCCC 3X2QB 1Y74A 3H7DA 1L0LH 4I50B 2P4KA 1Q8IA 4FMTA 4DV0B 2UXXA 3ZRXA 5J2UA 1KFUL 4LF5B 4BR6A 2ZD9A 2YICA 1NJIW 4LF7B 2DCCA 5KO3A 2W0XA 3JAMN 3SYPA 2IW5A 3TXQA 5C8YB 1VQLV 2B1MA 4FLXA 3BB7A 2H8PC 2WLJA 1H2SB 1K3BB 2AHYA 2YXYA 4K3AA 4OVZA 4X64B 4LFCO 4EB6A 1SRYA 3P5UA 1POPA 3B21A 1KU9A 2YIBD 2VRZA 2BOCC 3ZHTA 2Q4PA 3HKEA 1W0JG 3BAAA 5J94A 4BAYA 1OCZB 3K06A 4UCOA 3AG4C 2ACTA 4P16A 2XUMA 3F5WC 1IX9A 1GK9A 5DEDA 4O4JA 1MMMA 4YIOA 3CS5A 3CBJA 3H9VA 3OUSA 1YJ9V 1TGOA 4YYVA 2B5UA 4UFZA 3L74H 3CD6V 2R9NA 3NR7A 2QKAA 1SF9A 1VQ9V 4K0KB 4CS3A 4PI2A 2Z3YA 1XKGA 2FTDA 1FXKB 3HKDA 4B7EA 1FYJA 3UT5A 2VQEO 3TNXA 1MZEA 2RCVA 5JH7B 3ETDA 2Q68A 4BS6A 3IMAA 1HNWB 3DGEA 4JI2B 2CTRA 2CTWA 3TK1A 1R3JC 2JVDA 3SJBC 2VQFB 1I94B 2R9MA 3CJHA 3CPWU 4MM3B 1K7DA 2LO1A 4LF8B 4ZI7A 1ZX3A 3K0DA 4PA9A 4GUAA 5JQGA 1B6QA 4LF9O 2QJ1A 3PW3A 1X9YA 2Z0AA 2RDCA 3CBKA 1BGYH 2RN9A 5D5PA 1VEWA 2W6JG 1SQGA 3X2QC 4FLTA 2WLMA 1S77D 2GUZB 1F4NA 2CAZC 3M99B 1R3KC 3H89A 3VOUA 1GM8A 2E00A 3ZBHA 1PVJA 2UXBO 4N4ZA 1HP8A 4PDLA 3KCYA 3N2GB 1FAFA 1VJVA 3AG7A 3QVNA 2XU5A 4HAMA 3PRMA 3PHUA 2YEVB 3JD1A 1KD1W 3ETGA 2WA3A 4MVUA 3ZHRA 4IYHA 1JQPA 7PCKA 5GONB 2XAQA 1SETA 3ZRVA 4U3FH 5EGWA 4W5BA 1KBHA 1GECE 1OCZC 3D3QA 3FAVA 1YJNV 2VWJA 4JI3B 4YHHO 2FKXA 4X1YB 2BSKB 3STZC 4UV8A 3C9EA 4KHPO 3I06A 1N33B 4CZZA 2HG5C 5E1AC 3QT4A 3JARA 4FPPA 4DO2A 1D5NA 2CK3G 1US6A 3OVXA 1YJWV 4JYBA 1FXKC 4YVAA 4FLYA 4MTGA 5LMNB 4K8ZA 3OF9A 4DR4B 3BPFA 3ZMUA 3LDDA 2F95B 3ZMTA 4L87A 4QPJA 2E02A 5JJEB 1JA8A 3G6EV 2KB1A 3HPLC 4QRVA 3LUTB 3K04A 1I5YA 1QXPA 4DR6O 3KFQA 1MS6A 5KMGA 2IPPB 3J80N 5B1OA 4IT5A 3OM3B 3MDSA 1EN6A 4RF0A 2GFOA 1IBMB 1S4VA 2R9CA 5EZQA 1VSNA 5KX5B 3OW2U 3I55V 1PADA 1M90W 4MTFA 4PI0A 5LYJA 2WLNA 3H8CA 4YY3B 3CP1A 4XR7A 2QM8A 4PA3A 4LBEC 4W5CA 1IXMA 1MG1A 5A9GA 3ICXA 3LNMB 1J95A 5IE9A 4X8AA 3FKSG 3KCXA 4JI8O 3JAWB 5IYZB 1XHXA 4J42A 2P7UA 3JALA 1Q5OA 2XOKG 1KP3A 1AVMA 5KHJA 2R9AA 4J9YB 3WG7B 3RGBA 2PADA 1EBOA 5LOVB 1FPOA 3AEIA 2WPDG 1FXHA 1JFFA 3CRAA 4LNUB 4JI5B 3VQYA 2DMXA 1IVSA 1E1RG 4RNAA 4Z2WA 2YS8A 1CEZA 3PSEA 4NTXA 4MZSA 4NYKA 1Q82W 1KB9F 1K5QA 1MNGA 3UO2A 1XNQO 5B3SB 5C93A 3M7MX 3GCBA 1L8DA 3FYIB 3OD4A 5J9PC 1S5JA 2MW2B 2JS3A 3ZIAG 1GRJA 4JI7O 4DV7B 1SA0B 4JAUA 1BZKA 2ZQMA 1VP7A 4X88A 1JMKC 3APOA 5B5EZ 3LDCA 1N34O 3BPZA 3KX1A 4TV8B 2Y48A 1XNRO 1NVPB 5L3CA 1EWOA 2YJCA 2N74A 2OTJV 3B09A 2E76B 2DZYA 5KHKA 2GHYA 1KXRA 2BE3A 3OAAG 3N2KA 3T1HO 4GX0A 2J7QC 5EZYB 2Q73A 5IDJA 5BXZA 2EJ7A 1VQMV 2V4DA 4JI0O 3E2EA 4C7UA 4DV5O 3JAKB 5KHGA 1F2BA 2YXHA 2HR3A 4IIJA 3E9SA 4BQVA 1Q6UA 4I55A 5LXTA 4DK1A 2IH1C 4PDRA 4R3DA 4ZBMA 3Q4HB 4Q8HA 1XQ8A 4D8IA 1S3JA 2ZDIA 3SGIA 3CCRV 3ZHQA 2QWNB 5BMVB 2P90A 4IYIA 2BTWB 2Q9LA 3WG7C 4DUZO 2FQ9A 4EKWA 4JV5O 2AXTZ 3E83A 4X9QA 4LFCB 3S3WA 1G1XB 5DECA 4BOSA 4W4UA 4JZGA 3G4SV 4FK5A 4YJ3B 3PHWA 2QKSA 1R6TA 3OUFA 1PIPA 3SJCC 4B3SO 2UU9O 3ASNB 5B3SC 1M4UA 3B2EE 1E79G 3OR6C 4PV1B 2X6AA 3WB2A 4MVSA 3ABMB 1K97A 2IM9A 3CMAV 4FLUA 4NXNO 1L1FA 2DN9A 2JK5C 2Y4UA 1F23A 3KG2A 1GO3F 2HLDG 3E22B 3E8FA 4PJ0Z 1BP4A 2VQEB 1R6KA 2W6IG 4GT1A 4PD4F 4CDDB 5H6RA 4BPVA 5CB4A 5J2TB 4DR2O 3ZEDA 1NLJA 2DJFB 4IHJB 4O4IA 5EF4A 3K59A 3JASB 4B3MO 4FJCC 1V54B 5HFMA 4YJ2B 4DV3O 1GMGA 4I7ZB 3AK3A 1LUVA 4P9PA 4X6HA 3R65A 2IBIA 4ZOLA 3SPGA 2ITCC 4UVBA 1Q6IA 4CDCB 4NKGB 2LFSA 4I4TA 2OZ2A 1P7BA 1B04A 4OELA 3GWKC 3JD2A 4UB8Z 2UXBB 1FFXA 2L6LA 1DLBA 2XNDG 3K08A 1FS0G 3ETEA 1SQFA 2B1IA 3TXSA 4N23A 5CBFA 3MP2A 2WWWA 4LH6A 1ZL8B 3JSNA 4CS2A 3I5DA 1IDSA 4O2BB 4O4LB 4X6JA 2Q0AA 3ZS8C 1RM1B 4GKJO 2A0LA 2F23A 3RBZA 1GN4A 3JD4A 1PBHA 2K9PA 4JGSA 4CZWA 2YXLA 5L3BA 1BSMA 1X59A 3ASNC 5TISZ 2RJZA 4TUYB 1IWDA 4CS4A 4YHHB 5B1BB 1S5HC 2AHZA 4KHPB 5H9CA 4JAAA 1P84F 3ZHVA 1NR7A 4NB5A 1XL4A 3ABMC 5LMUO 4CC6A 1XUQA 2OIGA 1XMOO 4U3JA 3HHAA 3APQA 4LH7A 1TU6A 1F4MA 1Z5VA 4ZHQB 1SERA 4REZA 2QWQB 3W7SA 2XTAA 3IHPA 4JZ2A 2AYNA 3W7XA 4FFBB 4WF9V 2OTLV 4J7JA 1F7YA 2A79B 2P4VA 1HW7A 2QM4A 4RAIA 1IXBA 2BDZA 2CH7A 4DR6B 3W31A 1BE3H 2CGNA 3BABA 3ZX6A 2IH3C 2HKOA 3ZRWB 1MA1A 5L3DA 3CHXA 1STFE 4RKXA 2AZ0A 1V54C 1VQ5V 4DV6O 4WBNB 1FH0A 1FD9A 1Q81W 4WCEV 5FPRA 1PKXA 4DW1A 2Q5ZA 1ME3A 3U0ZA 1M5IA 1OV9A 1YTFB 5KA6A 1VQ6V 3PN1A 3ERVA 4ZUXU 2DC8A 1TUBA 2DQ0A 4I04A 3WXGA 3G71V 2G38A 4TSFG 5H6QA 5C8YA 4DUYO 3DTUB 3FYEB 1KKCA 1LR1A 2LJ2A 1JJ2U 