1YZBA

Solution structure of the josephin domain of ataxin-3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Machado-Joseph disease protein 1
publication title The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 48
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1yzbA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1yzbA01
3OTOO 2FKXA 3JAMN 4JV5O 2VQEO 4OX9O 4B3RO 1HNXO 2UXBO 1YZBA 1XNQO 5BR8O 2UUCO 2F4VO 1AILA 4KHPO 4DV6O 2ZKOA 2DOSA 1X59A 1NS1A 2UXDO 5IT9N 5H5NA 4JI2O 3R66A 2HHHO 2UUBO 1N33O 1DK1A 4AQYO 1IBMO 4JI6O 4JI7O 4JI5O 5A2QN 4DR4O 4B3SO 4DR5O 1N34O 1XMQO 4GKJO 4K0KO 1G1XB 1R6TA 5LMUO 4GKKO 4NXMO 2AGAA 5IWAO 4DV3O 4JI1O 3J7AU 3O65A 4DR3O 4YHHO 1IBLO 2E5LO 2N74A 1I94O 1AB3A 1HNZO 1F7YA 4X66O 2JRIA 4DV4O 4LFAO 4JI0O 4DV0O 4LF9O 4JI8O 2UU9O 1HNWO 4JI3O 4DV5O 4DR7O 3T1HO 4X62O 2UXCO 4OPHA 1XEQA 3F5TA 5BXZA 1R1BA 4LF8O 4DUZO 1A32A 5FLXN 3M8AA 4DR2O 1D2DA 4LFBO 2ZM6O 1FJGO 1N36O 3SDLA 2VQFO 1FYJA 1FKAO 1KUQA 1IBKO 4A5UB 4OPAA 4NXNO 2UUAO 4YY3O 4LF4O 4DV7O 1HR0O 5LMNO 1N32O 3T1YO 5BY1A 1XMOO 3RT3C 5LL6Y 2LW7A 4X64O 4DV1O 4DR1O 4DV2O 4LF5O 1J5EO 4B3TO 4LFCO 4LF6O 2Z0AA 4X65O 3J80N 1XNRO 4LF7O 4JYAO 4DUYO 3J81N 4JI4O 4B3MO 4DR6O 2DJVA
chains in the Genus database with same CATH superfamily
4LWSA 3FB6C 3T1CA 2R6NA 2WLIA 2VQEO 4AQYB 4TQDA 3CRAA 3O0UA 2UUCO 3G71V 1OZ0A 1GN6A 1X59A 2AHYA 2UXDO 1NTKH 5TISZ 1MHWA 2BOBC 2L6LA 4JI2O 3EXAA 5LOVA 5EZSA 1O9GA 3QTCA 3WB0A 4CC6A 1NPZA 2XASA 3ZJZA 4X89A 1N34O 1K73W 4HAMA 2ZDIA 3B2EE 2YJ2A 4P2ZA 4LP8A 2ZE8A 2QWNB 5EC1C 2XAJA 2XUMA 1K33A 2A9HA 4PADA 1RPOA 5HFLA 2GV9A 1HNZB 2Z3YA 3MAQA 2PADA 1GMGA 3S3WA 4P16A 5KHHA 5LA6B 5LOVB 3CRCA 1TUBA 1RP3B 4DRXA 4UVBA 2ZR2A 3K5LA 3T1HB 2W6JG 4YYSA 1DF4A 4NKGB 1VQLV 3F5WC 