1YZBA

Solution structure of the josephin domain of ataxin-3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Machado-Joseph disease protein 1
publication title The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1yzbA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1yzbA01
1A32A 4DUZO 4X62O 4B3SO 4JI0O 4LF7O 4B3TO 4LF9O 2ZKOA 1DK1A 2UUBO 4X64O 3M8AA 4DV2O 2VQFO 2UUAO 3J81N 4DV6O 1HNZO 3J7AU 5BR8O 1XMQO 4JI4O 4YHHO 1XNQO 2UU9O 2DOSA 1N34O 5LMUO 4LFCO 1AB3A 2AGAA 3R66A 4DR1O 4LFAO 1AILA 1N33O 4JI8O 4JI3O 4JI1O 4A5UB 5IWAO 4OPHA 4LF6O 4LF4O 2HHHO 1R6TA 5A2QN 3T1HO 1IBMO 4NXNO 1R1BA 5H5NA 4OPAA 1IBLO 4LF8O 4JI2O 2F4VO 1IBKO 1XNRO 4DV4O 3SDLA 4AQYO 1X59A 4YY3O 4GKJO 5BXZA 3O65A 4B3RO 2DJVA 4X65O 1N36O 2VQEO 1KUQA 4DV5O 1XMOO 1FKAO 2JRIA 4DV7O 2UXCO 1FJGO 1F7YA 2E5LO 2UXDO 4B3MO 5IT9N 3OTOO 4LFBO 2FKXA 1I94O 2UUCO 4LF5O 4DR4O 4DR7O 1FYJA 4OX9O 4KHPO 3RT3C 4JI5O 4JYAO 4DR6O 1XEQA 4DV1O 5FLXN 4NXMO 3JAMN 2LW7A 2UXBO 5LL6Y 2Z0AA 4DV3O 4DUYO 2N74A 4JI6O 1NS1A 1D2DA 5LMNO 3F5TA 4DR5O 4K0KO 1YZBA 4DR3O 4JV5O 3T1YO 5BY1A 1HNXO 1G1XB 1HNWO 4DR2O 2ZM6O 4JI7O 1J5EO 3J80N 1HR0O 1N32O 4GKKO 4X66O 4DV0O
chains in the Genus database with same CATH superfamily
2HVKC 4YYWA 2E01A 4FM2A 2PI5A 4PV1B 2BOBC 3CJHA 5EIBD 1ZCMA 2E3CA 5J2TA 2R9OA 3E8HA 3IMAA 3BAAA 8PCHA 3CP1A 2HVJC 2AHYA 4XDLA 1VQNV 4GUNA 1KBHA 1Y74A 2HR3A 2R9MA 1AU0A 5LHIA 1A6RA 3DC5A 1SA0B 1MNGA 5IY5C 5EC1C 3E35A 1N33O 3PW3A 2YXHA 5KA5A 3A0BZ 2Z3YA 3K8UA 5FPWA 1WPXA 1PNLA 1D5NA 2J7QC 2IPPB 4LF8O 3PN1A 3SYOA 5JJEB 4KP4A 4D6TH 2PI4A 2L35A 5E79Z 1NR7A 2YI9A 1N36B 5FNVA 2WWWA 1WA8B 2EZPA 3ZHSA 3JAKB 4B3RO 1F51A 3AG4C 3K0GA 2LO1A 1PE6A 5FL7G 3S3WA 4I7ZB 1PBHA 2PADA 3LSUA 2UXDO 5LMNB 3K59A 1FFTB 4JASA 5IYZA 1B6QA 2IJKA 4XR7A 2FKXA 4DR7O 2IM9A 4W4UA 3SJBC 2UUAB 3OF9A 4FVMA 3CS5A 5DM6V 4MVSA 1S72V 3GWOA 4PJ0Z 1F29A 4J7JA 1IVSA 1OV9A 3UO2A 4JV5B 4QBBA 2CTQA 1EN6A 5EIBC 3ASOC 2AW9A 1N32B 4UVBA 1GTOA 3AK1A 1AJNA 1MG1A 4BOUA 3K08A 4PDVA 3J80N 3CH2X 4DR1B 4B3TB 2P4VA 2IH3C 4BOZA 2M7WA 3BVOA 4L8JA 4JI0O 3O1GA 3SJCC 4F6RB 4BS6A 3K5NA 4GX5A 2VQFB 2A7WA 4O4LA 3FB6C 4Q8GA 2N05A 4LH6A 1GN3A 1PXVA 2FYUH 3H9VA 4JI2B 4MZOA 1IBKB 5TISZ 1XNRB 4JPRA 3EHBB 4N4ZA 4FFKA 1AYUA 5KHJA 1FFXA 2DJFB 1QVFU 4U7OA 5L3BA 2DQ3A 4RF0A 1EWOA 2EX3A 1YCIA 2AIMA 1KD1W 3LUTB 3RVYA 2RNBA 2ZT9B 5AG2A 4UCTA 3ETEA 1IZ3A 3TXQA 1POPA 5JVDB 4NXMB 3CCQV 2DJGB 4PD4F 3EVKA 4Z1VA 1SA0A 1BGYH 2QGNA 1ZSPA 2BTQB 1BL8A 2OWOA 1PNMA 5BXZA 1SZXA 1Q6UA 5CHTA 2JJ2G 3A2FA 2E5LB 5IYBO 4PP1A 1WJZA 1DKIA 2IBZH 2OP3A 2DMXA 1YIJV 1GECE 3B8MA 2YDEA 5CBGA 4LF9B 1DEUA 4Q8HA 3X2QC 1WA8A 2UXNA 2ZE5A 3JAKA 2FT2A 3H1JH 5H2FZ 4DR6O 1XKGA 2G6DA 1PKXA 4X88A 2FRQA 2YJ2A 4XUIA 4DR5B 3T2MA 1Q90D 3C3TA 3MHHC 4X1KB 3CBJA 5L3FA 3D3IA 4QE9A 3CCSV 2F7DA 3W7XA 3W31A 2Q69A 1JQ0A 5EZQA 3ABMC 4LF7B 4YIPA 3RYIB 4X62O 4IIJB 1CTEA 3OISA 1O0EA 2ZE6A 4JGSA 3CXCU 1F2AA 1KU9A 1S77D 4MM3B 3PBHA 1ENVA 3ABTA 4DV6O 2WLLB 1PL4A 4PA9A 3BRCA 4WFHA 2WLHA 3P5XA 1E1RG 1XNQO 4CS3A 3IC9A 4NTXA 2JS5A 4B08A 4F6RA 1YTFD 4LFAB 1WPBA 2EULA 3ERVA 5FPOA 4H0LB 3VQWA 1QDQA 2OIGA 3HD3A 4JI8O 2CH7A 3W7UA 3UM7A 3LNNA 1SQQH 1AI5A 1IX9A 4HZ3A 1I94B 4X8AA 1U9QX 2DC9A 3G6EV 3L74H 4AQYB 2DYSC 2JVDA 1PPOA 4AHCA 4WFAV 1M9NA 1OCZB 4FLYA 2ITDC 5JZEA 4TT3G 1KFXL 4X65O 1VF7A 4HNAA 3JD0A 3QT4A 1R73A 1NQTA 2AHZA 2OCCC 3JALA 3ZHQA 5L3CA 3NHEA 2UXXA 3ABKB 5JVDA 3VQYA 1H8EG 1KHPA 1I5XA 5E1AC 5IT9N 3QNEA 2BTQA 2B1NA 1EFRG 1E79G 4UFZA 1U9XA 4X1IB 5JCOC 4GZRB 3SPJA 2GHYA 2OTJV 4GX1A 3CCEV 3BPMA 3H89A 4TWKA 3RWRD 2X6AA 1SRYA 4I50B 1GMGA 1V55C 1NQCA 5KX5B 4K0KO 4O2BB 2EIMB 3U8EA 2GUZB 4WFGA 1G1XB 1HNWO 4N79A 2H8PC 3RGBA 3JD2A 3VQXA 4JI3B 1M5IA 4HYOA 1A32A 1GRJA 1H2KA 1SQVH 5KHGA 1CPYA 4FK5A 4X1KA 1P7BA 2UUBO 3F7YC 3K9MA 1PPDA 4O4IB 5B66Z 4QRXA 5B3SB 4ZI7B 5LMUB 1KYOF 5KHIA 1Q6HA 4IIJA 4R50A 4LH7A 5EZSA 5LOVB 5EC2C 1AB3A 1FXKB 4CH5A 5KMGB 2WLLA 2ZE7A 1YJNV 4LF6O 1SF9A 3LNMB 1XBLA 4FJCA 1TAEA 3CYOA 2KB1A 2RDCA 2JEUA 2G38A 2Y48A 1THZA 3OEHG 3RNVA 4RQFA 4DV1B 2XAFA 5B1AB 3LSSA 3VQVA 1QLNA 5LP6B 1M57B 4KLBA 4RQEA 4DRXB 2NLJC 4I4TB 3DXRB 1ME4A 1KP3A 2P22C 3DGEA 1XHXA 1TUBB 2VQEO 2V1DA 4FLWA 2YIAA 1FKAO 3OUSA 2YXYA 1MZEA 1ZWIC 3ABUA 5GTHZ 4CC6A 1H2NA 1RM1C 1L8DA 2WLJA 3K06A 1OCRB 5B1BB 4LFBO 1GM8A 4RUEA 4MW8A 1FYJA 2NQDB 1SQFA 2ZD9A 2QA4V 3T4DA 5JQGB 4FLTA 1TUEB 5LL6Y 4WBNB 3F5WC 4EB6B 4LR3A 3WG7B 4JI6O 1SP4B 3CSXA 1VQPV 5EBWC 4YJ2B 2F66C 1YK7A 1CV8A 3K9SA 4DV0B 4X1IA 2HP8A 2IJIA 4G54A 4YYUA 1Q5OA 2OYQA 1KXRA 1VQLV 1N33B 1QQCA 2QWRB 2Y4TA 1PP9H 4DUZO 4ZTBA 5L3GA 1BQIA 4O4JB 2CDYA 5HFLA 4I50A 3OGCC 3CRRA 1XDCA 2ZKOA 3BA8A 1Y76B 5JJNB 2PZSA 2X6BA 2GTAA 4BOSA 2Z5UA 1B3QA 1ZUQA 1B06A 1K8AW 3ZBHA 1QNMA 3RYFA 4KUMA 3ZS8C 4JI4O 2FTDA 3OD4A 2UU9O 2CTRA 2R9AA 3CBKA 3N3KA 1L0NH 2XAGA 4JYYA 1MSWD 1AJQA 4B3RB 4LFCO 3FKSG 3O0UA 1NJIW 1AR4A 1CQDA 4CDEB 1SERA 3R66A 2Y0IA 3THOA 4JI1O 4NXNB 1ITOA 4ZI7A 4OPHA 2UXDB 1BZKA 3Q4HB 1JR9A 2EILB 3T1HO 1I5YA 1SZTA 3OMIB 4I0XB 4CH3A 4JTAB 4RKXA 4PI0A 1DTOA 3DTUB 1CP9A 1FXHA 5LOVA 1YJWV 3BEHA 5JWPA 1FXKA 4I9QA 2QTSA 5FPRA 3H1LH 5KMGA 4YY3O 2CK3G 3RVXA 3O65A 1I0HA 2EIJB 3QSDA 1DF5A 3P5UA 1XMOB 1SESA 4TSFG 2BDLA 3E8GA 4RUFA 3OTOB 4BIOA 4J7KA 2XUMA 4O2AB 1BHAA 1N0NA 4DK1A 4B3MO 3ZIAG 5LP6A 1AP5A 1VF6A 