4JI8B 2IJJA 1HWYA 1M1KW 2YUAA 4MTOA 5CA0B 2Y69B 1AI7A 2LGQA 1K4CC 3VQWA 1KMIZ 2JGDA 3BFRA 1VQPV 4IP3A 4R50A 1YALA 4EEQA 2Y5BA 5KHIA 4YV8A 2PI4A 1AJPA 4P30A 1QBZA 3BOWA 2CUGA 1RM1C 4U7OA 3MHHC 3SPHA 1CPJA 1AJNA 1O9HA 1IZ3A 1QR8A 2HJDA 4MI7A 2X0LA 1VQOV 1CQDA 3K9AA 1S76D 1XNQB 2ZE5A 1THZA 3E1ZB 1EM1A 3GB7C 2LGWA 1ITOA 3RN4A 4WURA 5B1BC 1WPXA 4JI7B 3CCVV 2JS5A 1WP7A 4LP8A 5LHIA 4H44B 3UKMA 4D6TH 2DC7A 4CH5A 3A0HZ 1N34B 2WLLA 4XBFA 1I08A 2FL4A 4O4HB 5CA1A 1QDQA 3SJAC 1EN4A 3SPIA 3IEJA 1QU7A 1H8HG 3T1YO 1OHHG 1X4TA 2GHUA 1SQVH 1VQKV 4HNAB 1S0VA 3T1HB 3CE2A 2UZJA 5GW7A 4DMYA 5IY5B 4DXWA 4OX9O 1R1BA 1QVGU 4FVMA 2PZSA 4DV5B 3DC5A 4B7KA 3HKBA 3BC3A 3OMIB 1NTKH 2PREA 2DCAA 3RYIB 3ZMSA 4TQFA 4KP4A 2V1DA 1YK8A 2AIMA 1B06A 2Y0IA 3OEEG 2RQ6A 2LW7A 2E03A 5D5QA 3R66A 1Q6KA 3D3IA 2DCDA 4WFEA 3V6EA 1TL9A 1YF2A 2E5LO 4G27B 3LSQA 2DWDC 2Y69C 2D2CB 4TT3G 4YYRA 1S5LZ 1ROPA 1CVZA 4DUZB 3CH3X 4JV5B 5EBLC 2CGOA 3AG1B 3G6BA 2AZ2A 2BTOA 2YJ2A 1GAXA 4GX5A 1GM9A 1CTEA 1WB7A 1NZ6A 3W7WA 4YYWA 3MHSC 2F4VO 5KAFZ 3RFRA 1EZJA 3DXRA 4B3SB 5EYPB 1EN5A 2YIBA 4R7CA 2UU9B 3B40A 2FTKA 4I05A 3H1KH 5LGNA 1XI1A 5IYDO 4WFGA 2ZE6A 1NR1A 3CCUV 3H6SA 3HWNA 2P67A 3T4DA 1DEUA 4J80A 4PA4A 2AGAA 3BA8A 2IBZH 5L3FA 3L71H 4NXNB 3OTOO 1K34A 3HKCB 4HYOA 2WSSG 3KSEA 3A0RA 2EX3A 2CE4A 5B66Z 1TVKB 5IJ9A 4K8XA 4I0XB 1N0NA 1WLEA 5LA6B 1FKAO 2ZE7A 3MORA 3PJSK 3IFUA 1HNZO 4DR2B 4LWSB 1U9XA 3TETA 3MD0A 1FJGB 2WA4A 5IY5C 2AUZA 1Y74B 2DYRB 2JGUA 3LSUA 3RW0A 1VF7A 3DSQA 3WU2Z 5J2UB 4B3MB 4X1IA 2XAJA 1VF6A 6PADA 4MW8A 1Q86W 4DV3B 2QEXV 3IOQA 1IURA 2JDIG 4D7TA 1I7FA 2M6YA 4QRXA 2R70A 4QBBA 2ZIOA 1S72V 3JAWA 5F2VO 3UO3A 3H1IH 2Y6EA 1PNLA 3CCQV 3KKUA 5IYCO 4EB6B 2OT5A 2DC6A 3P5XA 1XDCA 2B1NA 2NLJC 1RPRA 1KECA 3HD3A 3F75A 3HKEB 3FB7C 1NVPD 4OEMA 1R6NA 2GBOA 1Y4HA 3K58A 4F4LA 3AG1C 4YYUA 2EIJB 3L70H 5JJNB 3H1LH 3KWZA 5BR8O 4GKJB 2X7RB 1MSDA 4O4JB 3ABUA 4CH6A 1Q90D 2KG7A 1PD3A 1M57B 3UM7A 3CXCU 3SYCA 5CN0A 4JI1B 3FX7A 3CWBH 4JAVA 3WFVA 3CEIA 5EBMC 2UXDO 3HKDB 3OGIB 3UT5B 4MVOA 1KQSU 1LUWA 2BU3A 2HJFC 2QTSA 1V55B 4OGQB 5LMUB 4D8EA 5EIBC 2RMKB 1IBLO 4LF6O 2AU1A 1XMOB 4FIPA 3CCJV 2FB5A 2M7WA 1AU2A 4WA6A 4ZI7B 1MZFA 3RT3C 4A5UA 1JOYA 3D36A 4HZ3A 5JQGB 2UUAO 2XHBA 2OWOA 8PCHA 1JX9A 2WLKA 3RYHB 3EFFK 1N36O 1WA8A 4UCRA 2DYRC 3W7TA 3BCNA 1N32O 4P2ZA 1H2MA 3E8GA 1ZTEA 2P7TC 3S3RA 3CRRA 4DR1O 2ZM6O 4DV4B 4FM0A 3QO7A 4DV6B 1KP2A 3HB3B 1VQ8V 2E75B 4LFBB 2VS0A 3T4ZA 4F6RA 1EWLA 2A06H 4GX1A 4PP2E 3BVOA 4FM1A 5IWAB 2BTQA 4DUYB 4QNHB 1H2GA 4MS2A 2EZPA 4MW3A 1PM9A 1QLNA 1SKVA 3ABLB 2ADQB 2V7QG 5KHHA 3JYCA 3H8BA 3P3PA 1A32A 4BOQA 4X1KA 3MTVA 3DF0A 3CRCA 1K92A 1QCEA 4XDLA 1K3EA 3B8MA 4O2AA 3L73H 2EIJC 5EZSA 3FAVB 4AXLA 2GDSA 4X62O 1YIJV 3SYAA 4ZIBA 2ARHA 5DM6V 5KLVH 4DRXA 4TOIA 3SYQA 3ASOB 1F2CA 1N8RW 3VQXA 4ZTBA 1QR9A 1GN3A 1M57C 1GM7A 1WP8A 4FZ1A 2FE8A 1AI4A 3QO5A 3C0RA 1AI6A 3ML0A 1M56B 4R8CA 3T2MA 1V55C 3BY6A 3E22A 3N4CA 1MHWA 4P9OA 1BMFG 1TA8A 2XASA 4LF4B 1PV0A 1ME4A 2Q6AA 1JCHA 3G67A 4AILC 3PNRA 2P06A 1NL6A 5KMGB 5JA7A 3OE7G 4UVCA 4LR3A 2HVJC 3ZN1A 3T1YB 4RF1A 4JTDB 1URFA 5FNVA 1XILA 3AG2B 2XAHA 2UUBB 1YXBA 5F02A 2L35A 1DKIA 3H01A 5E79Z 5LYJB 1WNSA 4OX9B 1SESA 3K5OA 4RQFA 1RPOA 2QWPB 1GLOA 3B4SA 4IGGA 3JALB 1JVMA 2YDEA 5JCOA 3C3TA 3EXAA 4X64O 3ABKB 3OISA 5LP6A 4X65O 1AI5A 3QO8A 1ZIVA 3JCZA 1JFFB 3ABLC 2HXZA 4QRGA 4PT5A 2F43G 4DYLA 2E5LB 1AECA 1E1QG 1RSOA 3KKYA 4ASUG 3B79A 1SZTA 3J7AU 4BW9A 1G8MA 3RVVA 1RP3B 3SJQC 3J81N 2ARYA 2H94A 4BIZA 1U9WA 3ASOC 4H13B 1JJOA 2F4VB 4JYAO 5JVDA 4DR5O 3N3GA 1VARA 1SZXA 2UXNA 2QDOA 1NTMH 1PCIA 5DN6G 1HNWO
chains in the Genus database with same CATH topology
3ZNHA 3E9SA 4IUMA 3SDLA 5BR8O 1IBKO 3J80N 3BY4A 2FE8A 2UUCO 3O65A 1XEQA 4XZXA 4RF0A 3PRPA 5IT9N 4OVZB 4NXMO 3C0RA 5EZQA 5LL6Y 4MM3B 4DV1O 2ZKOA 4JI1O 4IP3A 5LMNO 4R3DA 4HXDB 4GUAA 4JI6O 4DR4O 4YY3O 1N33O 4B3TO 2HHHO 4LF9O 2F4VO 4K0KO 4D8IA 1AILA 1HR0O 2UXDO 2Z0AA 1J5EO 2UXCO 4OW0A 4AQYO 3MP2A 4LF4O 1KUQA 4DV2O 2BTWB 2BU3A 2Z84A 4JI8O 4D8EA 4MI7A 4DUZO 4DR3O 1IBLO 5BY1A 4LF6O 4JV5O 4JI2O 4GKJO 2DJVA 4RF1A 4BOPA 3F5TA 2VQFO 2UUBO 1I94O 1G1XB 4WURA 1IBMO 3TMPA 4BOUA 4BOSA 4LF8O 2AGAA 1PVJA 2HWKA 2JTCA 2UXBO 3RT3C 4A5UA 1X59A 4X66O 1DKIA 3RNVA 1YZBA 3PHWA 1HNXO 3OTOO 2UUAO 1R6TA 4DR7O 5KO3A 3JAMN 5FLXN 4B3SO 3PRMA 4RNAA 