3F75A 1VF6C 4ZIBA 4DUZB 2PF4E 2ODMA 2JRIA 1DLBA 1EWMA 3TJTA 2CDYA 1QBZA 1T5EA 3ZBHA 2BTQB 3E8BA 4LBEC 4DRXB 3K5OA 2DQ0A 5BXZA 4LF8O 1QLEC 2ZR3A 1ZSPA 1MIRA 4LFBO 3AG1B 5LBQA 4K8ZA 1PL0A 4PA9A 4YYRA 5L3CA 1AI7A 1M9NA 2Q7HA 4KLBA 1KYOF 3R65A 5EBMC 4J41A 3CJHA 5FPOA 3O9OA 4IHJA 4U3JB 5D5QA 4D7SA 1M6DA 2NN4A 2PGGA 1XNQB 4KHPB 2EINC 3OMNB 1N4CA 4X65O 1V55C 4LF7O 4XDKA 3J81N 2WLHA 3A0RA 2AXTZ 3KSEA 2HEPA 4LH7A 4PA6A 2UXXA 2JQFR 1MG1A 4TOIA 2XOKG 5DECA 3CSXA 1K7DA 3MHSC 2HG5C 2RQ6A 4IHJB 3K9SA 4H0LB 2IJIA 3B8MA 1GMYA 4RKXA 2EIKB 4GKKB 4QPJA 1CB5A 1NJIW 1OHHG 4ZHQA 3SPJA 2E74B 3O1GA 3T4DA 4B7KA 4MVMA 4EFBA 2DC7A 3E8GA 4U7NA 4GYCB 2LGWA 2ZIOA 1ZIVA 4LF9B 1Y76A 1OCOB 3EVKA 4ZHQB 4I9WA 4JI3B 4XBFA 5EBLC 1YI2V 4H13B 1F7YA 4BW9A 4DR2B 1MS6A 3S3QA 3M7MX 1N36B 3BHPA 5EZYA 1PPDA 1CQDA 2V4DA 1Y76B 4X20B 4FM2A 1NI8A 4GZRB 2IU0A 2PI5A 1PNMA 2ZM6O 1WP7A 2QWRB 4D8EA 4DV1B 2B1IA 3B77A 3HKDB 2OCHA 1J5EB 1IBKO 3CRMA 1KP2A 4IYHA 5EZYB 5B1AC 2PYJA 4CS4A 1SERA 2ZM6B 2PI4A 4GUNA 4JYAB 3W7WA 1MEMA 1QMYA 3W30A 1CVZA 3OTOB 2JVDA 3CPWU 1THZA 3QO8A 1R3IC 4MW8A 4NB5A 1P4RA 4FM1A 3K5MA 4N8WA 1QR8A 4JYCA 2BDLA 3OUSA 3QSDA 3BWKA 4DR6O 3TXQA 3ZRWB 5AG2A 4EB6B 4JI5B 4QRVA 5F02A 3CRRA 1ITOA 2DYRC 3OQCA 4YIOA 4NTWA 2ITDC 3PRPA 2Q6AA 3CCSV 2A06H 4ABMA 2UUBO 4RO2A 2X7RB 1VQ9V 1AU0A 4JI6O 4DR4O 3JAWA 2HFEC 2HKOA 5KUMA 1SQVH 5ITZA 1QXPA 1SRYA 4DR4B 1AI6A 2D3OW 4X66B 2DJGB 3AG2C 2F23A 1CSBB 2F66C 2E75B 3FYEB 3CC7V 1BS3A 2MW2B 4U7OA 3RVZA 2B5UA 4BR6A 2BOCC 2HJFC 5B3SB 1OCRB 3IEJA 3OGCC 3W7XA 2AUXA 3DC6A 1M1KW 2CTWA 4P6EA 2C0YA 3ZHRA 5E79Z 3AI8A 5ITZB 3ABUA 5A9GA 3H1IH 2EIMB 1SNKA 4LFAO 3ZRSA 4I5SA 1AVMA 3USVA 1AJPA 1D5AA 1NQTA 5EK0A 4TV9A 4BOQA 1OCZC 2E3CA 1A32A 4MVQA 3T1YB 1XMOB 1L0LH 1XREA 1YALA 1NR7A 