4LNUB 2HLDG 4BW5A 4DRXA 4NTYA 4LF5O 2UXBB 1QR9A 3FFQA 3DXRA 4I4TA 3DF0A 4DUYB 1TGOA 3BA9A 4TUYB 1L1FA 3W7TA 1TUBA 3AEIA 4DV3O 3HKBB 2Q8VA 1TL9A 4EFBA 1HNXB 4KXRA 1WP7A 3IC7A 4KFMA 1BT8A 2QKSA 1M4UA 5IY5B 4DR3O 2QM4A 3T1YO 3IHPA 4FLUA 4X1YB 4DR2O 4PI2A 1HR0O 2ARHA 1ORQC 2LP7A 4GKKO 3E9SA 1SQXH 5H9CA 5JQGA 4X64B 1V54C 5CB4B 4WBNA 3OMNB 4EB6A 1NVPD 3AG7A 1YSCA 3OQCA 1SQPH 3D36C 4QIWF 2PYLA 2XU5A 2X6CA 3P32A 2AUXA 4YJ2A 3ZUAA 5J2UA 2XHBA 2ACTA 3BCCH 5BR8O 2M6YA 3AG4B 3TK1A 3U0ZA 1FAFA 4HBNA 2JTCA 4UVAA 2DW4A 4O4JA 3OUFA 4WFFA 1W59A 1L0LH 3N2KB 1Y76A 3CX5F 1DF0A 2Q7GA 2XAJA 1FFXB 3AG1C 1AILA 2KSDA 4CC5A 1P4RA 5IWAO 2YSUB 3GWKC 1K5QA 5KUKA 2AU1A 3KSEA 1PL0A 5H5NA 2JGDB 2XU1A 2F4VO 2AYNA 1FH0A 4MSXA 3B8NA 4GKJB 5J9PC 4W4KA 4DV4O 4TQDA 3ASOB 2AYOA 4IT5A 1KKCA 3RYHA 2DJVA 1V9PA 3L72H 2ZXWC 2V4DA 3Q4HA 4RWUA 3NR7A 2G7YA 5K1XA 1X9YA 1XOUA 4I0XA 3P3PA 1ICFA 1URFA 1R6KA 1RFYA 4FM1A 4OX9B 3JD4A 3A0HZ 4W5CA 2RMKB 1RSOB 3FB7C 1K3EA 4I05A 3W7SA 3RT3C 4YV8A 1F2CA 2G8EA 4BSQA 2WSSG 4CDFB 2BTOA 2R70A 4MTGA 3K5MA 4O2AA 3ABLC 2GTSA 4FIPC 4Z1MG 4RO2A 4AILC 3F5VA 2QWQB 4LNUA 3HB3B 3IOQA 4JI7O 3CB2A 4UUJC 4TUYA 2VHSA 4JI8B 1TLOA 3CCVV 4L87A 2DCCA 3VBBA 3HKBA 2WBFX 4YYSA 2W6JG 2O57A 2RN9A 1HNZB 4TOIA 4ZBMA 4TV8B 4UV9A 2CIOA 5H6RA 1XMQB 4E4EA 1LNQA 4X1YA 2A3QA 2WLNA 1ZLZA 4TQFA 2WLKA 1BY8A 1JQPA 3PHWA 2J7QA 4UB8Z 2CTWA 5CB4A 2HJFC 2WLIB 1Y67A 4GX0A 3MORA 2ATOA 2HHHB 3CRAA 1GN6A 2EINC 1MZFA 3X2QB 3ZEDA 4LF4O 1OHHG 4LBEC 5EBLC 2GBOA 3I5DA 3LXSA 2FYEA 4F6EA 2CH7B 1ZL8B 3S3RA 3M7MX 2R72A 2DWDC 4H13B 4CZWA 3H8BA 4N21A 3N2KA 4PDMA 1NKDA 3IFXA 1EWMA 1THEA 5CA3A 2GDSA 5A9GA 5KAIZ 3KWBX 1JFFB 3ABMB 1WB8A 3CMAV 4K0KB 4DV7B 3QG5A 1R3LC 1AROP 1MABG 2JGDA 3MAQA 1NBMG 4HNAB 2UXCO 2YC0A 1H2GA 1SETA 4Z2WA 1NT2B 3JALB 4BS5A 4GT1A 1VQ7V 2P5OA 4QRVA 1K7DA 2LFSA 5CA1B 5IYDO 3BFRA 5BMVB 1ZX3A 1YXBA 2XNDG 2NQGA 1H38A 2CTPA 3JARB 2WPDG 2IJJA 2DC6A 2ZR3A 1NS1A 2GSMB 1D2DA 1Q8IA 1RSOA 2WA3A 3CMEV 2GFOA 4ZOLB 1LUVA 3FYEB 3DC6A 1J5EO 3K03A 3LDCA 3ZMZA 1LR1A 1EBOA 1Q6IA 4TV9B 2P4KA 1IWDA 3E2EA 2ZR2A 3M8AA 4J11A 4DV2O 3GCBA 4E2LA 1OCOB 3FAVB 5DEDA 1U9VA 3G80A 2WLMA 3RBZA 2WAMA 2AZ2A 3JCZA 1AECA 2P7TC 1U5IA 2ZQMA 5LYJA 3K9AA 2QM7A 1M56C 2OCCB 2VWKA 2XU4A 2B1IA 4XDJA 3SGIA 2IH1C 1TU6A 3BB7A 1QBZA 4TV8A 5IJ9B 3IEJA 2HXZA 3MP2A 1Q7YW 2HFEC 4U3JB 1M1KW 4BR6A 1PV0A 3CCUV 1OZ0A 2PGGA 2WLIA 1V55B 2Y0PA 2DN9A 4XBFA 2XAHA 1K4CC 5KUMA 1HWYA 5LXTA 4EEQA 4JI6B 1UFIA 1AP6A 4YJ3B 3G67A 1F4MA 1N36O 2QDOA 3SPHA 4JYBA 1F23A 2YIBD 1FJGB 2MW2B 1YTFB 1OCCC 1ZL8A 4CBCA 1Q81W 2FUDA 2ZDIC 1EWPA 4GUAA 4QRGA 3JSLA 3MHHA 4JAUA 5IE9A 3ASNC 5GW7A 1VQ8V 2NNUA 2XAQA 4KHPO 1JFFA 2NR5A 2Q0AA 2BSKB 2ZCEA 2R9NA 2JDIG 1JJ2U 5CVOB 3N2GB 1SKVA 2CGOA 3HPLC 3QVNA 1P84F 3MD0A 4PADA 3CC4V 1AR5A 4JV5O 1MMMA 3F7VC 4H33A 4X66B 4YYVA 1QCEA 5CA1A 3OW2U 3UO3A 1Q86W 5BMVA 2YS8A 4RNAA 1N32O 3SPIA 3CC2V 3CH3X 3D8CA 1Y4HA 3KG2A 5EK0A 3JARA 4B3TO 2EIKC 4WCEV 3APQA 1S5JA 2VQFO 3ZNHA 3E86A 4ZOLA 3CEIA 4NTWA 1NTKH 1N34B 3TRKA 1R3KC 3TJTA 2P90A 2DZZA 2KKWA 3HKCB 2K9PA 2MK3A 3L9DA 4TV9A 3RYFB 2RCVA 1Q3EA 1N4CA 3STLC 4W5BA 4PT5A 3JD3A 3FAVA 1RM1B 1IURA 3HHIA 5JA7A 2F43G 4QE7A 5F2VO 1H8HG 5DN6G 4JYCA 1QLEC 1AI6A 7PCKA 3ZRSA 4UCOA 3STZC 3IAYA 1XL6A 2FO5A 1R1BA 3ETGA 1DF4A 3T1CA 3I3TA 2Q73A 1PIPA 2EJ7A 4BAYA 4X6IA 2CGNA 1WAZA 1R3JC 3BPFA 2XOKG 2ETNA 5IJ9A 4DV3B 3PSEA 2QWPB 1QOLA 1GK9A 4D7SA 2AS8A 2Y6EA 3RVWA 1B04A 3ZMUA 3A0RA 5JCOA 4U3JA 4BPVA 1Z5VA 1I7FA 2FQ9A 4DR3B 2ATKC 2CAZC 4ZIBA 4DV5O 4IP3A 4QH6A 3ZHVA 3K58A 4GKKB 1AVMA 1N8RW 2E5LO 4DR4B 3AI8A 2LGWA 1XUQA 4JI5B 4JYAB 1AU2A 4P2ZA 4K8XA 4YJ3A 2AVWA 1BP4A 2OCHA 5FLXN 1EF7A 2LW7A 1PVJA 2FTKA 3CCMV 1QMYA 4XDKA 2Z0AA 5CA0B 3H1KH 1MIRA 4YYRA 4MVRA 3I55V 3RVVA 3PRPA 3PT2A 4DR5O 2JK5C 2HD5A 4X6JA 4AXLA 4PA6A 3WXEA 2YIDA 5BY1A 1J95A 2Y4UA 2ZNJA 4BOPA 4D8EA 5K16A 3OEEG 1VF5B 2F23A 2BSKA 4MVOA 4UCRA 1SS3A 1I08A 5GONA 2ADPA 3N2GA 1NH2D 2VS0A 4B3SO 4B7KA 5IWAB 3RVZA 2K1EA 4LP8A 4LF7O 2JJ1G 3MDSA 1XL4A 1DK1A 4QNHB 4DO2A 4WFEA 3SPGA 3WB1A 3MTVA 4DW0A 3H1HH 1AYVA 3MHSC 3ZJZA 4MW3A 3KX1A 2G8JA 1TVKB 3P30A 2A06H 4MS2A 2P67A 4YYQA 2DC8A 1FD9A 4IL6Z 4PHZA 5J2UB 2HH5A 4G28B 3PJSK 5EGWA 5CMUA 2RQ6A 5B1OA 5JH3A 3PNRA 4G2KA 4YVAA 2NQIA 2E03A 4LFAO 3ZHUA 1K4DC 2OULA 4MVMA 2XTAA 2Q6AA 4FLVA 3QO7A 1BHBA 3ZMTA 4LF8B 3ZN0A 3SYAA 5A2QN 2E74B 2FE8A 4P6EA 3WXFA 1YDXA 3HKCA 2QJ1A 3RN4A 4K7CA 3KCYA 1COWG 3SJAC 1PCIA 1GAXA 2YJCA 1AYWA 4FMTA 1CS8A 2BOCC 4UVCA 4AQYO 3BWKA 1P7GA 2H94A 2P86A 4WFBV 1VQ5V 4WF9V 1GLOA 4RF1A 1D5AA 2AUZA 3BABA 3ZMVA 3RYHB 3M99B 1V54B 4JI7B 3DSQA 4NR1A 3CCRV 4DR7B 4CDCB 4MVQA 1AI7A 3GVMA 4JZ2A 1IDSA 1XEQA 2B1GA 1VEWA 2PY5A 1VMGA 3CHXA 3B4SA 1CSBB 4FLXA 4K3AA 3TMPA 2HJDA 1VQ9V 4D7TA 1YITV 3UCSC 2N74A 3V6EA 1Z2GA 3WXGA 1VQ4V 1YZBA 3AG1B 3ZRXA 1XQ8A 3USVA 2DYRC 4JI0B 3OTFA 1DLBA 2ZM6O 2GHUA 4R3DA 4K35A 5H6QA 5L3EA 5CA0A 4BOQA 1BSMA 3AG3C 1QU7A 2JQGR 1K5SA 4YIOA 2AZ0A 3S3XA 1VQOV 4WURA 1Y6XA 1H2SB 4HXDB 2Q5ZA 3OVZA 4I5SA 5HFMA 4F4LA 1F4NA 4YHHO 2ZXWB 6PADA 5LMUO 3WB0A 4UCVA 3HWNA 4JF3A 1ME3A 4UCUA 3G4SV 4IHJB 3E1ZB 3H8CA 1KB9F 1VQMV 2UXCB 1TVKA 2QTOA 3U11A 3TNXA 4OEMA 1NTMH 3PHXA 4MT8A 3L71H 2CUGA 1YT7A 3F75A 3I06A 1WNSA 1NVPB 2HG5C 1S76D 3FB5C 3KCXA 3SR2C 1Y08A 1X59A 4J10A 5LGNA 1O9HA 5A24A 