3PHUA 2UU9O 1N36O 5JZEA 3BB7A 3PSEA 1D2DA 5H5NA 1UKFA 3PT2A 5LMUO 1FKAO 1N32O 3IFUA 1HNZO 1XMOO 3T1YO 1XNQO 1FJGO 3MJ5A 4JI4O 4X64O 4DV4O 4D8BA 4OVZA 4DR1O 2ZM6O 4LFCO 5A2QN 2DOSA 4REZA 3B21A 4X65O 4LFBO 4DV0O 4A5UB 4JI7O 2UZJA 4NXNO 1AB3A 4LF5O 4GKKO 4LFAO 4OX9O 3BBAA 4BOZA 1R1BA 5IWAO 4LF7O 4JI5O 4PT5A 4YHHO 2FKXA 1F7YA 3OQCA 1N34O 4KHPO 2J7QA 1DK1A 1XNRO 3W31A 4B3RO 5E6JA 4P16A 1A32A 3J7AU 4BOQA 4DR2O 2N74A 3MTVA 4RKXA 3TRKA 3J81N 4DV6O 2LW7A 4M0WA 3T1HO 2JRIA 3R66A 4DV7O 3W30A 1NS1A 4B3MO 2J7QC 5EZSA 4JYAO 5BXZA 4OPHA 4X62O 4DR5O 4DUYO 4DV3O 4JI3O 3M8AA 1FYJA 4JI0O 2E5LO 4DV5O 1XMQO 2VQEO 2BTWA 4OPAA 4ZTBA 4DR6O 1HNWO 3PHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDL A;  5BR8 O;  1IBK O;  3J80 N;  2UUC O;  3O65 A;  1XEQ A;  5IT9 N;  4NXM O;  5LL6 Y;  4DV1 O;  2ZKO A;  4JI1 O;  5LMN O;  4JI6 O;  4DR4 O;  4YY3 O;  1N33 O;  4B3T O;  2HHH O;  4LF9 O;  2F4V O;  4K0K O;  1AIL A;  1HR0 O;  2UXD O;  2Z0A A;  1J5E O;  2UXC O;  4AQY O;  4LF4 O;  1KUQ A;  4DV2 O;  4JI8 O;  4DUZ O;  4DR3 O;  1IBL O;  5BY1 A;  4LF6 O;  4JV5 O;  4JI2 O;  4GKJ O;  2DJV A;  3F5T A;  2VQF O;  2UUB O;  1I94 O;  1G1X B;  1IBM O;  4LF8 O;  2AGA A;  2UXB O;  3RT3 C;  1X59 A;  4X66 O;  1YZB A;  1HNX O;  3OTO O;  2UUA O;  1R6T A;  4DR7 O;  3JAM N;  5FLX N;  4B3S O;  2UU9 O;  1N36 O;  1D2D A;  5H5N A;  5LMU O;  1FKA O;  1N32 O;  1HNZ O;  1XMO O;  3T1Y O;  1XNQ O;  1FJG O;  4JI4 O;  4X64 O;  4DV4 O;  4DR1 O;  2ZM6 O;  4LFC O;  5A2Q N;  2DOS A;  4X65 O;  4LFB O;  4DV0 O;  4A5U B;  4JI7 O;  4NXN O;  1AB3 A;  4LF5 O;  4GKK O;  4LFA O;  4OX9 O;  1R1B A;  5IWA O;  4LF7 O;  4JI5 O;  4YHH O;  2FKX A;  1F7Y A;  1N34 O;  4KHP O;  1DK1 A;  1XNR O;  4B3R O;  1A32 A;  3J7A U;  4DR2 O;  2N74 A;  3J81 N;  4DV6 O;  2LW7 A;  3T1H O;  2JRI A;  3R66 A;  4DV7 O;  1NS1 A;  4B3M O;  4JYA O;  5BXZ A;  4OPH A;  4X62 O;  4DR5 O;  4DUY O;  4DV3 O;  4JI3 O;  3M8A A;  1FYJ A;  4JI0 O;  2E5L O;  4DV5 O;  1XMQ O;  2VQE O;  4OPA A;  4DR6 O;  1HNW O; 
#chains in the Genus database with same CATH topology
 1M56 C;  3CX5 F;  3P32 A;  4W4L A;  4QJF B;  1EWM A;  1YTF D;  4NXM O;  3OMN B;  1AJQ A;  3N2K B;  3T1C A;  3CH2 X;  1U97 A;  4X20 A;  4JYC A;  1NH2 B;  4LF9 B;  1AP6 A;  4UUJ C;  1J5E O;  2UXC O;  2HFE C;  1QVF U;  2WLI A;  1KUQ A;  1WN7 A;  1PPO A;  2EBO A;  1Z5W A;  3AG2 C;  1VIB A;  3CRM A;  4QPK A;  4IIJ B;  4TV9 A;  3CCS V;  1DF4 A;  2DJV A;  4I55 B;  1AYV A;  3RYF A;  4D7S A;  3STL C;  3AK2 A;  5LXT B;  2DQ3 A;  5FL7 G;  3BHP A;  1Y76 A;  1GN6 A;  4Z1M G;  3RNV A;  5EK0 A;  3RYC B;  1GMY A;  4RUF A;  4DR7 O;  1HDJ A;  2E01 A;  5CBH A;  1MIR A;  2YJ9 A;  2P22 C;  3ABT A;  3ABK C;  1ARO P;  4BIU A;  5ITZ A;  4G54 A;  2GTS A;  4JI4 O;  4HWY A;  3QG5 A;  5A2Q N;  2ZE8 A;  2DOS A;  1AYW A;  3K79 A;  2PUS A;  2BOB C;  2EIL B;  3BWK A;  3E89 A;  1NB3 A;  2CTQ A;  1H2N A;  3BA9 A;  4E4E A;  4L8J A;  3K24 A;  2XAF A;  3OQC A;  1K5S A;  3L75 H;  4N8W A;  5IJ0 A;  3FB5 C;  1H2L A;  4B3R O;  3B77 A;  2YI9 A;  3CC7 V;  2EIM B;  4UCT A;  3H1H H;  1GTO A;  1YHQ V;  3JAT A;  4NTY A;  1CXZ B;  1QQC A;  1FXV A;  2UXD B;  2Q7E A;  4KL1 A;  5A24 A;  3FD9 A;  2B1G A;  4MVR A;  4LF6 B;  5CB4 B;  1IBK O;  4QH6 A;  1OCO B;  4XZX A;  3TJT A;  1PP9 H;  4I9W A;  1YDX A;  4DV1 O;  3CCL V;  4I50 A;  4OXS A;  4O4I B;  3THO A;  3K57 A;  4UVA A;  4HBN A;  4YY3 O;  2UUA B;  1COW G;  3TCU A;  4W4K A;  3SPJ A;  1N36 B;  1WAZ A;  5CVO B;  2XU3 A;  1WB8 A;  4ZOL B;  1KFX L;  2ZIN A;  4DR3 O;  2FRA A;  1ZAU A;  1VMG A;  4I4T B;  2DYS B;  2IU3 A;  2GV9 A;  4DR1 B;  2ZM6 B;  2ZDI C;  3D6S A;  3P30 A;  3TMP A;  2LQT A;  2HWK A;  2BDL A;  1FFX B;  4X66 O;  4DMX A;  4KLB A;  1PNK A;  1HNX O;  4YYQ A;  4KFM A;  4GX2 A;  3A0B Z;  2LP7 A;  2C0Y A;  5FLX N;  1XOU A;  1ATK A;  1CV8 A;  4MTX A;  2R9F A;  2ETN A;  3K5M A;  5JZE A;  1UFI A;  2JQF R;  5IYB O;  5EIB D;  2DZZ A;  4FLW A;  2EIL C;  4FK5 C;  2PNS A;  4Z1V A;  4MT8 A;  2HD5 A;  2DWE C;  2ADP A;  2F66 C;  3P5W A;  3BBA A;  4X62 B;  4WFF A;  2GTA A;  5KA5 A;  1FXK A;  5EYP A;  1ZSP A;  1WPB A;  2HEP A;  2EIM C;  3N27 A;  5JH7 A;  1TUE B;  1TAE A;  1XNR B;  2N04 A;  2QR4 A;  3CME V;  1PPP A;  2ZXW B;  3B8N A;  4U3J B;  2R9R B;  2ZNI A;  3N3K A;  2BCC H;  5GTI