2Y69B 4X64B 4DR1B 2QKSA 3TETA 1KUQA 2JGDA 1PXVA 1OV9A 2Y4UA 5LMNO 4JI4B 4TV9B 3E89A 3D3IA 4JPRA 5LL6Y 5JWPA 4LF5O 1XDCA 1NVPD 1U9QX 3K58A 5LMNB 1H2SB 3UCSC 5L3EA 3I06A 2ZXWC 3FD9A 4FIPA 3PDFA 2CE4A 2HP8A 1HW7A 3TGUH 3KZIZ 2Q7EA 3KCXA 5LP6A 3ETDA 2ZCEA 3SPHA 1ATKA 4MTOA 1DF5A 3SYOA 2OYQA 1Q6KA 1FXKA 3MHHC 4K7CA 4X1KA 1YZBA 1AILA 4PDLA 3ZRVA 4UV9A 2BTOA 5GTIZ 3L75H 1XL6A 2DOSA 1YTFB 1K5SA 2HH5A 3IFUA 3OE7G 3CWBH 3KW9A 1AIMA 3QJ3A 3A2FA 3ZHVA 3LNNA 3Q4HB 4CS3A 3F5VA 3AG7A 1Q7YW 3W7SA 4LNUB 4GX0A 1FXKB 5B1NA 1VF7A 2FYEA 4MSXA 5KAIZ 4X1KB 1XMQO 1X9YA 4RF0A 1PE6A 1FXHA 3U0ZA 5JZEA 4YHHB 5EF4A 4PA7A 1Y66A 3RNVA 2AGAA 3K0GA 4JI1O 3HWNA 5CA3A 1PIPA 1SKVA 3HHAA 1SQFA 3HHIA 3O65A 4BW5A 3QNEA 2R9RB 2AYNA 3DGEA 1KXRA 1QR9A 3CC2V 2QGNA 1S77D 2LO1A 1GTOA 4I07A 1W2BU 2WA3A 4PJ0Z 3ASNC 5FL7G 4HXDB 1BHAA 3P5XA 4X62O 4R7CA 3CP1A 4NXNB 3I5DA 3H8BA 4UVAA 4LF4B 4BS6A 1HR0B 4UCSA 1G6UA 2X6AA 5IJ0A 1CEZA 4O4HA 2G8EA 3P32A 3S3XA 1FFTB 1AI5A 3CX5F 1YIJV 4WFFA 5HFMA 1YK7A 2CK3G 3JATA 4G27B 2UUAO 3IOQA 2AVWA 3B79A 3PHXA 4QRGA 1M56C 3TNXA 1JVMA 4HBNA 4PA4A 1KFUL 1PPPA 2EILC 4X1YA 4QE7A 3T2MA 2Y4TA 1PCIA 1B3QA 1V54B 1H8HG 3RGBA 4R3DA 3BY4A 5IJ0B 2LQTA 2UUAB 3E9SA 4B3RB 2VHFA 1WA8A 3JSLA 3IAYA 3E2EA 4XUIA 3K9MA 1NKDA 2R70A 1KC8W 5KMGA 3F7VC 4HWYA 1XNRO 3D36C 4J9ZB 4RAIA 3FB8C 4IYIA 2G7YA 2EZPA 2XT9A 2IU3A 2ARHA 1MOFA 4B3SB 1M57B 2CGOA 1WA8B 4D8IA 3K3WA 3PSEA 2LW1A 2QDOA 5KMGB 1VQKV 4X6IA 1BCCH 5CB4B 4W5CA 3HD3A 2HVJC 3VBBA 4NXMB 3IV2A 4BWAA 1S4VA 1U5IA 4YV8A 4H33A 1PNLA 4JAUA 2Y0PA 4DR3B 3VQVA 3SPCA 4X9QA 3RYFB 1F23A 3GVMA 4DV4B 3ZMZA 3JAKA 3RN4A 2JIZG 1CS8A 3CCRV 1KBHA 1WP8A 1S5LZ 2JK5C 2ZD9A 2DCCA 2YIDA 3OISA 2RN9A 1SQGA 4UVCA 1YJNV 3ZN1A 3K03A 4D6TH 3JD2A 2PY5A 2N74A 3G80A 4GX1A 3NR7A 