2GV9A 1HUCB 1M93A 3B2EE 4I9WA 5D5QA 1M6DA 2HKOA 4DXWA 4X6HA 2B5UA 2ODMA 3AG2C 3G71V 4DR6B 4J80A 1G6UA 4U3FH 2UUCO 4BQVA 4GX2A 2E02A 4DV2B 2P06A 2PNSA 4P30A 4UV8A 3JATB 1U96A 2DC7A 3M99A 2F95B 3OGIB 3K24A 1XILA 4ASUG 4FPPA 1H2MA 1QVGU 1S0VA 1VSNA 1IXMA 2IU3A 3L70H 2YI8A 3D36A 4QGPA 1S3JA 3HHAA 4LCUC 3KZIZ 4X62B 2EINB 3ETQA 4MTFA 4PA3A 4BW9A 1U9WA 4PDLA 4P9PA 1PADA 2ADQB 4DV0O 1LUWA 1SNKA 2XASA 4I04A 3VOUA 1GKFA 3LSQA 4DV6B 4JAVA 4N8WA 2Y69C 2Q0OC 3IFUA 5ITZB 1XNQB 2X7RB 4EKWA 3CD6V 1PPPA 1XHZA 2XU3A 4DYLA 5L3DA 3BC3A 2DOSA 3ICXA 1BQ0A 5EF4A 3E8FA 5LYJB 3IUTA 1KKDA 4PA7A 3K5LA 1YJ9V 3CCLV 2EBOA 3C90A 1KECA 2RJZA 2PYJA 3KWZA 2LGQA 1KC8W 3OVXA 2BE3A 3APOA 1IBMO 4NXNO 4BIUA 5CHVA 1IBLO 4ZKIA 4KHPB 3OR7C 1G8MA 2OZ2A 4MTXA 3CC7V 1MA1A 2BDZA 1EZJA 1NTZH 3KW9A 3SYQA 3C3SA 3ZX6A 4X65B 4IHJA 2N04A 3QF7A 4W4LA 5EZYB 1U97A 2NN4A 4NYKA 3ZN1A 3BY6A 1CB5A 4R7CA 5LXTB 1KUQA 1HP8A 5DECA 3KKUA 4J42A 2W6IG 2JRIA 1XMOO 4HWYA 3TGUH 4AXMA 4H37A 4MTOA 3ML0A 4KL1A 4FIPA 3OTOO 2QKAA 3AK2A 3P5WA 2P0RA 1UPGA 2ITCC 1F2BA 5CVNB 4XZXA 2UZJA 1K34A 2UXBO 1YK8A 2QSAA 4DUYO 2C0YA 2H7JA 4J9YB 4DMYA 1M56B 1HNWB 5BZBA 4IUMA 3BHPA 5IDJA 3B21A 1Y4MA 9PAPA 1GN4A 1K3BB 3K0DA 1HNXO 2E00A 3N4CA 4CZZA 4R6ZA 3E83A 1GMYA 3OM3B 3SJQC 3ZRWB 2F1GA 3QO8A 3JATA 3K04A 1AR1B 1N0JA 5KA6A 3QTCA 4G27B 2UUBB 4QJFB 4M0WA 3W7WA 4MVZA 2NQAA 5B5EZ 2Y5BA 4X64O 2C2AA 1DGSA 4NVPA 5LHGA 4P6GA 1PM9A 3IGAC 1GH6A 2EJRA 1PPJH 4OELA 4GLXA 2ARYA 1OCCB 2Q67A 3TXSA 4PI3A 2KG7B 3FB8C 3HKDB 4IGGA 1AU3A 2AGAA 2L6LA 2JIZG 3OR6C 4LF6B 4ZHQB 3OF8A 5ITZA 4DV5B 3ASNB 2R9FA 1NU1H 2DYSB 4PELA 5KLVH 3ETDA 2IU0A 5J94A 1SQGA 3SYPA 1R6TA 4FFBB 3OT7A 2XT9A 2BU3A 3FD9A 2JS3A 5JH7B 4CH4A 1FPOA 1YALA 2A9HA 1M90W 3L75H 3PHUA 2LW1A 3KKYA 2ZIOA 4YXWG 4GKJO 3E89A 4GYCB 3CPWU 2VQEB 2FB5A 4AI8A 2O6XA 1Q82W 3IV2A 1KHQA 2JQFR 1YEWA 1R3IC 4CS2A 4OGQB 3MJ5A 1K73W 2EIKB 4LFBB 1F7YA 1S5HC 4R8CA 2PF4E 4B3SB 4P9OA 2EZOA 4FLZA 2H3OA 4PA4A 3P5VA 5EZYA 1VIBA 4FZ0A 4OX9O 1K92A 2DWEC 4P16A 4IYHA 1FXVA 1BCCH 1EZVH 1GN2A 2KQXA 2OTLV 4LWSB 3JAMN 2ZE8A 4EFEA 2VHFA 2DCAA 1QHTA 4Q6GA 3JD1A 1HDJA 1YI2V 1W0KG 4D8BA 3K57A 4DMXA 3JASB 2ZNIA 1QXPA 3C9EA 4DUZB 3PRMA 2YJBA 1YVWA 1QLEB 1CVZA 3OMAB 5LMNO 3B77A 1RP3B 3WB2A 2YICA 2P7UA 5GONB 2E76B 4RY2A 2YUAA 1PD3A 2ILMA 3N27A 5C8YB 5F02A 2UUAO 5CBHA 3LFYA 4JI4B 1NB5A 2E75B 3J81N 1HNZO 3O9OA 1VARA 2UU9B 3CRMA 3J7AU 3ZRWA 1XMQO 4LFCB 2WA4A 2Z84A 4K8ZA 1CJLA 1SC5B 5KO3A 1OCOC 5CVMA 3ZHTA 4FK5C 1VQ6V 5KHHA 3JSNA 4JI1B 3UKMA 3BBAA 4B7EA 4DR1O 4X20B 3T1HB 4A5UB 1AIMA 1WLEA 3FYIB 2HHHO 3PDFA 3JAWB 3A8TA 1BMFG 3UT5B 4I07A 5KHKA 5LGUA 2YJ9A 4JI2O 1IBKO 1UKFA 2KG7A 2ZDIA 3GB7C 3HKDA 3RW0A 4YY3B 1KQSU 1XNRO 4FZ1A 3CWBH 4ZHQA 3CCJV 3SYCA 4J7ZA 3E22B 4FJCC 2Q7EA 1Q43A 3K5OA 3CE2A 4FFBA 5EYPB 2DZYA 2R9RB 2HEPA 5JH7A 4B3MB 3U10A 4REZA 2ZM6B 1KMIZ 1NI8A 4DV7O 3I56V 1UJWB 1K33A 1CPJA 5B1NA 4LF5B 3UQ8A 2ZINA 2B9ZA 3RYCB 3G6BA 4BIZA 4PP2E 1FS0G 1EN4A 4I55B 4CDDB 4NKGB 2R9CA 1KFUL 1VJVA 5LA6B 5E6JA 4NXMO 1IXBA 4H44B 2PREA 5LGTA 1BQZA 2V7QG 1GCBA 2YXLA 1NLJA 1RPOA 4YHHB 3T1YB 2R9IA 4RAIA 1K9MW 4DR2B 3NXSA 1OCZC 2LFRA 4ABMA 1HR0B 3H6SA 5PADA 3H01A 3RYIA 2P6JA 2QWNB 5K1PA 1TA8A 4LWSA 2JEXA 3OFNG 2F93B 3ABKC 4LF9O 4FM0A 1S5LZ 1VP7A 1JPXA 5IYCO 4N23A 1KP2A 5BR8B 3JASA 3B09A 3V6CA 1MDWA 4GCZA 2X0LA 3E8BA 1WN7A 3OAAG 2DCBA 5IJ0B 3W30A 2YIBA 2QE7G 1CXZB 3BPZA 2W0FC 2LQTA 2B1MA 1JX9A 1ATKA 5C8YA 4LC1A 1MOFA 1PNKA 2EIMC 1PPNA 1JMKC 3CRQA 4UB6Z 2BTWB 4QPJA 2R6NA 2HHNA 1EWLA 2YEVB 1NPZA 1BGOA 4JTDB 4UXNA 4O4HB 2F4VB 4UCSA 2QWOB 1NH2B 2UUCB 1G4YB 2OIEA 2Q4PA 4DV4B 1JOYA 4OPAA 2YJ8A 1S4VA 1Y66A 4WA6A 1HW7A 2QR4A 1VQKV 3S3QA 2CE4A 1W0JG 5CBFA 3ZRVA 5B3SC 3CRCA 4X20A 4HAMA 3SDLA 4OVZB 2BCCH 2QEXV 4A5UA 3K79A 3HKEB 2DYRB 3EFFK 4U7NA 3FX7A 3K3WA 3JAWA 1EM1A 1MS6A 1NZ6A 3UT5A 3N3GA 1Z5WA 5JJJB 3AG3B 3WU2Z 1JA8A 1FJGO 3R65A 1FXKC 4JTCB 4C7UA 2PTMA 1GO3F 3IJ4A 1I94O 3E22A 3B79A 2PUSA 1XREA 2JGUA 5EYPA 2Q9LA 1US6A 1O9GA 5KX5A 2IBIA 1ZIVA 5CN0A 2LJ2A 3RFRA 4O2BA 5B1AC 2GUZA 3BCNA 3TETA 5LP6C 5D5PA 1M57C 1VF6C 3CJHB 5C93A 3C0RA 3T4ZA 3RYCA 5J2TB 3MHSA 4I55A 3H1IH 5LA6A 1K97A 3H7DA 1NB3A 4X66O 4X9QA 3AK3A 2OT5A 1AI4A 3SPCA 1Y74B 4O4IA 3LDEA 1YVBA 1IBMB 3BOWA 1JJOA 1NR1A 2W0XA 3EXAA 1T5EA 1BE3H 1P49A 1OCRC 5B1BC 4BWAA 4CS4A 1XI1A 1IBLB 3OE7G 3ZCCA 2PBHA 2QKCA 1MEGA 2IW5A 4Q20A 1MSDA 1WB7A 1NL6A 3KFQA 2HWKA 2Q7HA 1ROPA 1N34O 4MZSA 3D6SA 3WG7C 1BS3A 4J9ZB 1R6NA 1JCHA 4MSWC 5GTIZ 2ZIMA 2VWJA 4LF4B 4OXSA 4JI3O 1E1QG 5FNVB 3AG2B 4X89A 1AU4A 3QJ3A 3P3NA 2QM8A 5LHHA 1AJPA 1GM9A 5IJ0A 4J41A 2AXTZ 1YHQV 3MTNA 2F1MA 4NB5A 4ICGA 3WFVA 1GM7A 3B40A 2FMLA 2D3OW 2D2CB 3D3QA 4MI7A 4PDRA 4D8IA 5IYZB 2DCDA 2BTWA 1ZTEA 4ZUXU 2YEVA 3QO5A 3TCUA 2Q68A 4O4HA 2IJHA 1MHWA 1RPRA 4DW1A 1STFE 1OJHA 2DE0X 2CB5A 2A79B 3ZHRA 2DQ0A 1CEZA 1YF2A 3JYCA 2FRAA 4JAAA 4OW0A 1JVMA 2Y69B 1QR8A 1ZAUA 4OVZA 2VRZA 5KAFZ 4DR4O 3HKEA 3ABLB 4JI5O 4JYAO 1Q6KA 2EILC 4DV1O 3BY4A 4MVUA 4DK0A 1MEMA 4IYIA 2FL4A 1X4TA 4CH6A 3CXHF 1H2LA 4O4LB 3ZMSA 4JZGA 5EBMC 3F5TA 1J5EB 4QPKA 2EIJC 3HR0A 2A0LA 1EN5A 1SQBH 3LDDA 1WP8A 3JCUZ 3L73H 1W2BU 5LBQA
chains in the Genus database with same CATH topology