Z;  4X89 A;  5FPO A;  5LGT A;  4M0W A;  3K5L A;  4QIW F;  4PDV A;  3W30 A;  2A3Q A;  1YCI A;  9PAP A;  3OEH G;  1BQI A;  4OPH A;  1KYO F;  3MTN A;  4JI0 B;  5KUM A;  1V9P A;  5KAI Z;  3JSL A;  4XUI A;  1OCO C;  5JWP A;  2CH7 B;  4PEL A;  3HHI A;  1ZWI C;  2AW9 A;  2F93 B;  2Y0P A;  1EZV H;  2NQD B;  4LWS A;  1BHA A;  3AG3 B;  2GUZ A;  3SDL A;  3E86 A;  3M99 A;  4AHC A;  1CB5 A;  1XEQ A;  1OCR B;  4QE7 A;  3LDE A;  1Z2G A;  2NNU A;  3WB1 A;  1NKD A;  4HXD B;  2IJI A;  1TUB B;  3N2G A;  3SYO A;  4Q6G A;  2HHH O;  4IL6 Z;  1SS3 A;  1HR0 O;  1GH6 A;  3V6C A;  2CIO A;  3G80 A;  2WBF X;  2YEV A;  1JPX A;  3P3N A;  2YID A;  2DYS C;  1AIM A;  4MSW C;  2Z84 A;  2XU4 A;  1YK7 A;  4J11 A;  2YJB A;  2HH5 A;  5GON A;  2QM7 A;  3DC6 A;  3OF8 A;  2ZT9 B;  2JGD B;  2LFR A;  4X65 B;  2MK3 A;  5CHT A;  5L3G A;  1YZB A;  1KHP A;  2O57 A;  3CB2 A;  4X1Y A;  2BSK A;  1NBM G;  2AYO A;  3OGC C;  2XT9 A;  3F7Y C;  3PT2 A;  2LW1 A;  4Q8G A;  1QNM A;  3K5N A;  4G2K A;  3EVK A;  1AYU A;  3MJ5 A;  1BY8 A;  4D8B A;  3K3W A;  1BS3 A;  3K0G A;  4LFA O;  3BRC A;  2XAG A;  1W0K G;  4JYA B;  4KUM A;  4DR5 B;  2JJ1 G;  2P6J A;  3QSD A;  2ZXW C;  3L72 H;  2WLL B;  4KXR A;  1BGO A;  2J7Q A;  4UB6 Z;  1N0J A;  2DE0 X;  4H0L B;  5GTH Z;  5CA1 B;  4FLV A;  2DCB A;  1B3Q A;  1L0N H;  2FML A;  4LCU C;  3PBH A;  2NN4 A;  1YEW A;  3TRK A;  4NXM B;  4F6E A;  1SNK A;  5KX5 A;  3U10 A;  3KZI Z;  3ZMV A;  1G4Y B;  4K35 A;  4BS5 A;  3RYH A;  3RVZ A;  1FFT B;  1J5E B;  2UXC B;  2OYQ A;  3M8A A;  2FYE A;  3KWB X;  3LXS A;  3AG3 C;  2G6D A;  3HKB B;  3KW9 A;  4OPA A;  1OCR C;  1BQZ A;  5IYZ A;  5LGU A;  1SQB H;  1SQQ H;  2PTM A;  3JD3 A;  1R73 A;  1NQC A;  4WFA V;  3ZRS A;  2UUC O;  2QWO B;  2F7D A;  1QMY A;  4OVZ B;  5LOV A;  4LNU A;  2X6C A;  4QE9 A;  4B3T O;  4DR7 B;  2B9Z A;  4JAS A;  1NTZ H;  4DV2 O;  4X6I A;  1AU3 A;  3HR0 A;  1XL6 A;  3CCM V;  2JEX A;  2YJ8 A;  2ZNJ A;  2OUL A;  4RUE A;  2PBH A;  2R6N A;  5LHH A;  4FM2 A;  1NU1 H;  4JI4 B;  1T5E A;  3QTC A;  3IV2 A;  4BOU A;  5L3E A;  4ZKI A;  3IFX A;  4GYC B;  3LSS A;  1SA0 A;  2CDY A;  3U11 A;  5CHV A;  1A6R A;  1MEG A;  2QKC A;  4TQD A;  3IAY A;  3DXR B;  4J41 A;  5JJJ B;  3ETQ A;  1PPN A;  3GWO A;  4N21 A;  2ODM A;  1H38 A;  4J7K A;  1GKF A;  4TV8 A;  4B3R B;  4GLX A;  2QE7 G;  4NR1 A;  5BZB A;  3WB0 A;  1AP5 A;  3IC9 A;  3QF7 A;  3ZUA A;  4AI8 A;  1QHT A;  1SQP H;  3U8E A;  1CP9 A;  2JEU A;  2QSA A;  3CJH B;  5CVM A;  3IC7 A;  4GZR B;  5EZY A;  4GKK O;  1RFY A;  1K33 A;  5CVN B;  3LNN A;  4I5S A;  1F51 A;  3ZN0 A;  4NVP A;  1AR5 A;  5IJ9 B;  2IU0 A;  4AXM A;  4FJC A;  4WFH A;  2OCC B;  3JAK A;  1DF0 A;  4PA6 A;  4MVQ A;  3OMA B;  1IBK B;  1PE6 A;  3CYO A;  1QLE B;  2G8J A;  3O0U A;  1SC5 B;  1AR4 A;  3OFN G;  3E35 A;  3OR7 C;  3WXE A;  1Y4M A;  3CSX A;  3D8C A;  4DV1 B;  1PPJ H;  1XRE A;  2EZO A;  2P86 A;  2C2A A;  3IGA C;  4YIP A;  3ZHS A;  2VWK A;  4H33 A;  3Q4H A;  4X1I B;  1NQT A;  1BHB A;  3K03 A;  1XMQ O;  5BMV A;  2BTW A;  5CMU A;  3CRQ A;  5B1N A;  1K9M W;  1AR1 B;  4CDF B;  3WXF A;  4DR3 B;  2FT2 A;  1Y08 A;  4IUM A;  2ZIM A;  1H8E G;  1PNM A;  3P5V A;  4CH3 A;  1SQX H;  2FO5 A;  4DW0 A;  5JH3 A;  4X66 B;  2WLH A;  4YJ3 A;  4J10 A;  4JI6 O;  2EIN B;  1HNX B;  1W2B U;  4GUN A;  3E8H A;  4YYS A;  1Q7Y W;  1VQ4 V;  4PI3 A;  3E8B A;  4OW0 A;  4P6G A;  4AQY O;  2E3C A;  1VQN V;  1BQ0 A;  2NQA A;  4P6E A;  4YXW G;  4N79 A;  3O9O A;  3JAR B;  1MAB G;  3K9S A;  1MEM A;  1OJH A;  2IJK A;  2KG7 B;  4WFB V;  1NH2 D;  2Z5U A;  1GN2 A;  5K1P A;  1U5I A;  2JTC A;  1U9V A;  2R9O A;  2NQI A;  1I0H A;  1K4D C;  5EC1 C;  1BT8 A;  4XDK A;  1K73 W;  2H3O A;  3S3Q A;  2CTP A;  3AK1 A;  3C90 A;  1PL0 A;  2O6X A;  2OP3 A;  3CC2 V;  1R3I C;  5LHG A;  2QA4 V;  2N05 A;  5J2T A;  1BL8 A;  3QJ3 A;  1Q6H A;  2ZR2 A;  4RQE A;  3W7U A;  2HHN A;  4IHJ A;  3C3S A;  4FZ0 A;  3GVM A;  1F2A A;  2YI8 A;  4DV0 O;  4A5U B;  3JAS A;  3K9M A;  1AB3 A;  4LF5 O;  3TGU H;  2OCC C;  3F5V A;  3BCC H;  3ZHU A;  2ZCE A;  5B1A B;  4LF7 O;  4H37 A;  4YJ2 A;  1QLE C;  2EIK B;  5LBQ A;  1MSW D;  4PP1 A;  1WA8 B;  4PDM A;  1UJW B;  2D3O W;  1Y6X A;  2ZR3 A;  2QWR B;  1D5A A;  2ITD C;  4RO2 A;  4DK0 A;  2Q69 A;  3ZMZ A;  1M93 A;  2G7Y A;  1VF6 C;  