3K5NA 2BDZA 4DV0O 3FKSG 4JI8O 4UB6Z 3H6SA 3IHPA 2Y6EA 1SA0B 3JAKB 4AI8A 4R6ZA 5CBFA 4OVZA 3AK1A 3H7DA 3UQ8A 1SF9A 1K34A 4G28B 2VRZA 4ZBMA 2OTJV 5IE9A 1N0JA 2VQFO 1SZXA 2WSSG 3OR6C 2XU1A 1U9WA 1GM8A 3JYCA 3ZMSA 4YY3O 4Q8HA 4OVZB 5J2UA 3JALA 2HXZA 5EYPB 4DV2O 3BB7A 2BU3A 4B3TO 3ABLC 2F4VB 4N79A 1PM9A 4K8XA 4DV6B 2LP7A 3ETGA 4Q8GA 5C8YA 1GM7A 1AYUA 2PTMA 4QNHB 3PN1A 5J2UB 3ABKB 5BMVA 1Y74A 2WLNA 2PUSA 3IMAA 1WB8A 1I5XA 1SC5B 4FJCA 4I55A 3H89A 3PHWA 2L35A 3V6CA 1F2BA 3UT5B 5CA1A 4M0WA 2R9IA 2PNSA 2ZNIA 3P3PA 4AQYO 2VHSA 5IY5B 2IW5A 2DZYA 1VJVA 2KKWA 5BMVB 1NH2B 3SYPA 1Y74B 3CHXA 1MSDA 4UV8A 1SQPH 4K3AA 2CTPA 1KHPA 2FT2A 1QU7A 3T4ZA 1Y67A 1ZCMA 2HJDA 4I55B 2HLDG 3OT7A 1CPYA 1JCHA 1GAXA 4I4TA 3ZHTA 4JI0B 3P5WA 1K4CC 4KUMA 2XU3A 3J7AU 5B1BC 5JVDA 1WB7A 5LYJA 1P7BA 2WLLB 1QNMA 4TUYA 2IH1C 1S3JA 4LWSB 4UCUA 1Z5WA 2DZZA 3AK3A 4WA6A 1HNZO 2WLIB 3CMEV 3DC5A 5IYZA 1FJGB 2YS8A 1HNWO 1XUQA 4XDJA 5JJNB 1SQBH 3T1HO 4PV1B 3LDDA 4RWUA 1ME3A 4JZ2A 4J7JA 1BY8A 5JVDB 4ICGA 4DUZO 3N2GA 1HNWB 5L3DA 4FVMA 1Q6IA 3B8NA 2UZJA 3L71H 1VF6A 1XILA 3ZMUA 5IYZB 3G67A 2HVKC 3BAAA 2R72A 4X88A 1DKIA 1GLOA 2JJ1G 1BQ0A 5JQGA 1NH2D 2P7TC 4DUYB 4W4LA 2YXLA 1F51A 4B3MB 4GKJB 1Q6UA 4J11A 2QTSA 3N2GB 4X6JA 1MA1A 1V9PA 2JJ2G 1TUBB 4AHCA 2DYSC 3BFRA 1VMGA 2O6XA 3J80N 3SGIA 1QDQA 2BE3A 3BRCA 1ICFA 1VQ7V 4MVOA 2ILMA 4JYYA 1R3JC 3ASOC 1RM1B 2E02A 3ZX6A 5CA0A 3STLC 1XNQO 1VSNA 1DGSA 1YVWA 2VWKA 1BT8A 1UPGA 4KHPO 5H6RA 4I50A 5LHGA 3DF0A 1QLEB 2P86A 2QKAA 3K59A 2HHHO 4LCUC 1US6A 4L87A 1P49A 1YEWA 4DR5O 1PP9H 2OULA 1NQCA 2JTCA 3SYQA 2Q73A 2HHHB 2DMXA 4I50B 5LHIA 3CJHB 4P6GA 3K57A 2K1EA 4GKKO 4J9YB 2GTSA 1I94B 3MHSA 4DR5B 4KP4A 1V55B 4J7KA 1MDWA 4UFZA 4TT3G 2V7QG 2ZNJA 5H6QA 2P90A 3ZMTA 1AB3A 3ZIAG 3TXSA 3RYIA 