1A32A 4DUZO 4X62O 4ZTBA 4B3SO 4JI0O 4LF7O 4M0WA 4BOQA 4B3TO 4LF9O 2ZKOA 1DK1A 3OQCA 2UUBO 4X64O 3M8AA 4WURA 4MM3B 3IFUA 4DV2O 3MTVA 4HXDB 2VQFO 2UUAO 4BOSA 3J81N 4DV6O 1HNZO 3ZNHA 3J7AU 3TRKA 5BR8O 1XMQO 4JI4O 4YHHO 1XNQO 2Z84A 2UU9O 3W30A 2HWKA 2JTCA 2J7QA 3PHWA 2DOSA 1N34O 5KO3A 5LMUO 4LFCO 5EZSA 1AB3A 3BB7A 2AGAA 3BBAA 3R66A 4DR1O 4LFAO 1AILA 4PT5A 4RF0A 3MP2A 1N33O 4JI8O 4JI3O 2BTWB 4JI1O 4A5UB 5IWAO 4OPHA 4LF6O 4LF4O 2HHHO 1R6TA 5A2QN 3PHXA 2FE8A 3T1HO 1IBMO 2BU3A 4NXNO 2J7QC 1R1BA 5H5NA 4OPAA 1IBLO 4LF8O 4RKXA 4JI2O 2F4VO 3RNVA 1IBKO 1UKFA 1XNRO 4DV4O 4MI7A 4D8IA 3PSEA 3PHUA 4OVZB 3SDLA 4AQYO 1X59A 2BTWA 4A5UA 4YY3O 4GKJO 5BXZA 3O65A 4B3RO 5JZEA 2DJVA 4X65O 4RF1A 1N36O 2VQEO 1KUQA 4REZA 4DV5O 1DKIA 1XMOO 1FKAO 2JRIA 3MJ5A 4IP3A 4DV7O 2UXCO 4GUAA 1FJGO 1F7YA 2E5LO 2UXDO 4B3MO 4OW0A 5IT9N 3OTOO 4OVZA 4LFBO 2FKXA 1I94O 2UUCO 4LF5O 4DR4O 4DR7O 1FYJA 4OX9O 4KHPO 4P16A 3RT3C 4JI5O 4JYAO 5E6JA 4DR6O 1XEQA 4DV1O 5FLXN 4NXMO 3BY4A 4XZXA 3JAMN 2LW7A 2UZJA 1PVJA 2UXBO 5LL6Y 2Z0AA 4DV3O 3TMPA 4DUYO 2N74A 4JI6O 3PRPA 1NS1A 4IUMA 3PT2A 3B21A 4D8BA 1D2DA 3C0RA 5LMNO 3F5TA 4DR5O 4K0KO 1YZBA 4DR3O 4JV5O 3T1YO 5BY1A 1HNXO 1G1XB 3W31A 1HNWO 4BOUA 4BOPA 4D8EA 4DR2O 2ZM6O 4JI7O 1J5EO 3J80N 3PRMA 1HR0O 4RNAA 1N32O 4R3DA 5EZQA 4GKKO 4BOZA 3E9SA 4X66O 4DV0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A32 A;  4DUZ O;  4X62 O;  4B3S O;  4JI0 O;  4LF7 O;  4B3T O;  4LF9 O;  2ZKO A;  1DK1 A;  2UUB O;  4X64 O;  3M8A A;  4DV2 O;  2VQF O;  2UUA O;  3J81 N;  4DV6 O;  1HNZ O;  3J7A U;  5BR8 O;  1XMQ O;  4JI4 O;  4YHH O;  1XNQ O;  2UU9 O;  2DOS A;  1N34 O;  5LMU O;  4LFC O;  1AB3 A;  2AGA A;  3R66 A;  4DR1 O;  4LFA O;  1AIL A;  1N33 O;  4JI8 O;  4JI3 O;  4JI1 O;  4A5U B;  5IWA O;  4OPH A;  4LF6 O;  4LF4 O;  2HHH O;  1R6T A;  5A2Q N;  3T1H O;  1IBM O;  4NXN O;  1R1B A;  5H5N A;  4OPA A;  1IBL O;  4LF8 O;  4JI2 O;  2F4V O;  1IBK O;  1XNR O;  4DV4 O;  3SDL A;  4AQY O;  1X59 A;  4YY3 O;  4GKJ O;  5BXZ A;  3O65 A;  4B3R O;  2DJV A;  4X65 O;  1N36 O;  2VQE O;  1KUQ A;  4DV5 O;  1XMO O;  1FKA O;  2JRI A;  4DV7 O;  2UXC O;  1FJG O;  1F7Y A;  2E5L O;  2UXD O;  4B3M O;  5IT9 N;  3OTO O;  4LFB O;  2FKX A;  1I94 O;  2UUC O;  4LF5 O;  4DR4 O;  4DR7 O;  1FYJ A;  4OX9 O;  4KHP O;  3RT3 C;  4JI5 O;  4JYA O;  4DR6 O;  1XEQ A;  4DV1 O;  5FLX N;  4NXM O;  3JAM N;  2LW7 A;  2UXB O;  5LL6 Y;  2Z0A A;  4DV3 O;  4DUY O;  2N74 A;  4JI6 O;  1NS1 A;  1D2D A;  5LMN O;  3F5T A;  4DR5 O;  4K0K O;  1YZB A;  4DR3 O;  4JV5 O;  3T1Y O;  5BY1 A;  1HNX O;  1G1X B;  1HNW O;  4DR2 O;  2ZM6 O;  4JI7 O;  1J5E O;  3J80 N;  1HR0 O;  1N32 O;  4GKK O;  4X66 O;  4DV0 O; 
#chains in the Genus database with same CATH topology
 2HVK C;  4YYW A;  2E01 A;  4FM2 A;  2PI5 A;  4PV1 B;  2BOB C;  3CJH A;  5EIB D;  1ZCM A;  2E3C A;  5J2T A;  2R9O A;  3E8H A;  3IMA A;  3BAA A;  8PCH A;  3CP1 A;  2HVJ C;  2AHY A;  4XDL A;  1VQN V;  4GUN A;  1KBH A;  1Y74 A;  2HR3 A;  2R9M A;  1AU0 A;  5LHI A;  1A6R A;  3DC5 A;  1SA0 B;  1MNG A;  5IY5 C;  5EC1 C;  3E35 A;  1N33 O;  3PW3 A;  2YXH A;  5KA5 A;  3A0B Z;  2Z3Y A;  3K8U A;  5FPW A;  1WPX A;  1PNL A;  1D5N A;  2J7Q C;  2IPP B;  4LF8 O;  3PN1 A;  3SYO A;  5JJE B;  4KP4 A;  4D6T H;  2PI4 A;  2L35 A;  5E79 Z;  1NR7 A;  2YI9 A;  1N36 B;  5FNV A;  2WWW A;  1WA8 B;  2EZP A;  3ZHS A;  3JAK B;  4B3R O;  1F51 A;  3AG4 C;  3K0G A;  2LO1 A;  1PE6 A;  5FL7 G;  3S3W A;  4I7Z B;  1PBH A;  2PAD A;  3LSU A;  2UXD O;  5LMN B;  3K59 A;  1FFT B;  4JAS A;  5IYZ A;  1B6Q A;  2IJK A;  4XR7 A;  2FKX A;  4DR7 O;  2IM9 A;  4W4U A;  3SJB C;  2UUA B;  3OF9 A;  4FVM A;  3CS5 A;  5DM6 V;  4MVS A;  1S72 V;  3GWO A;  4PJ0 Z;  1F29 A;  4J7J A;  1IVS A;  1OV9 A;  3UO2 A;  4JV5 B;  4QBB A;  2CTQ A;  1EN6 A;  5EIB C;  3ASO C;  2AW9 A;  1N32 B;  4UVB A;  1GTO A;  3AK1 A;  1AJN A;  1MG1 A;  4BOU A;  3K08 A;  4PDV A;  3J80 N;  3CH2 X;  4DR1 B;  4B3T B;  2P4V A;  2IH3 C;  4BOZ A;  2M7W A;  3BVO A;  4L8J A;  4JI0 O;  3O1G A;  3SJC C;  4F6R B;  4BS6 A;  3K5N A;  4GX5 A;  2VQF B;  2A7W A;  4O4L A;  3FB6 C;  4Q8G A;  2N05 A;  4LH6 A;  1GN3 A;  1PXV A;  2FYU H;  3H9V A;  4JI2 B;  4MZO A;  1IBK B;  5TIS Z;  1XNR B;  4JPR A;  3EHB B;  4N4Z A;  4FFK A;  1AYU A;  5KHJ A;  1FFX A;  2DJF B;  1QVF U;  4U7O A;  5L3B A;  2DQ3 A;  4RF0 A;  1EWO A;  2EX3 A;  1YCI A;  2AIM A;  1KD1 W;  3LUT B;  3RVY A;  2RNB A;  2ZT9 B;  5AG2 A;  4UCT A;  3ETE A;  1IZ3 A;  3TXQ A;  1POP A;  5JVD B;  4NXM B;  3CCQ V;  2DJG B;  4PD4 F;  3EVK A;  4Z1V A;  1SA0 A;  1BGY H;  2QGN A;  1ZSP A;  2BTQ B;  1BL8 A;  2OWO A;  1PNM A;  5BXZ A;  1SZX A;  1Q6U A;  5CHT A;  2JJ2 G;  3A2F A;  2E5L B;  5IYB O;  4PP1 A;  1WJZ A;  1DKI A;  2IBZ H;  2OP3 A;  2DMX A;  1YIJ V;  1GEC E;  3B8M A;  2YDE A;  5CBG A;  4LF9 B;  1DEU A;  4Q8H A;  3X2Q C;  1WA8 A;  2UXN A;  2ZE5 A;  3JAK A;  2FT2 A;  3H1J H;  5H2F Z;  4DR6 O;  1XKG A;  2G6D A;  1PKX A;  4X88 A;  2FRQ A;  2YJ2 A;  4XUI A;  4DR5 B;  3T2M A;  1Q90 D;  3C3T A;  3MHH C;  4X1K B;  3CBJ A;  5L3F A;  3D3I A;  4QE9 A;  3CCS V;  2F7D A;  3W7X A;  3W31 A;  2Q69 A;  1JQ0 A;  5EZQ A;  3ABM C;  4LF7 B;  4YIP A;  3RYI B;  4X62 O;  4IIJ B;  1CTE A;  3OIS A;  1O0E A;  2ZE6 A;  4JGS A;  3CXC U;  1F2A A;  1KU9 A;  1S77 D;  4MM3 B;  3PBH A;  1ENV A;  3ABT A;  4DV6 O;  2WLL B;  1PL4 A;  4PA9 A;  3BRC A;  4WFH A;  