1CJL A;  1KHQ A;  4F6R B;  1NS1 A;  1CS8 A;  1XHZ A;  1THE A;  3RYC A;  1P49 A;  1U9Q X;  2HHH B;  1HR0 B;  1NB5 A;  3QNE A;  2BTQ B;  3IJ4 A;  1F29 A;  2DW4 A;  1ZL8 A;  2Q7H A;  1OZ0 A;  2GSM B;  2HVK C;  1I5X A;  2P5O A;  4O2B A;  3SR2 C;  4O4L A;  3CC4 V;  4BOZ A;  4MZO A;  1YT7 A;  5CA3 A;  3JCU Z;  5H2F Z;  4X1K B;  3O65 A;  4J7Z A;  3MHH A;  2EIN C;  2WAM A;  5EC2 C;  4EFE A;  4O2A B;  2ATK C;  1ENV A;  4K0K O;  4TUY A;  4BWA A;  2OCH A;  2DC9 A;  4DRX B;  2NR5 A;  2EJR A;  2YSU B;  1NPZ A;  1W59 A;  3USV A;  3SPC A;  2PGG A;  5K16 A;  2Q67 A;  5AG2 A;  5BY1 A;  3OVZ A;  4JI2 O;  4G28 B;  2PF4 E;  2YIA A;  2VQF O;  1I94 O;  4ZHQ A;  4LF8 O;  3A2F A;  4FFB A;  3UCS C;  2NQG A;  4LFA B;  3OTO B;  4UV9 A;  1NI8 A;  5PAD A;  4I07 A;  1SP4 B;  4FIP C;  1MOF A;  3I56 V;  2R9I A;  2H7J A;  3H1J H;  5EBW C;  2X6B A;  3RWR D;  5H5N A;  5K1X A;  2A9H A;  1ICF A;  1YVB A;  3ZRW A;  1HNZ B;  2F1G A;  1FJG O;  3I3T A;  4R6Z A;  3D36 C;  4CBC A;  5FNV B;  4NTW A;  4WBN A;  5B1A C;  1NT2 B;  4FLZ A;  4BSQ A;  3OTF A;  2EIK C;  1YSC A;  1PPD A;  3ZJZ A;  1YVW A;  2VHS A;  5FPW A;  3L9D A;  2W0F C;  1M9N A;  4RWU A;  4CC5 A;  1DK1 A;  3LFY A;  1BCC H;  4BW5 A;  4BIO A;  2UUC B;  5CA0 A;  3K8U A;  4MVZ A;  1EFR G;  5LP6 B;  1PL4 A;  2JRI A;  4MVM A;  3RVY A;  2VHF A;  2R72 A;  2KSD A;  4B3T B;  2AS8 A;  1WJZ A;  2QGN A;  4JI3 O;  1U96 A;  4Q20 A;  4DV2 B;  1N4C A;  2HP8 A;  4TWK A;  1RSO B;  2AUX A;  3PDF A;  3MHS A;  1VF5 B;  1N33 O;  3PHX A;  5KUK A;  1XBL A;  3ZNH A;  4QGP A;  4CH4 A;  4PHZ A;  2JJ2 G;  3BY4 A;  5BR8 B;  1R3L C;  3OT7 A;  1QOL A;  3PRP A;  1CPY A;  3RVX A;  2ZKO A;  4JI1 O;  3FB8 C;  5LMN O;  2JIZ G;  2Q0O C;  4DR4 O;  3FFQ A;  4UCU A;  4GCZ A;  4FFK A;  1ZUQ A;  5JVD B;  2YC0 A;  3CCE V;  2PI5 A;  4LC1 A;  1EF7 A;  2CB5 A;  4J9Z B;  2KQX A;  1P4R A;  3FB6 C;  3NXS A;  4O4H A;  1KKD A;  4JPR A;  3ZCC A;  1IBL B;  1LNQ A;  3AI8 A;  4BOP A;  2ILM A;  1IBM O;  4HNA A;  1KC8 W;  2IJH A;  1AU4 A;  2DJG B;  4X20 B;  4GKK B;  1OCC B;  2P0R A;  3CXH F;  2FRQ A;  2WLI B;  1Q43 A;  1VQ7 V;  2JQG R;  1D2D A;  3O1G A;  1G6U A;  3RYI A;  1MDW A;  1UKF A;  2G8E A;  3EHB B;  2RNB A;  4JTA B;  1N32 B;  4TV9 B;  2Q7G A;  4DV4 O;  4RY2 A;  3RYF B;  4JF3 A;  1ORQ C;  2PY5 A;  1HUC B;  3A8T A;  2PYJ A;  3UQ8 A;  4LFB O;  1Y76 B;  4MSX A;  3MAQ A;  5IWA O;  1DGS A;  2QTO A;  4JI5 O;  1M6D A;  1ZCM A;  1GCB A;  1XMQ B;  3VQV A;  5JCO C;  4XDJ A;  1CSB B;  2KKW A;  1JQ0 A;  1YI2 V;  3NHE A;  5E6J A;  2FYU H;  5LP6 C;  1JR9 A;  5ITZ B;  3RVW A;  2F1M A;  1Q3E A;  2EUL A;  2PYL A;  3AG4 B;  3BEH A;  2Y4T A;  1Y66 A;  4DV7 O;  1DF5 A;  4JI6 B;  1ZLZ A;  4U7N A;  1K8A W;  1PXV A;  2A7W A;  2K1E A;  1EWP A;  4AQY B;  1DTO A;  3S3X A;  1H2K A;  2E74 B;  4CDE B;  5IJ0 B;  1TLO A;  4UCS A;  5HFL A;  4JTC B;  4JYY A;  4UCV A;  2ATO A;  4E2L A;  3IUT A;  4PAD A;  2Q8V A;  4K7C A;  5IT9 N;  1UPG A;  4ICG A;  5LL6 Y;  4PA7 A;  3JAT B;  4ABM A;  4B08 A;  1YIT V;  3HKC A;  1AIL A;  2OIE A;  4LF4 O;  4I9Q A;  1AU0 A;  1TVK A;  2FUD A;  4I0X A;  3JD0 A;  3BPM A;  5LA6 A;  1Y67 A;  3VBB A;  2XU1 A;  3F7V C;  5CBG A;  4EFB A;  1O9G A;  1P7G A;  3F5T A;  2AVW A;  4UXN A;  1O0E A;  2UUB O;  1OCC C;  3X2Q B;  1Y74 A;  3H7D A;  1L0L H;  4I50 B;  2P4K A;  1Q8I A;  4FMT A;  4DV0 B;  2UXX A;  3ZRX A;  5J2U A;  1KFU L;  4LF5 B;  4BR6 A;  2ZD9 A;  2YIC A;  1NJI W;  4LF7 B;  2DCC A;  5KO3 A;  2W0X A;  3JAM N;  3SYP A;  2IW5 A;  3TXQ A;  5C8Y B;  1VQL V;  2B1M A;  4FLX A;  3BB7 A;  2H8P C;  2WLJ A;  1H2S B;  1K3B B;  2AHY A;  2YXY A;  4K3A A;  4OVZ A;  4X64 B;  4LFC O;  4EB6 A;  1SRY A;  3P5U A;  1POP A;  3B21 A;  1KU9 A;  2YIB D;  2VRZ A;  2BOC C;  3ZHT A;  2Q4P A;  3HKE A;  1W0J G;  3BAA A;  5J94 A;  4BAY A;  1OCZ B;  3K06 A;  4UCO A;  3AG4 C;  2ACT A;  4P16 A;  2XUM A;  3F5W C;  1IX9 A;  1GK9 A;  5DED A;  4O4J A;  1MMM A;  4YIO A;  3CS5 A;  3CBJ A;  3H9V A;  3OUS A;  1YJ9 V;  1TGO A;  4YYV A;  2B5U A;  4UFZ A;  3L74 H;  3CD6 V;  2R9N A;  3NR7 A;  2QKA A;  1SF9 A;  1VQ9 V;  4K0K B;  4CS3 A;  4PI2 A;  2Z3Y A;  1XKG A;  2FTD A;  1FXK B;  3HKD A;  4B7E A;  1FYJ A;  3UT5 A;  2VQE O;  3TNX A;  1MZE A;  2RCV A;  5JH7 B;  3ETD A;  2Q68 A;  4BS6 A;  3IMA A;  1HNW B;  