4LF9O 1XHXA 3WFVA 4JI3O 3CYOA 3SYAA 2AHZA 1EBOA 3ETQA 3LUTB 1MNGA 4YIPA 1VQMV 2H3OA 4OPHA 4AXLA 1WPBA 1R1BA 3SJCC 3U8EA 4PP2E 1OCOC 4DR2O 1D2DA 1KU9A 1Q86W 1N36O 4RQFA 5F2VO 1AP5A 2WWWA 3CCEV 1VP7A 4LF6B 1Q82W 2G38A 4PT5A 5L3BA 5KX5A 1NZ6A 2C2AA 1BGOA 3IFXA 4DV1O 3ABMC 1J5EO 4OX9B 4F6RA 4CH3A 5EIBC 4RQEA 5EZQA 2W0FC 4D8BA 4FMTA 3QO7A 1K9MW 4WURA 4JYAO 2Q9LA 3F7YC 4RUFA 1JFFA 5KX5B 5DM6V 3OTOO 3JAMN 2ARYA 3MDSA 1SQQH 4YXWG 1L1FA 3ZMVA 8PCHA 4LC1A 1MABG 1QVFU 4E2LA 2B1MA 3SPGA 4F6RB 5GTHZ 5EGWA 2QKCA 1YSCA 4QIWF 4CDFB 3D8CA 3B09A 3HPLC 4IL6Z 4K0KB 1YT7A 3KCYA 2QE7G 3A0BZ 4JAAA 3K06A 1JFFB 3RWRD 4WFAV 2RMKB 2XAHA 3BEHA 2IJKA 4PI2A 5B1AB 4JI5O 1I08A 3AG4C 3OTFA 4ZKIA 4N4ZA 3OAAG 2HHNA 3JARA 3X2QC 4J42A 1R6TA 2AW9A 1RSOA 2FTKA 4CDDB 2ZIMA 4ZI7A 2HWKA 3HR0A 3GCBA 1WAZA 2CB5A 3OR7C 1FXVA 2P7UA 2ADPA 3RW0A 2AIMA 1EN4A 4LR3A 2Q0AA 3TK1A 1KKDA 2NQAA 4MZOA 4X66O 2IBZH 1F2AA 3CCUV 4MTGA 1O0EA 2DYRB 1PPOA 4NYKA 1KECA 1SESA 2KG7A 1WJZA 3OM3B 3K8UA 2DQ3A 2UXCO 1NVPB 1ME4A 4MS2A 2JS5A 5CHVA 3N3KA 1MEGA 5DN6G 2RCVA 3HKEA 2ZE5A 1QQCA 1NLJA 2UXCB 5FPWA 3JAWB 3PRMA 1X4TA 4PHZA 5LGNA 1FFXA 2YJCA 1Q8IA 2E76B 4MI7A 3G6BA 1K4DC 2UXNA 3OD4A 3CBJA 5LXTA 3T1YO 4DO2A 3AG2B 3U11A 5BY1A 1N0NA 1XMOO 2GUZA 2JGUA 2Z84A 3ZHUA 2LW7A 4JYBA 3JD3A 2QR4A 4X64O 2EJ7A 1R6KA 4MT8A 2VS0A 1B6QA 4DR1O 3HKEB 4OELA 2UXBB 2F43G 3WU2Z 1OCCC 1AJNA 1FFXB 1R3LC 1XL4A 4FLTA 1CTEA 4FK5A 2GBOA 3JD4A 4FK5C 3LDCA 4JI4O 2WBFX 3H01A 2OIEA 2DJVA 4GCZA 2GSMB 5LXTB 5CBHA 3CS5A 1GN2A 1GKFA 3TMPA 1KFXL 2GUZB 4CH6A 4H37A 3FB7C 1DTOA 1OCZB 1TVKA 3K08A 3BABA 4FFKA 1HWYA 3D6SA 1AR1B 3JD0A 1GN4A 2FB5A 2NNUA 3PJSK 2QM8A 1L8DA 5EBWC 4N21A 3TCUA 2JGDB 5KA5A 4MVRA 1FD9A 3W7UA 2FRQA 4UXNA 1K3EA 1IBLB 1NU1H 2WAMA 1TVKB 3BC3A 3MHHA 