2WLH A;  3P5X A;  1E1R G;  1XNQ O;  4CS3 A;  3IC9 A;  4NTX A;  2JS5 A;  4B08 A;  4F6R A;  1YTF D;  4LFA B;  1WPB A;  2EUL A;  3ERV A;  5FPO A;  4H0L B;  3VQW A;  1QDQ A;  2OIG A;  3HD3 A;  4JI8 O;  2CH7 A;  3W7U A;  3UM7 A;  3LNN A;  1SQQ H;  1AI5 A;  1IX9 A;  4HZ3 A;  1I94 B;  4X8A A;  1U9Q X;  2DC9 A;  3G6E V;  3L74 H;  4AQY B;  2DYS C;  2JVD A;  1PPO A;  4AHC A;  4WFA V;  1M9N A;  1OCZ B;  4FLY A;  2ITD C;  5JZE A;  4TT3 G;  1KFX L;  4X65 O;  1VF7 A;  4HNA A;  3JD0 A;  3QT4 A;  1R73 A;  1NQT A;  2AHZ A;  2OCC C;  3JAL A;  3ZHQ A;  5L3C A;  3NHE A;  2UXX A;  3ABK B;  5JVD A;  3VQY A;  1H8E G;  1KHP A;  1I5X A;  5E1A C;  5IT9 N;  3QNE A;  2BTQ A;  2B1N A;  1EFR G;  1E79 G;  4UFZ A;  1U9X A;  4X1I B;  5JCO C;  4GZR B;  3SPJ A;  2GHY A;  2OTJ V;  4GX1 A;  3CCE V;  3BPM A;  3H89 A;  4TWK A;  3RWR D;  2X6A A;  1SRY A;  4I50 B;  1GMG A;  1V55 C;  1NQC A;  5KX5 B;  4K0K O;  4O2B B;  2EIM B;  3U8E A;  2GUZ B;  4WFG A;  1G1X B;  1HNW O;  4N79 A;  2H8P C;  3RGB A;  3JD2 A;  3VQX A;  4JI3 B;  1M5I A;  4HYO A;  1A32 A;  1GRJ A;  1H2K A;  1SQV H;  5KHG A;  1CPY A;  4FK5 A;  4X1K A;  1P7B A;  2UUB O;  3F7Y C;  3K9M A;  1PPD A;  4O4I B;  5B66 Z;  4QRX A;  5B3S B;  4ZI7 B;  5LMU B;  1KYO F;  5KHI A;  1Q6H A;  4IIJ A;  4R50 A;  4LH7 A;  5EZS A;  5LOV B;  5EC2 C;  1AB3 A;  1FXK B;  4CH5 A;  5KMG B;  2WLL A;  2ZE7 A;  1YJN V;  4LF6 O;  1SF9 A;  3LNM B;  1XBL A;  4FJC A;  1TAE A;  3CYO A;  2KB1 A;  2RDC A;  2JEU A;  2G38 A;  2Y48 A;  1THZ A;  3OEH G;  3RNV A;  4RQF A;  4DV1 B;  2XAF A;  5B1A B;  3LSS A;  3VQV A;  1QLN A;  5LP6 B;  1M57 B;  4KLB A;  4RQE A;  4DRX B;  2NLJ C;  4I4T B;  3DXR B;  1ME4 A;  1KP3 A;  2P22 C;  3DGE A;  1XHX A;  1TUB B;  2VQE O;  2V1D A;  4FLW A;  2YIA A;  1FKA O;  3OUS A;  2YXY A;  1MZE A;  1ZWI C;  3ABU A;  5GTH Z;  4CC6 A;  1H2N A;  1RM1 C;  1L8D A;  2WLJ A;  3K06 A;  1OCR B;  5B1B B;  4LFB O;  1GM8 A;  4RUE A;  4MW8 A;  1FYJ A;  2NQD B;  1SQF A;  2ZD9 A;  2QA4 V;  3T4D A;  5JQG B;  4FLT A;  1TUE B;  5LL6 Y;  4WBN B;  3F5W C;  4EB6 B;  4LR3 A;  3WG7 B;  4JI6 O;  1SP4 B;  3CSX A;  1VQP V;  5EBW C;  4YJ2 B;  2F66 C;  1YK7 A;  1CV8 A;  3K9S A;  4DV0 B;  4X1I A;  2HP8 A;  2IJI A;  4G54 A;  4YYU A;  1Q5O A;  2OYQ A;  1KXR A;  1VQL V;  1N33 B;  1QQC A;  2QWR B;  2Y4T A;  1PP9 H;  4DUZ O;  4ZTB A;  5L3G A;  1BQI A;  4O4J B;  2CDY A;  5HFL A;  4I50 A;  3OGC C;  3CRR A;  1XDC A;  2ZKO A;  3BA8 A;  1Y76 B;  5JJN B;  2PZS A;  2X6B A;  2GTA A;  4BOS A;  2Z5U A;  1B3Q A;  1ZUQ A;  1B06 A;  1K8A W;  3ZBH A;  1QNM A;  3RYF A;  4KUM A;  3ZS8 C;  4JI4 O;  2FTD A;  3OD4 A;  2UU9 O;  2CTR A;  2R9A A;  3CBK A;  3N3K A;  1L0N H;  2XAG A;  4JYY A;  1MSW D;  1AJQ A;  4B3R B;  4LFC O;  3FKS G;  3O0U A;  1NJI W;  1AR4 A;  1CQD A;  4CDE B;  1SER A;  3R66 A;  2Y0I A;  3THO A;  4JI1 O;  4NXN B;  1ITO A;  4ZI7 A;  4OPH A;  2UXD B;  1BZK A;  3Q4H B;  1JR9 A;  2EIL B;  3T1H O;  1I5Y A;  1SZT A;  3OMI B;  4I0X B;  4CH3 A;  4JTA B;  4RKX A;  4PI0 A;  1DTO A;  3DTU B;  1CP9 A;  1FXH A;  5LOV A;  1YJW V;  3BEH A;  5JWP A;  1FXK A;  4I9Q A;  2QTS A;  5FPR A;  3H1L H;  5KMG A;  4YY3 O;  2CK3 G;  3RVX A;  3O65 A;  1I0H A;  2EIJ B;  3QSD A;  1DF5 A;  3P5U A;  1XMO B;  1SES A;  4TSF G;  2BDL A;  3E8G A;  4RUF A;  3OTO B;  4BIO A;  4J7K A;  2XUM A;  4O2A B;  1BHA A;  1N0N A;  4DK1 A;  4B3M O;  3ZIA G;  5LP6 A;  1AP5 A;  1VF6 A;  4LNU B;  2HLD G;  4BW5 A;  4DRX A;  4NTY A;  4LF5 O;  2UXB B;  1QR9 A;  3FFQ A;  3DXR A;  4I4T A;  3DF0 A;  4DUY B;  1TGO A;  3BA9 A;  4TUY B;  1L1F A;  3W7T A;  1TUB A;  3AEI A;  4DV3 O;  3HKB B;  2Q8V A;  1TL9 A;  4EFB A;  1HNX B;  4KXR A;  1WP7 A;  3IC7 A;  4KFM A;  1BT8 A;  2QKS A;  1M4U A;  5IY5 B;  4DR3 O;  2QM4 A;  3T1Y O;  3IHP A;  4FLU A;  4X1Y B;  4DR2 O;  4PI2 A;  1HR0 O;  2ARH A;  1ORQ C;  2LP7 A;  4GKK O;  3E9S A;  1SQX H;  5H9C A;  5JQG A;  4X64 B;  1V54 C;  5CB4 B;  4WBN A;  3OMN B;  4EB6 A;  1NVP D;  3AG7 A;  1YSC A;  3OQC A;  1SQP H;  3D36 C;  4QIW F;  2PYL A;  2XU5 A;  2X6C A;  3P32 A;  2AUX A;  4YJ2 A;  3ZUA A;  5J2U A;  2XHB A;  2ACT A;  3BCC H;  5BR8 O;  2M6Y A;  3AG4 B;  3TK1 A;  3U0Z A;  1FAF A;  4HBN A;  2JTC A;  4UVA A;  2DW4 A;  4O4J A;  3OUF A;  4WFF A;  1W59 A;  1L0L H;  3N2K B;  1Y76 A;  3CX5 F;  1DF0 A;  2Q7G A;  2XAJ A;  1FFX B;  3AG1 C;  1AIL A;  2KSD A;  4CC5 A;  1P4R A;  5IWA O;  2YSU B;  3GWK C;  1K5Q A;  5KUK A;  2AU1 A;  3KSE A;  1PL0 A;  5H5N A;  2JGD B;  2XU1 A;  2F4V O;  2AYN A;  1FH0 A;  4MSX A;  3B8N A;  4GKJ B;  5J9P C;  4W4K A;  4DV4 O;  4TQD A;  3ASO B;  2AYO A;  4IT5 A;  1KKC A;  3RYH A;  2DJV A;  1V9P A;  3L72 H;  2ZXW C;  2V4D A;  3Q4H A;  4RWU A;  3NR7 A;  2G7Y A;  5K1X A;  1X9Y A;  1XOU A;  4I0X A;  3P3P A;  1ICF A;  1URF A;  1R6K A;  1RFY A;  4FM1 A;  4OX9 B;  3JD4 A;  3A0H Z;  4W5C A;  2RMK B;  1RSO B;  3FB7 C;  1K3E A;  4I05 A;  3W7S A;  3RT3 C;  4YV8 A;  1F2C A;  2G8E A;  4BSQ A;  2WSS G;  4CDF B;  2BTO A;  2R70 A;  4MTG A;  3K5M A;  4O2A A;  3ABL C;  2GTS A;  4FIP C;  4Z1M G;  4RO2 A;  4AIL C;  3F5V A;  2QWQ B;  4LNU A;  3HB3 B;  3IOQ A;  4JI7 O;  3CB2 A;  4UUJ C;  4TUY A;  2VHS A;  4JI8 B;  1TLO A;  3CCV V;  4L87 A;  2DCC A;  3VBB A;  3HKB A;  2WBF X;  4YYS A;  2W6J G;  2O57 A;  2RN9 A;  1HNZ B;  4TOI A;  4ZBM A;  4TV8 B;  4UV9 A;  2CIO A;  5H6R A;  1XMQ B;  4E4E A;  1LNQ A;  4X1Y A;  2A3Q A;  2WLN A;  1ZLZ A;  4TQF A;  2WLK A;  1BY8 A;  1JQP A;  3PHW A;  2J7Q A;  4UB8 Z;  2CTW A;  5CB4 A;  2HJF C;  2WLI B;  1Y67 A;  4GX0 A;  3MOR A;  2ATO A;  2HHH B;  3CRA A;  1GN6 A;  2EIN C;  1MZF A;  3X2Q B;  3ZED A;  4LF4 O;  1OHH G;  4LBE C;  5EBL C;  2GBO A;  3I5D A;  3LXS A;  2FYE A;  4F6E A;  2CH7 B;  1ZL8 B;  3S3R A;  3M7M X;  2R72 A;  2DWD C;  4H13 B;  4CZW A;  3H8B A;  4N21 A;  3N2K A;  4PDM A;  1NKD A;  3IFX A;  1EWM A;  1THE A;  5CA3 A;  2GDS A;  5A9G A;  5KAI Z;  3KWB X;  1JFF B;  3ABM B;  1WB8 A;  3CMA V;  4K0K B;  4DV7 B;  3QG5 A;  1R3L C;  1ARO P;  1MAB G;  2JGD A;  3MAQ A;  1NBM G;  4HNA B;  2UXC O;  2YC0 A;  1H2G A;  1SET A;  4Z2W A;  1NT2 B;  3JAL B;  4BS5 A;  4GT1 A;  1VQ7 V;  2P5O A;  4QRV A;  1K7D A;  2LFS A;  5CA1 B;  5IYD O;  3BFR A;  5BMV B;  1ZX3 A;  1YXB A;  2XND G;  2NQG A;  1H38 A;  2CTP A;  3JAR B;  2WPD G;  2IJJ A;  2DC6 A;  2ZR3 A;  1NS1 A;  2GSM B;  1D2D A;  1Q8I A;  1RSO A;  2WA3 A;  3CME V;  2GFO A;  4ZOL B;  1LUV A;  3FYE B;  3DC6 A;  1J5E O;  3K03 A;  3LDC A;  3ZMZ A;  1LR1 A;  1EBO A;  1Q6I A;  4TV9 B;  2P4K A;  1IWD A;  3E2E A;  2ZR2 A;  3M8A A;  4J11 A;  4DV2 O;  3GCB A;  4E2L A;  1OCO B;  3FAV B;  5DED A;  1U9V A;  3G80 A;  2WLM A;  3RBZ A;  2WAM A;  2AZ2 A;  3JCZ A;  1AEC A;  2P7T C;  1U5I A;  2ZQM A;  5LYJ A;  3K9A A;  2QM7 A;  1M56 C;  2OCC B;  2VWK A;  2XU4 A;  2B1I A;  4XDJ A;  3SGI A;  2IH1 C;  1TU6 A;  3BB7 A;  1QBZ A;  4TV8 A;  5IJ9 B;  3IEJ A;  2HXZ A;  3MP2 A;  1Q7Y W;  2HFE C;  4U3J B;  1M1K W;  4BR6 A;  1PV0 A;  3CCU V;  1OZ0 A;  2PGG A;  2WLI A;  1V55 B;  2Y0P A;  2DN9 A;  4XBF A;  2XAH A;  1K4C C;  5KUM A;  1HWY A;  5LXT A;  4EEQ A;  4JI6 B;  1UFI A;  1AP6 A;  4YJ3 B;  3G67 A;  1F4M A;  1N36 O;  2QDO A;  3SPH A;  4JYB A;  1F23 A;  2YIB D;  1FJG B;  2MW2 B;  1YTF B;  1OCC C;  1ZL8 A;  4CBC A;  1Q81 W;  2FUD A;  2ZDI C;  1EWP A;  4GUA A;  4QRG A;  3JSL A;  3MHH A;  4JAU A;  5IE9 A;  3ASN C;  5GW7 A;  1VQ8 V;  2NNU A;  2XAQ A;  4KHP O;  1JFF A;  2NR5 A;  2Q0A A;  2BSK B;  2ZCE A;  2R9N A;  2JDI G;  1JJ2 U;  5CVO B;  3N2G B;  1SKV A;  2CGO A;  3HPL C;  3QVN A;  1P84 F;  3MD0 A;  4PAD A;  3CC4 V;  1AR5 A;  4JV5 O;  1MMM A;  3F7V C;  4H33 A;  4X66 B;  4YYV A;  1QCE A;  5CA1 A;  3OW2 U;  3UO3 A;  1Q86 W;  5BMV A;  2YS8 A;  4RNA A;  1N32 O;  3SPI A;  3CC2 V;  3CH3 X;  3D8C A;  1Y4H A;  3KG2 A;  5EK0 A;  3JAR A;  4B3T O;  2EIK C;  4WCE V;  3APQ A;  1S5J A;  2VQF O;  3ZNH A;  3E86 A;  4ZOL A;  3CEI A;  4NTW A;  1NTK H;  1N34 B;  3TRK A;  1R3K C;  3TJT A;  2P90 A;  2DZZ A;  2KKW A;  3HKC B;  2K9P A;  2MK3 A;  3L9D A;  4TV9 A;  3RYF B;  2RCV A;  1Q3E A;  1N4C A;  3STL C;  4W5B A;  4PT5 A;  3JD3 A;  3FAV A;  1RM1 B;  1IUR A;  3HHI A;  5JA7 A;  2F43 G;  4QE7 A;  5F2V O;  1H8H G;  5DN6 G;  4JYC A;  1QLE C;  1AI6 A;  7PCK A;  3ZRS A;  4UCO A;  3STZ C;  3IAY A;  1XL6 A;  2FO5 A;  1R1B A;  3ETG A;  1DF4 A;  3T1C A;  3I3T A;  2Q73 A;  1PIP A;  2EJ7 A;  4BAY A;  4X6I A;  2CGN A;  1WAZ A;  1R3J C;  3BPF A;  2XOK G;  2ETN A;  5IJ9 A;  4DV3 B;  3PSE A;  2QWP B;  1QOL A;  1GK9 A;  4D7S A;  2AS8 A;  2Y6E A;  3RVW A;  1B04 A;  3ZMU A;  3A0R A;  5JCO A;  4U3J A;  4BPV A;  1Z5V A;  1I7F A;  2FQ9 A;  4DR3 B;  2ATK C;  2CAZ C;  4ZIB A;  4DV5 O;  4IP3 A;  4QH6 A;  3ZHV A;  3K58 A;  4GKK B;  1AVM A;  1N8R W;  2E5L O;  4DR4 B;  3AI8 A;  2LGW A;  1XUQ A;  4JI5 B;  4JYA B;  1AU2 A;  4P2Z A;  4K8X A;  4YJ3 A;  2AVW A;  1BP4 A;  2OCH A;  5FLX N;  1EF7 A;  2LW7 A;  1PVJ A;  2FTK A;  3CCM V;  1QMY A;  4XDK A;  2Z0A A;  5CA0 B;  3H1K H;  1MIR A;  4YYR A;  4MVR A;  3I55 V;  3RVV A;  3PRP A;  3PT2 A;  4DR5 O;  2JK5 C;  2HD5 A;  4X6J A;  4AXL A;  4PA6 A;  3WXE A;  2YID A;  5BY1 A;  1J95 A;  2Y4U A;  2ZNJ A;  4BOP A;  4D8E A;  5K16 A;  3OEE G;  1VF5 B;  2F23 A;  2BSK A;  4MVO A;  4UCR A;  1SS3 A;  1I08 A;  5GON A;  2ADP A;  3N2G A;  1NH2 D;  2VS0 A;  4B3S O;  4B7K A;  5IWA B;  3RVZ A;  2K1E A;  4LP8 A;  4LF7 O;  2JJ1 G;  3MDS A;  1XL4 A;  1DK1 A;  4QNH B;  4DO2 A;  4WFE A;  3SPG A;  3WB1 A;  3MTV A;  4DW0 A;  3H1H H;  1AYV A;  3MHS C;  3ZJZ A;  4MW3 A;  3KX1 A;  2G8J A;  1TVK B;  3P30 A;  2A06 H;  4MS2 A;  2P67 A;  4YYQ A;  2DC8 A;  1FD9 A;  4IL6 Z;  4PHZ A;  5J2U B;  2HH5 A;  4G28 B;  3PJS K;  5EGW A;  5CMU A;  2RQ6 A;  5B1O A;  5JH3 A;  3PNR A;  4G2K A;  4YVA A;  2NQI A;  2E03 A;  4LFA O;  3ZHU A;  1K4D C;  2OUL A;  4MVM A;  2XTA A;  2Q6A A;  4FLV A;  3QO7 A;  1BHB A;  3ZMT A;  4LF8 B;  3ZN0 A;  3SYA A;  5A2Q N;  2E74 B;  2FE8 A;  4P6E A;  3WXF A;  1YDX A;  3HKC A;  2QJ1 A;  3RN4 A;  4K7C A;  3KCY A;  1COW G;  3SJA C;  1PCI A;  1GAX A;  2YJC A;  1AYW A;  4FMT A;  1CS8 A;  2BOC C;  4UVC A;  4AQY O;  3BWK A;  1P7G A;  2H94 A;  2P86 A;  4WFB V;  1VQ5 V;  4WF9 V;  1GLO A;  4RF1 A;  1D5A A;  2AUZ A;  3BAB A;  3ZMV A;  3RYH B;  3M99 B;  1V54 B;  4JI7 B;  3DSQ A;  4NR1 A;  3CCR V;  4DR7 B;  4CDC B;  4MVQ A;  1AI7 A;  3GVM A;  4JZ2 A;  1IDS A;  1XEQ A;  2B1G A;  1VEW A;  2PY5 A;  1VMG A;  3CHX A;  3B4S A;  1CSB B;  4FLX A;  4K3A A;  3TMP A;  2HJD A;  1VQ9 V;  4D7T A;  1YIT V;  3UCS C;  2N74 A;  3V6E