3DGE A;  4JI2 B;  2CTR A;  2CTW A;  3TK1 A;  1R3J C;  2JVD A;  3SJB C;  2VQF B;  1I94 B;  2R9M A;  3CJH A;  3CPW U;  4MM3 B;  1K7D A;  2LO1 A;  4LF8 B;  4ZI7 A;  1ZX3 A;  3K0D A;  4PA9 A;  4GUA A;  5JQG A;  1B6Q A;  4LF9 O;  2QJ1 A;  3PW3 A;  1X9Y A;  2Z0A A;  2RDC A;  3CBK A;  1BGY H;  2RN9 A;  5D5P A;  1VEW A;  2W6J G;  1SQG A;  3X2Q C;  4FLT A;  2WLM A;  1S77 D;  2GUZ B;  1F4N A;  2CAZ C;  3M99 B;  1R3K C;  3H89 A;  3VOU A;  1GM8 A;  2E00 A;  3ZBH A;  1PVJ A;  2UXB O;  4N4Z A;  1HP8 A;  4PDL A;  3KCY A;  3N2G B;  1FAF A;  1VJV A;  3AG7 A;  3QVN A;  2XU5 A;  4HAM A;  3PRM A;  3PHU A;  2YEV B;  3JD1 A;  1KD1 W;  3ETG A;  2WA3 A;  4MVU A;  3ZHR A;  4IYH A;  1JQP A;  7PCK A;  5GON B;  2XAQ A;  1SET A;  3ZRV A;  4U3F H;  5EGW A;  4W5B A;  1KBH A;  1GEC E;  1OCZ C;  3D3Q A;  3FAV A;  1YJN V;  2VWJ A;  4JI3 B;  4YHH O;  2FKX A;  4X1Y B;  2BSK B;  3STZ C;  4UV8 A;  3C9E A;  4KHP O;  3I06 A;  1N33 B;  4CZZ A;  2HG5 C;  5E1A C;  3QT4 A;  3JAR A;  4FPP A;  4DO2 A;  1D5N A;  2CK3 G;  1US6 A;  3OVX A;  1YJW V;  4JYB A;  1FXK C;  4YVA A;  4FLY A;  4MTG A;  5LMN B;  4K8Z A;  3OF9 A;  4DR4 B;  3BPF A;  3ZMU A;  3LDD A;  2F95 B;  3ZMT A;  4L87 A;  4QPJ A;  2E02 A;  5JJE B;  1JA8 A;  3G6E V;  2KB1 A;  3HPL C;  4QRV A;  3LUT B;  3K04 A;  1I5Y A;  1QXP A;  4DR6 O;  3KFQ A;  1MS6 A;  5KMG A;  2IPP B;  3J80 N;  5B1O A;  4IT5 A;  3OM3 B;  3MDS A;  1EN6 A;  4RF0 A;  2GFO A;  1IBM B;  1S4V A;  2R9C A;  5EZQ A;  1VSN A;  5KX5 B;  3OW2 U;  3I55 V;  1PAD A;  1M90 W;  4MTF A;  4PI0 A;  5LYJ A;  2WLN A;  3H8C A;  4YY3 B;  3CP1 A;  4XR7 A;  2QM8 A;  4PA3 A;  4LBE C;  4W5C A;  1IXM A;  1MG1 A;  5A9G A;  3ICX A;  3LNM B;  1J95 A;  5IE9 A;  4X8A A;  3FKS G;  3KCX A;  4JI8 O;  3JAW B;  5IYZ B;  1XHX A;  4J42 A;  2P7U A;  3JAL A;  1Q5O A;  2XOK G;  1KP3 A;  1AVM A;  5KHJ A;  2R9A A;  4J9Y B;  3WG7 B;  3RGB A;  2PAD A;  1EBO A;  5LOV B;  1FPO A;  3AEI A;  2WPD G;  1FXH A;  1JFF A;  3CRA A;  4LNU B;  4JI5 B;  3VQY A;  2DMX A;  1IVS A;  1E1R G;  4RNA A;  4Z2W A;  2YS8 A;  1CEZ A;  3PSE A;  4NTX A;  4MZS A;  4NYK A;  1Q82 W;  1KB9 F;  1K5Q A;  1MNG A;  3UO2 A;  1XNQ O;  5B3S B;  5C93 A;  3M7M X;  3GCB A;  1L8D A;  3FYI B;  3OD4 A;  5J9P C;  1S5J A;  2MW2 B;  2JS3 A;  3ZIA G;  1GRJ A;  4JI7 O;  4DV7 B;  1SA0 B;  4JAU A;  1BZK A;  2ZQM A;  1VP7 A;  4X88 A;  1JMK C;  3APO A;  5B5E Z;  3LDC A;  1N34 O;  3BPZ A;  3KX1 A;  4TV8 B;  2Y48 A;  1XNR O;  1NVP B;  5L3C A;  1EWO A;  2YJC A;  2N74 A;  2OTJ V;  3B09 A;  2E76 B;  2DZY A;  5KHK A;  2GHY A;  1KXR A;  2BE3 A;  3OAA G;  3N2K A;  3T1H O;  4GX0 A;  2J7Q C;  5EZY B;  2Q73 A;  5IDJ A;  5BXZ A;  2EJ7 A;  1VQM V;  2V4D A;  4JI0 O;  3E2E A;  4C7U A;  4DV5 O;  3JAK B;  5KHG A;  1F2B A;  2YXH A;  2HR3 A;  4IIJ A;  3E9S A;  4BQV A;  1Q6U A;  4I55 A;  5LXT A;  4DK1 A;  2IH1 C;  4PDR A;  4R3D A;  4ZBM A;  3Q4H B;  4Q8H A;  1XQ8 A;  4D8I A;  1S3J A;  2ZDI A;  3SGI A;  3CCR V;  3ZHQ A;  2QWN B;  5BMV B;  2P90 A;  4IYI A;  2BTW B;  2Q9L A;  3WG7 C;  4DUZ O;  2FQ9 A;  4EKW A;  4JV5 O;  2AXT Z;  3E83 A;  4X9Q A;  4LFC B;  3S3W A;  1G1X B;  5DEC A;  4BOS A;  4W4U A;  4JZG A;  3G4S V;  4FK5 A;  4YJ3 B;  3PHW A;  2QKS A;  1R6T A;  3OUF A;  1PIP A;  3SJC C;  4B3S O;  2UU9 O;  3ASN B;  5B3S C;  1M4U A;  3B2E E;  1E79 G;  3OR6 C;  4PV1 B;  2X6A A;  3WB2 A;  4MVS A;  3ABM B;  1K97 A;  2IM9 A;  3CMA V;  4FLU A;  4NXN O;  1L1F A;  2DN9 A;  2JK5 C;  2Y4U A;  1F23 A;  3KG2 A;  1GO3 F;  2HLD G;  3E22 B;  3E8F A;  4PJ0 Z;  1BP4 A;  2VQE B;  1R6K A;  2W6I G;  4GT1 A;  4PD4 F;  4CDD B;  5H6R A;  4BPV A;  5CB4 A;  5J2T B;  4DR2 O;  3ZED A;  1NLJ A;  2DJF B;  4IHJ B;  4O4I A;  5EF4 A;  3K59 A;  3JAS B;  4B3M O;  4FJC C;  1V54 B;  5HFM A;  4YJ2 B;  4DV3 O;  1GMG A;  4I7Z B;  3AK3 A;  1LUV A;  4P9P A;  4X6H A;  3R65 A;  2IBI A;  4ZOL A;  3SPG A;  2ITC C;  4UVB A;  1Q6I A;  4CDC B;  4NKG B;  2LFS A;  4I4T A;  2OZ2 A;  1P7B A;  1B04 A;  4OEL A;  3GWK C;  3JD2 A;  4UB8 Z;  2UXB B;  1FFX A;  2L6L A;  1DLB A;  2XND G;  3K08 A;  1FS0 G;  3ETE A;  1SQF A;  2B1I A;  3TXS A;  4N23 A;  5CBF A;  3MP2 A;  2WWW A;  4LH6 A;  1ZL8 B;  3JSN A;  4CS2 A;  3I5D A;  1IDS A;  4O2B B;  4O4L B;  4X6J A;  2Q0A A;  3ZS8 C;  1RM1 B;  4GKJ O;  2A0L A;  2F23 A;  3RBZ A;  1GN4 A;  3JD4 A;  1PBH A;  2K9P A;  4JGS A;  4CZW A;  2YXL A;  5L3B A;  1BSM A;  1X59 A;  3ASN C;  5TIS Z;  2RJZ A;  4TUY B;  1IWD A;  4CS4 A;  4YHH B;  5B1B B;  1S5H C;  2AHZ A;  4KHP B;  5H9C A;  4JAA A;  1P84 F;  3ZHV A;  1NR7 A;  4NB5 A;  1XL4 A;  3ABM C;  5LMU O;  4CC6 A;  1XUQ A;  2OIG A;  1XMO O;  4U3J A;  3HHA A;  3APQ A;  4LH7 A;  1TU6 A;  1F4M A;  1Z5V A;  4ZHQ B;  1SER A;  4REZ A;  2QWQ B;  3W7S A;  2XTA A;  3IHP A;  4JZ2 A;  2AYN A;  3W7X A;  4FFB B;  4WF9 V;  2OTL V;  4J7J A;  1F7Y A;  2A79 B;  2P4V A;  1HW7 A;  2QM4 A;  4RAI A;  1IXB A;  2BDZ A;  2CH7 A;  4DR6 B;  3W31 A;  1BE3 H;  2CGN A;  3BAB A;  3ZX6 A;  2IH3 C;  2HKO A;  3ZRW B;  1MA1 A;  5L3D A;  3CHX A;  1STF E;  4RKX A;  2AZ0 A;  1V54 C;  1VQ5 V;  4DV6 O;  4WBN B;  1FH0 A;  1FD9 A;  1Q81 W;  4WCE V;  5FPR A;  1PKX A;  4DW1 A;  2Q5Z A;  1ME3 A;  3U0Z A;  1M5I A;  1OV9 A;  1YTF B;  5KA6 A;  1VQ6 V;  3PN1 A;  3ERV A;  4ZUX U;  2DC8 A;  1TUB A;  2DQ0 A;  4I04 A;  3WXG A;  3G71 V;  2G38 A;  4TSF G;  5H6Q A;  5C8Y A;  4DUY O;  3DTU B;  3FYE B;  1KKC A;  1LR1 A;  2LJ2 A;  1JJ2 U;  4JI8 B;  2IJJ A;  1HWY A;  1M1K W;  2YUA A;  4MTO A;  5CA0 B;  2Y69 B;  1AI7 A;  2LGQ A;  1K4C C;  3VQW A;  1KMI Z;  2JGD A;  3BFR A;  1VQP V;  4IP3 A;  4R50 A;  1YAL A;  4EEQ A;  2Y5B A;  5KHI A;  4YV8 A;  2PI4 A;  1AJP A;  4P30 A;  1QBZ A;  3BOW A;  2CUG A;  1RM1 C;  4U7O A;  3MHH C;  3SPH A;  1CPJ A;  1AJN A;  1O9H A;  1IZ3 A;  1QR8 A;  2HJD A;  4MI7 A;  2X0L A;  1VQO V;  1CQD A;  3K9A A;  1S76 D;  1XNQ B;  2ZE5 A;  1THZ A;  3E1Z B;  1EM1 A;  3GB7 C;  2LGW A;  1ITO A;  3RN4 A;  4WUR A;  5B1B C;  1WPX A;  4JI7 B;  3CCV V;  2JS5 A;  1WP7 A;  4LP8 A;  5LHI A;  4H44 B;  3UKM A;  4D6T H;  2DC7 A;  4CH5 A;  3A0H Z;  1N34 B;  2WLL A;  4XBF A;  1I08 A;  2FL4 A;  4O4H B;  5CA1 A;  1QDQ A;  3SJA C;  1EN4 A;  3SPI A;  3IEJ A;  1QU7 A;  1H8H G;  3T1Y O;  1OHH G;  1X4T A;  2GHU A;  1SQV H;  1VQK V;  4HNA B;  1S0V A;  3T1H B;  3CE2 A;  2UZJ A;  5GW7 A;  4DMY A;  5IY5 B;  4DXW A;  4OX9 O;  1R1B A;  1QVG U;  4FVM A;  2PZS A;  4DV5 B;  3DC5 A;  4B7K A;  3HKB A;  3BC3 A;  3OMI B;  1NTK H;  2PRE A;  2DCA A;  3RYI B;  3ZMS A;  4TQF A;  4KP4 A;  2V1D A;  1YK8 A;  2AIM A;  1B06 A;  2Y0I A;  3OEE G;  2RQ6 A;  2LW7 A;  2E03 A;  5D5Q A;  3R66 A;  1Q6K A;  3D3I A;  2DCD A;  4WFE A;  3V6E A;  1TL9 A;  1YF2 A;  2E5L O;  4G27 B;  3LSQ A;  2DWD C;  2Y69 C;  2D2C B;  4TT3 G;  4YYR A;  1S5L Z;  1ROP A;  1CVZ A;  4DUZ B;  3CH3 X;  4JV5 B;  5EBL C;  2CGO A;  3AG1 B;  3G6B A;  2AZ2 A;  2BTO A;  2YJ2 A;  1GAX A;  4GX5 A;  1GM9 A;  1CTE A;  1WB7 A;  1NZ6 A;  3W7W A;  4YYW A;  3MHS C;  2F4V O;  5KAF Z;  3RFR A;  1EZJ A;  3DXR A;  4B3S B;  5EYP B;  1EN5 A;  2YIB A;  4R7C A;  2UU9 B;  3B40 A;  2FTK A;  4I05 A;  3H1K H;  5LGN A;  1XI1 A;  5IYD O;  4WFG A;  2ZE6 A;  1NR1 A;  3CCU V;  3H6S A;  3HWN A;  2P67 A;  3T4D A;  1DEU A;  4J80 A;  4PA4 A;  2AGA A;  3BA8 A;  2IBZ H;  5L3F A;  3L71 H;  4NXN B;  3OTO O;  1K34 A;  3HKC B;  4HYO A;  2WSS G;  3KSE A;  3A0R A;  2EX3 A;  2CE4 A;  5B66 Z;  1TVK B;  5IJ9 A;  4K8X A;  4I0X B;  1N0N A;  1WLE A;  5LA6 B;  1FKA O;  2ZE7 A;  3MOR A;  3PJS K;  3IFU A;  1HNZ O;  4DR2 B;  4LWS B;  1U9X A;  3TET A;  3MD0 A;  1FJG B;  2WA4 A;  5IY5 C;  2AUZ A;  1Y74 B;  2DYR B;  2JGU A;  3LSU A;  3RW0 A;  1VF7 A;  3DSQ A;  3WU2 Z;  5J2U B;  4B3M B;  4X1I A;  2XAJ A;  1VF6 A;  6PAD A;  4MW8 A;  1Q86 W;  4DV3 B;  2QEX V;  3IOQ A;  1IUR A;  2JDI G;  4D7T A;  1I7F A;  2M6Y A;  4QRX A;  2R70 A;  4QBB A;  2ZIO A;  1S72 V;  3JAW A;  5F2V O;  3UO3 A;  3H1I H;  2Y6E A;  1PNL A;  3CCQ V;  3KKU A;  5IYC O;  4EB6 B;  2OT5 A;  2DC6 A;  3P5X A;  1XDC A;  2B1N A;  2NLJ C;  1RPR A;  1KEC A;  3HD3 A;  3F75 A;  3HKE B;  3FB7 C;  1NVP D;  4OEM A;  1R6N A;  2GBO A;  1Y4H A;  3K58 A;  4F4L A;  3AG1 C;  4YYU A;  2EIJ B;  3L70 H;  5JJN B;  3H1L H;  3KWZ A;  5BR8 O;  4GKJ B;  2X7R B;  1MSD A;  4O4J B;  3ABU A;  4CH6 A;  1Q90 D;  2KG7 A;  1PD3 A;  1M57 B;  3UM7 A;  3CXC U;  3SYC A;  5CN0 A;  4JI1 B;  3FX7 A;  3CWB H;  4JAV A;  3WFV A;  3CEI A;  5EBM C;  2UXD O;  3HKD B;  3OGI B;  3UT5 B;  4MVO A;  1KQS U;  1LUW A;  2BU3 A;  2HJF C;  2QTS A;  1V55 B;  4OGQ B;  5LMU B;  4D8E A;  5EIB C;  2RMK B;  1IBL O;  4LF6 O;  