A;  1Z2G A;  3WXG A;  1VQ4 V;  1YZB A;  3AG1 B;  3ZRX A;  1XQ8 A;  3USV A;  2DYR C;  4JI0 B;  3OTF A;  1DLB A;  2ZM6 O;  2GHU A;  4R3D A;  4K35 A;  5H6Q A;  5L3E A;  5CA0 A;  4BOQ A;  1BSM A;  3AG3 C;  1QU7 A;  2JQG R;  1K5S A;  4YIO A;  2AZ0 A;  3S3X A;  1VQO V;  4WUR A;  1Y6X A;  1H2S B;  4HXD B;  2Q5Z A;  3OVZ A;  4I5S A;  5HFM A;  4F4L A;  1F4N A;  4YHH O;  2ZXW B;  6PAD A;  5LMU O;  3WB0 A;  4UCV A;  3HWN A;  4JF3 A;  1ME3 A;  4UCU A;  3G4S V;  4IHJ B;  3E1Z B;  3H8C A;  1KB9 F;  1VQM V;  2UXC B;  1TVK A;  2QTO A;  3U11 A;  3TNX A;  4OEM A;  1NTM H;  3PHX A;  4MT8 A;  3L71 H;  2CUG A;  1YT7 A;  3F75 A;  3I06 A;  1WNS A;  1NVP B;  2HG5 C;  1S76 D;  3FB5 C;  3KCX A;  3SR2 C;  1Y08 A;  1X59 A;  4J10 A;  5LGN A;  1O9H A;  5A24 A;  2GV9 A;  1HUC B;  1M93 A;  3B2E E;  4I9W A;  5D5Q A;  1M6D A;  2HKO A;  4DXW A;  4X6H A;  2B5U A;  2ODM A;  3AG2 C;  3G71 V;  4DR6 B;  4J80 A;  1G6U A;  4U3F H;  2UUC O;  4BQV A;  4GX2 A;  2E02 A;  4DV2 B;  2P06 A;  2PNS A;  4P30 A;  4UV8 A;  3JAT B;  1U96 A;  2DC7 A;  3M99 A;  2F95 B;  3OGI B;  3K24 A;  1XIL A;  4ASU G;  4FPP A;  1H2M A;  1QVG U;  1S0V A;  1VSN A;  1IXM A;  2IU3 A;  3L70 H;  2YI8 A;  3D36 A;  4QGP A;  1S3J A;  3HHA A;  4LCU C;  3KZI Z;  4X62 B;  2EIN B;  3ETQ A;  4MTF A;  4PA3 A;  4BW9 A;  1U9W A;  4PDL A;  4P9P A;  1PAD A;  2ADQ B;  4DV0 O;  1LUW A;  1SNK A;  2XAS A;  4I04 A;  3VOU A;  1GKF A;  3LSQ A;  4DV6 B;  4JAV A;  4N8W A;  2Y69 C;  2Q0O C;  3IFU A;  5ITZ B;  1XNQ B;  2X7R B;  4EKW A;  3CD6 V;  1PPP A;  1XHZ A;  2XU3 A;  4DYL A;  5L3D A;  3BC3 A;  2DOS A;  3ICX A;  1BQ0 A;  5EF4 A;  3E8F A;  5LYJ B;  3IUT A;  1KKD A;  4PA7 A;  3K5L A;  1YJ9 V;  3CCL V;  2EBO A;  3C90 A;  1KEC A;  2RJZ A;  2PYJ A;  3KWZ A;  2LGQ A;  1KC8 W;  3OVX A;  2BE3 A;  3APO A;  1IBM O;  4NXN O;  4BIU A;  5CHV A;  1IBL O;  4ZKI A;  4KHP B;  3OR7 C;  1G8M A;  2OZ2 A;  4MTX A;  3CC7 V;  1MA1 A;  2BDZ A;  1EZJ A;  1NTZ H;  3KW9 A;  3SYQ A;  3C3S A;  3ZX6 A;  4X65 B;  4IHJ A;  2N04 A;  3QF7 A;  4W4L A;  5EZY B;  1U97 A;  2NN4 A;  4NYK A;  3ZN1 A;  3BY6 A;  1CB5 A;  4R7C A;  5LXT B;  1KUQ A;  1HP8 A;  5DEC A;  3KKU A;  4J42 A;  2W6I G;  2JRI A;  1XMO O;  4HWY A;  3TGU H;  4AXM A;  4H37 A;  4MTO A;  3ML0 A;  4KL1 A;  4FIP A;  3OTO O;  2QKA A;  3AK2 A;  3P5W A;  2P0R A;  1UPG A;  2ITC C;  1F2B A;  5CVN B;  4XZX A;  2UZJ A;  1K34 A;  2UXB O;  1YK8 A;  2QSA A;  4DUY O;  2C0Y A;  2H7J A;  4J9Y B;  4DMY A;  1M56 B;  1HNW B;  5BZB A;  4IUM A;  3BHP A;  5IDJ A;  3B21 A;  1Y4M A;  9PAP A;  1GN4 A;  1K3B B;  3K0D A;  1HNX O;  2E00 A;  3N4C A;  4CZZ A;  4R6Z A;  3E83 A;  1GMY A;  3OM3 B;  3SJQ C;  3ZRW B;  2F1G A;  3QO8 A;  3JAT A;  3K04 A;  1AR1 B;  1N0J A;  5KA6 A;  3QTC A;  4G27 B;  2UUB B;  4QJF B;  4M0W A;  3W7W A;  4MVZ A;  2NQA A;  5B5E Z;  2Y5B A;  4X64 O;  2C2A A;  1DGS A;  4NVP A;  5LHG A;  4P6G A;  1PM9 A;  3IGA C;  1GH6 A;  2EJR A;  1PPJ H;  4OEL A;  4GLX A;  2ARY A;  1OCC B;  2Q67 A;  3TXS A;  4PI3 A;  2KG7 B;  3FB8 C;  3HKD B;  4IGG A;  1AU3 A;  2AGA A;  2L6L A;  2JIZ G;  3OR6 C;  4LF6 B;  4ZHQ B;  3OF8 A;  5ITZ A;  4DV5 B;  3ASN B;  2R9F A;  1NU1 H;  2DYS B;  4PEL A;  5KLV H;  3ETD A;  2IU0 A;  5J94 A;  1SQG A;  3SYP A;  1R6T A;  4FFB B;  3OT7 A;  2XT9 A;  2BU3 A;  3FD9 A;  2JS3 A;  5JH7 B;  4CH4 A;  1FPO A;  1YAL A;  2A9H A;  1M90 W;  3L75 H;  3PHU A;  2LW1 A;  3KKY A;  2ZIO A;  4YXW G;  4GKJ O;  3E89 A;  4GYC B;  3CPW U;  2VQE B;  2FB5 A;  4AI8 A;  2O6X A;  1Q82 W;  3IV2 A;  1KHQ A;  2JQF R;  1YEW A;  1R3I C;  4CS2 A;  4OGQ B;  3MJ5 A;  1K73 W;  2EIK B;  4LFB B;  1F7Y A;  1S5H C;  4R8C A;  2PF4 E;  4B3S B;  4P9O A;  2EZO A;  4FLZ A;  2H3O A;  4PA4 A;  3P5V A;  5EZY A;  1VIB A;  4FZ0 A;  4OX9 O;  1K92 A;  2DWE C;  4P16 A;  4IYH A;  1FXV A;  1BCC H;  1EZV H;  1GN2 A;  2KQX A;  2OTL V;  4LWS B;  3JAM N;  2ZE8 A;  4EFE A;  2VHF A;  2DCA A;  1QHT A;  4Q6G A;  3JD1 A;  1HDJ A;  1YI2 V;  1W0K G;  4D8B A;  3K57 A;  4DMX A;  3JAS B;  2ZNI A;  1QXP A;  3C9E A;  4DUZ B;  3PRM A;  2YJB A;  1YVW A;  1QLE B;  1CVZ A;  3OMA B;  5LMN O;  3B77 A;  1RP3 B;  3WB2 A;  2YIC A;  2P7U A;  5GON B;  2E76 B;  4RY2 A;  2YUA A;  1PD3 A;  2ILM A;  3N27 A;  5C8Y B;  5F02 A;  2UUA O;  5CBH A;  3LFY A;  4JI4 B;  1NB5 A;  2E75 B;  3J81 N;  1HNZ O;  3O9O A;  1VAR A;  2UU9 B;  3CRM A;  3J7A U;  3ZRW A;  1XMQ O;  4LFC B;  2WA4 A;  2Z84 A;  4K8Z A;  1CJL A;  1SC5 B;  5KO3 A;  1OCO C;  5CVM A;  3ZHT A;  4FK5 C;  1VQ6 V;  5KHH A;  3JSN A;  4JI1 B;  3UKM A;  3BBA A;  4B7E A;  4DR1 O;  4X20 B;  3T1H B;  4A5U B;  1AIM A;  1WLE A;  3FYI B;  2HHH O;  3PDF A;  3JAW B;  3A8T A;  1BMF G;  3UT5 B;  4I07 A;  5KHK A;  5LGU A;  2YJ9 A;  4JI2 O;  1IBK O;  1UKF A;  2KG7 A;  2ZDI A;  3GB7 C;  3HKD A;  3RW0 A;  4YY3 B;  1KQS U;  1XNR O;  4FZ1 A;  3CWB H;  4ZHQ A;  3CCJ V;  3SYC A;  4J7Z A;  3E22 B;  4FJC C;  2Q7E A;  1Q43 A;  3K5O A;  3CE2 A;  4FFB A;  5EYP B;  2DZY A;  2R9R B;  2HEP A;  5JH7 A;  4B3M B;  3U10 A;  4REZ A;  2ZM6 B;  1KMI Z;  1NI8 A;  4DV7 O;  3I56 V;  1UJW B;  1K33 A;  1CPJ A;  5B1N A;  4LF5 B;  3UQ8 A;  2ZIN A;  2B9Z A;  3RYC B;  3G6B A;  4BIZ A;  4PP2 E;  1FS0 G;  1EN4 A;  4I55 B;  4CDD B;  4NKG B;  2R9C A;  1KFU L;  1VJV A;  5LA6 