2AU1 A;  1XMO B;  4FIP A;  3CCJ V;  2FB5 A;  2M7W A;  1AU2 A;  4WA6 A;  4ZI7 B;  1MZF A;  3RT3 C;  4A5U A;  1JOY A;  3D36 A;  4HZ3 A;  5JQG B;  2UUA O;  2XHB A;  2OWO A;  8PCH A;  1JX9 A;  2WLK A;  3RYH B;  3EFF K;  1N36 O;  1WA8 A;  4UCR A;  2DYR C;  3W7T A;  3BCN A;  1N32 O;  4P2Z A;  1H2M A;  3E8G A;  1ZTE A;  2P7T C;  3S3R A;  3CRR A;  4DR1 O;  2ZM6 O;  4DV4 B;  4FM0 A;  3QO7 A;  4DV6 B;  1KP2 A;  3HB3 B;  1VQ8 V;  2E75 B;  4LFB B;  2VS0 A;  3T4Z A;  4F6R A;  1EWL A;  2A06 H;  4GX1 A;  4PP2 E;  3BVO A;  4FM1 A;  5IWA B;  2BTQ A;  4DUY B;  4QNH B;  1H2G A;  4MS2 A;  2EZP A;  4MW3 A;  1PM9 A;  1QLN A;  1SKV A;  3ABL B;  2ADQ B;  2V7Q G;  5KHH A;  3JYC A;  3H8B A;  3P3P A;  1A32 A;  4BOQ A;  4X1K A;  3MTV A;  3DF0 A;  3CRC A;  1K92 A;  1QCE A;  4XDL A;  1K3E A;  3B8M A;  4O2A A;  3L73 H;  2EIJ C;  5EZS A;  3FAV B;  4AXL A;  2GDS A;  4X62 O;  1YIJ V;  3SYA A;  4ZIB A;  2ARH A;  5DM6 V;  5KLV H;  4DRX A;  4TOI A;  3SYQ A;  3ASO B;  1F2C A;  1N8R W;  3VQX A;  4ZTB A;  1QR9 A;  1GN3 A;  1M57 C;  1GM7 A;  1WP8 A;  4FZ1 A;  2FE8 A;  1AI4 A;  3QO5 A;  3C0R A;  1AI6 A;  3ML0 A;  1M56 B;  4R8C A;  3T2M A;  1V55 C;  3BY6 A;  3E22 A;  3N4C A;  1MHW A;  4P9O A;  1BMF G;  1TA8 A;  2XAS A;  4LF4 B;  1PV0 A;  1ME4 A;  2Q6A A;  1JCH A;  3G67 A;  4AIL C;  3PNR A;  2P06 A;  1NL6 A;  5KMG B;  5JA7 A;  3OE7 G;  4UVC A;  4LR3 A;  2HVJ C;  3ZN1 A;  3T1Y B;  4RF1 A;  4JTD B;  1URF A;  5FNV A;  1XIL A;  3AG2 B;  2XAH A;  2UUB B;  1YXB A;  5F02 A;  2L35 A;  1DKI A;  3H01 A;  5E79 Z;  5LYJ B;  1WNS A;  4OX9 B;  1SES A;  3K5O A;  4RQF A;  1RPO A;  2QWP B;  1GLO A;  3B4S A;  4IGG A;  3JAL B;  1JVM A;  2YDE A;  5JCO A;  3C3T A;  3EXA A;  4X64 O;  3ABK B;  3OIS A;  5LP6 A;  4X65 O;  1AI5 A;  3QO8 A;  1ZIV A;  3JCZ A;  1JFF B;  3ABL C;  2HXZ A;  4QRG A;  4PT5 A;  2F43 G;  4DYL A;  2E5L B;  1AEC A;  1E1Q G;  1RSO A;  3KKY A;  4ASU G;  3B79 A;  1SZT A;  3J7A U;  4BW9 A;  1G8M A;  3RVV A;  1RP3 B;  3SJQ C;  3J81 N;  2ARY A;  2H94 A;  4BIZ A;  1U9W A;  3ASO C;  4H13 B;  1JJO A;  2F4V B;  4JYA O;  5JVD A;  4DR5 O;  3N3G A;  1VAR A;  1SZX A;  2UXN A;  2QDO A;  1NTM H;  1PCI A;  5DN6 G;  1HNW O; 
#chains in the Genus database with same CATH homology
 3ZNH A;  3E9S A;  4IUM A;  3SDL A;  5BR8 O;  1IBK O;  3J80 N;  3BY4 A;  2FE8 A;  2UUC O;  3O65 A;  1XEQ A;  4XZX A;  4RF0 A;  3PRP A;  5IT9 N;  4OVZ B;  4NXM O;  3C0R A;  5EZQ A;  5LL6 Y;  4MM3 B;  4DV1 O;  2ZKO A;  4JI1 O;  4IP3 A;  5LMN O;  4R3D A;  4HXD B;  4GUA A;  4JI6 O;  4DR4 O;  4YY3 O;  1N33 O;  4B3T O;  2HHH O;  4LF9 O;  2F4V O;  4K0K O;  4D8I A;  1AIL A;  1HR0 O;  2UXD O;  2Z0A A;  1J5E O;  2UXC O;  4OW0 A;  4AQY O;  3MP2 A;  4LF4 O;  1KUQ A;  4DV2 O;  2BTW B;  2BU3 A;  2Z84 A;  4JI8 O;  4D8E A;  4MI7 A;  4DUZ O;  4DR3 O;  1IBL O;  5BY1 A;  4LF6 O;  4JV5 O;  4JI2 O;  4GKJ O;  2DJV A;  4RF1 A;  4BOP A;  3F5T A;  2VQF O;  2UUB O;  1I94 O;  1G1X B;  4WUR A;  1IBM O;  3TMP A;  4BOU A;  4BOS A;  4LF8 O;  2AGA A;  1PVJ A;  2HWK A;  2JTC A;  2UXB O;  3RT3 C;  4A5U A;  1X59 A;  4X66 O;  1DKI A;  3RNV A;  1YZB A;  3PHW A;  1HNX O;  3OTO O;  2UUA O;  1R6T A;  4DR7 O;  5KO3 A;  3JAM N;  5FLX N;  4B3S O;  3PRM A;  4RNA A;  3PHU A;  2UU9 O;  1N36 O;  5JZE A;  3BB7 A;  3PSE A;  1D2D A;  5H5N A;  1UKF A;  3PT2 A;  5LMU O;  1FKA O;  1N32 O;  3IFU A;  1HNZ O;  1XMO O;  3T1Y O;  1XNQ O;  1FJG O;  3MJ5 A;  4JI4 O;  4X64 O;  4DV4 O;  4D8B A;  4OVZ A;  4DR1 O;  2ZM6 O;  4LFC O;  5A2Q N;  2DOS A;  4REZ A;  3B21 A;  4X65 O;  4LFB O;  4DV0 O;  4A5U B;  4JI7 O;  2UZJ A;  4NXN O;  1AB3 A;  4LF5 O;  4GKK O;  4LFA O;  4OX9 O;  3BBA A;  4BOZ A;  1R1B A;  5IWA O;  4LF7 O;  4JI5 O;  4PT5 A;  4YHH O;  2FKX A;  1F7Y A;  3OQC A;  1N34 O;  4KHP O;  2J7Q A;  1DK1 A;  1XNR O;  3W31 A;  4B3R O;  5E6J A;  4P16 A;  1A32 A;  3J7A U;  4BOQ A;  4DR2 O;  2N74 A;  3MTV A;  4RKX A;  3TRK A;  3J81 N;  4DV6 O;  2LW7 A;  4M0W A;  3T1H O;  2JRI A;  3R66 A;  4DV7 O;  3W30 A;  1NS1 A;  4B3M O;  2J7Q C;  5EZS A;  4JYA O;  5BXZ A;  4OPH A;  4X62 O;  4DR5 O;  4DUY O;  4DV3 O;  4JI3 O;  3M8A A;  1FYJ A;  4JI0 O;  2E5L O;  4DV5 O;  1XMQ O;  2VQE O;  2BTW A;  4OPA A;  4ZTB A;  4DR6 O;  1HNW O;  3PHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...