B;  5E6J A;  4NXM O;  1IXB A;  4H44 B;  2PRE A;  5LGT A;  1BQZ A;  2V7Q G;  1GCB A;  2YXL A;  1NLJ A;  1RPO A;  4YHH B;  3T1Y B;  2R9I A;  4RAI A;  1K9M W;  4DR2 B;  3NXS A;  1OCZ C;  2LFR A;  4ABM A;  1HR0 B;  3H6S A;  5PAD A;  3H01 A;  3RYI A;  2P6J A;  2QWN B;  5K1P A;  1TA8 A;  4LWS A;  2JEX A;  3OFN G;  2F93 B;  3ABK C;  4LF9 O;  4FM0 A;  1S5L Z;  1VP7 A;  1JPX A;  5IYC O;  4N23 A;  1KP2 A;  5BR8 B;  3JAS A;  3B09 A;  3V6C A;  1MDW A;  4GCZ A;  2X0L A;  3E8B A;  1WN7 A;  3OAA G;  2DCB A;  5IJ0 B;  3W30 A;  2YIB A;  2QE7 G;  1CXZ B;  3BPZ A;  2W0F C;  2LQT A;  2B1M A;  1JX9 A;  1ATK A;  5C8Y A;  4LC1 A;  1MOF A;  1PNK A;  2EIM C;  1PPN A;  1JMK C;  3CRQ A;  4UB6 Z;  2BTW B;  4QPJ A;  2R6N A;  2HHN A;  1EWL A;  2YEV B;  1NPZ A;  1BGO A;  4JTD B;  4UXN A;  4O4H B;  2F4V B;  4UCS A;  2QWO B;  1NH2 B;  2UUC B;  1G4Y B;  2OIE A;  2Q4P A;  4DV4 B;  1JOY A;  4OPA A;  2YJ8 A;  1S4V A;  1Y66 A;  4WA6 A;  1HW7 A;  2QR4 A;  1VQK V;  3S3Q A;  2CE4 A;  1W0J G;  5CBF A;  3ZRV A;  5B3S C;  3CRC A;  4X20 A;  4HAM A;  3SDL A;  4OVZ B;  2BCC H;  2QEX V;  4A5U A;  3K79 A;  3HKE B;  2DYR B;  3EFF K;  4U7N A;  3FX7 A;  3K3W A;  3JAW A;  1EM1 A;  1MS6 A;  1NZ6 A;  3UT5 A;  3N3G A;  1Z5W A;  5JJJ B;  3AG3 B;  3WU2 Z;  1JA8 A;  1FJG O;  3R65 A;  1FXK C;  4JTC B;  4C7U A;  2PTM A;  1GO3 F;  3IJ4 A;  1I94 O;  3E22 A;  3B79 A;  2PUS A;  1XRE A;  2JGU A;  5EYP A;  2Q9L A;  1US6 A;  1O9G A;  5KX5 A;  2IBI A;  1ZIV A;  5CN0 A;  2LJ2 A;  3RFR A;  4O2B A;  5B1A C;  2GUZ A;  3BCN A;  3TET A;  5LP6 C;  5D5P A;  1M57 C;  1VF6 C;  3CJH B;  5C93 A;  3C0R A;  3T4Z A;  3RYC A;  5J2T B;  3MHS A;  4I55 A;  3H1I H;  5LA6 A;  1K97 A;  3H7D A;  1NB3 A;  4X66 O;  4X9Q A;  3AK3 A;  2OT5 A;  1AI4 A;  3SPC A;  1Y74 B;  4O4I A;  3LDE A;  1YVB A;  1IBM B;  3BOW A;  1JJO A;  1NR1 A;  2W0X A;  3EXA A;  1T5E A;  1BE3 H;  1P49 A;  1OCR C;  5B1B C;  4BWA A;  4CS4 A;  1XI1 A;  1IBL B;  3OE7 G;  3ZCC A;  2PBH A;  2QKC A;  1MEG A;  2IW5 A;  4Q20 A;  1MSD A;  1WB7 A;  1NL6 A;  3KFQ A;  2HWK A;  2Q7H A;  1ROP A;  1N34 O;  4MZS A;  3D6S A;  3WG7 C;  1BS3 A;  4J9Z B;  1R6N A;  1JCH A;  4MSW C;  5GTI Z;  2ZIM A;  2VWJ A;  4LF4 B;  4OXS A;  4JI3 O;  1E1Q G;  5FNV B;  3AG2 B;  4X89 A;  1AU4 A;  3QJ3 A;  3P3N A;  2QM8 A;  5LHH A;  1AJP A;  1GM9 A;  5IJ0 A;  4J41 A;  2AXT Z;  1YHQ V;  3MTN A;  2F1M A;  4NB5 A;  4ICG A;  3WFV A;  1GM7 A;  3B40 A;  2FML A;  2D3O W;  2D2C B;  3D3Q A;  4MI7 A;  4PDR A;  4D8I A;  5IYZ B;  2DCD A;  2BTW A;  1ZTE A;  4ZUX U;  2YEV A;  3QO5 A;  3TCU A;  2Q68 A;  4O4H A;  2IJH A;  1MHW A;  1RPR A;  4DW1 A;  1STF E;  1OJH A;  2DE0 X;  2CB5 A;  2A79 B;  3ZHR A;  2DQ0 A;  1CEZ A;  1YF2 A;  3JYC A;  2FRA A;  4JAA A;  4OW0 A;  1JVM A;  2Y69 B;  1QR8 A;  1ZAU A;  4OVZ A;  2VRZ A;  5KAF Z;  4DR4 O;  3HKE A;  3ABL B;  4JI5 O;  4JYA O;  1Q6K A;  2EIL C;  4DV1 O;  3BY4 A;  4MVU A;  4DK0 A;  1MEM A;  4IYI A;  2FL4 A;  1X4T A;  4CH6 A;  3CXH F;  1H2L A;  4O4L B;  3ZMS A;  4JZG A;  5EBM C;  3F5T A;  1J5E B;  4QPK A;  2EIJ C;  3HR0 A;  2A0L A;  1EN5 A;  1SQB H;  3LDD A;  1WP8 A;  3JCU Z;  3L73 H;  1W2B U;  5LBQ A; 
#chains in the Genus database with same CATH homology
 1A32 A;  4DUZ O;  4X62 O;  4ZTB A;  4B3S O;  4JI0 O;  4LF7 O;  4M0W A;  4BOQ A;  4B3T O;  4LF9 O;  2ZKO A;  1DK1 A;  3OQC A;  2UUB O;  4X64 O;  3M8A A;  4WUR A;  4MM3 B;  3IFU A;  4DV2 O;  3MTV A;  4HXD B;  2VQF O;  2UUA O;  4BOS A;  3J81 N;  4DV6 O;  1HNZ O;  3ZNH A;  3J7A U;  3TRK A;  5BR8 O;  1XMQ O;  4JI4 O;  4YHH O;  1XNQ O;  2Z84 A;  2UU9 O;  3W30 A;  2HWK A;  2JTC A;  2J7Q A;  3PHW A;  2DOS A;  1N34 O;  5KO3 A;  5LMU O;  4LFC O;  5EZS A;  1AB3 A;  3BB7 A;  2AGA A;  3BBA A;  3R66 A;  4DR1 O;  4LFA O;  1AIL A;  4PT5 A;  4RF0 A;  3MP2 A;  1N33 O;  4JI8 O;  4JI3 O;  2BTW B;  4JI1 O;  4A5U B;  5IWA O;  4OPH A;  4LF6 O;  4LF4 O;  2HHH O;  1R6T A;  5A2Q N;  3PHX A;  2FE8 A;  3T1H O;  1IBM O;  2BU3 A;  4NXN O;  2J7Q C;  1R1B A;  5H5N A;  4OPA A;  1IBL O;  4LF8 O;  4RKX A;  4JI2 O;  2F4V O;  3RNV A;  1IBK O;  1UKF A;  1XNR O;  4DV4 O;  4MI7 A;  4D8I A;  3PSE A;  3PHU A;  4OVZ B;  3SDL A;  4AQY O;  1X59 A;  2BTW A;  4A5U A;  4YY3 O;  4GKJ O;  5BXZ A;  3O65 A;  4B3R O;  5JZE A;  2DJV A;  4X65 O;  4RF1 A;  1N36 O;  2VQE O;  1KUQ A;  4REZ A;  4DV5 O;  1DKI A;  1XMO O;  1FKA O;  2JRI A;  3MJ5 A;  4IP3 A;  4DV7 O;  2UXC O;  4GUA A;  1FJG O;  1F7Y A;  2E5L O;  2UXD O;  4B3M O;  4OW0 A;  5IT9 N;  3OTO O;  4OVZ A;  4LFB O;  2FKX A;  1I94 O;  2UUC O;  4LF5 O;  4DR4 O;  4DR7 O;  1FYJ A;  4OX9 O;  4KHP O;  4P16 A;  3RT3 C;  4JI5 O;  4JYA O;  5E6J A;  4DR6 O;  1XEQ A;  4DV1 O;  5FLX N;  4NXM O;  3BY4 A;  4XZX A;  3JAM N;  2LW7 A;  2UZJ A;  1PVJ A;  2UXB O;  5LL6 Y;  2Z0A A;  4DV3 O;  3TMP A;  4DUY O;  2N74 A;  4JI6 O;  3PRP A;  1NS1 A;  4IUM A;  3PT2 A;  3B21 A;  4D8B A;  1D2D A;  3C0R A;  5LMN O;  3F5T A;  4DR5 O;  4K0K O;  1YZB A;  4DR3 O;  4JV5 O;  3T1Y O;  5BY1 A;  1HNX O;  1G1X B;  3W31 A;  1HNW O;  4BOU A;  4BOP A;  4D8E A;  4DR2 O;  2ZM6 O;  4JI7 O;  1J5E O;  3J80 N;  3PRM A;  1HR0 O;  4RNA A;  1N32 O;  4R3D A;  5EZQ A;  4GKK O;  4BOZ A;  3E9S A;  4X66 O;  4DV0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...