1TL9A 1D5NA 1BGYH 1PPNA 1Q5OA 5KO3A 2YICA 2Y0IA 4GT1A 4BQVA 5JH7A 3BPMA 2ACTA 2DCAA 2ZXWB 2RDCA 4O4LA 1SS3A 1R6NA 2J7QC 3SPIA 5LP6B 1AP6A 4YHHO 3RVXA 1XHZA 4Q6GA 4WF9V 1PVJA 2AZ0A 3QT4A 4O4IA 2YDEA 2IM9A 4QE9A 1EN5A 5JH7B 1U9VA 4DR7O 2OP3A 4O4LB 3EHBB 3KWBX 4FZ1A 4PP1A 1UJWB 2Q7GA 4DV7B 4B08A 4G54A 2ADQB 1M5IA 3N27A 4E4EA 4DR7B 3A8TA 4IP3A 1WNSA 2FL4A 4LH6A 4O4IB 2PZSA 1PV0A 2W6IG 4NXNO 4XR7A 2N04A 4LF4O 4YVAA 1HR0O 4UCOA 1NBMG 4EKWA 3H1LH 4PDRA 2RNBA 1L0NH 2F7DA 5KHKA 3MP2A 4UUJC 4JV5B 3AG3B 1K92A 3OGIB 2QSAA 2D2CB 1W0JG 3NHEA 1EZJA 4B7EA 3H1KH 2DCDA 2HD5A 2JDIG 2PREA 3CCMV 2IPPB 2XTAA 3ASNB 4MM3B 3WXGA 3U10A 2QA4V 4B3RO 2GTAA 1B04A 1PL4A 3OEHG 4R8CA 3CH2X 1YITV 3G4SV 1U96A 4O4HB 7PCKA 2QEXV 1R73A 1N8RW 5KAFZ 3WG7C 3JATB 1MZFA 3D36A 3ABTA 5A2QN 4B3SO 1M56B 3ZEDA 3BPZA 3MTVA 4X1YB 1YJ9V 2E5LB 1G1XB 1TGOA 4WBNA 4C7UA 5JCOC 4FM0A 4NXMO 3N4CA 5KA6A 1FPOA 5IWAO 2CAZC 4QGPA 3M99A 2LGQA 4CH5A 4DV5B 2EIJC 2Q67A 4DR3O 3ML0A 2YUAA 3CEIA 1S0VA 5KHJA 1VIBA 4OW0A 4MW3A 5IWAB 1M90W 2E01A 5KUKA 4MSWC 4EFEA 1YF2A 4WBNB 2E03A 3I55V 4DV4O 1ENVA 2GHYA 1E79G 1RPRA 4HZ3A 2R9CA 1A6RA 1VQ6V 2YSUB 3M99B 2DC9A 2AS8A 1JJOA 4PDVA 3APOA 3CCJV 5LHHA 1B06A 4JTDB 3SDLA 2Q5ZA 1FKAO 2CH7A 3H1JH 3UKMA 5GW7A 4LFCB 4NVPA 2YEVA 5B5EZ 5CVMA 4PI3A 2E00A 4Q20A 2NLJC 1IZ3A 3HB3B 4U3FH 3UO3A 3L9DA 4WFHA 5FNVA 2XU5A 1DF0A 1HNXB 5BR8B 5IDJA 5J2TA 2CH7B 1AR5A 4RUEA 3N2KA 3CE2A 2G6DA 2YEVB 3ICXA 1WLEA 4ASUG 5D5PA 1EWLA 1K97A 5H9CA 2NQDB 2P5OA 1N33B 3P5UA 1NT2B 5C93A 4JI7B 2ATKC 3FB5C 2F4VO 5JA7A 3RYHA 2FYUH 2OT5A 3OEEG 4DV6O 5J2TB 3W31A 3B4SA 5IT9N 5H5NA 2Q69A 1EM1A 3RVVA 4OEMA 4UCTA 1IWDA 2NQGA 2KSDA 1RFYA 4P9OA 1S72V 4BS5A 3E35A 2YIAA 2OWOA 1YXBA 3CRQA 2JEUA 3PW3A 2DCBA 1S5HC 2W0XA 2OCCC 3C90A 3RYHB 4FLYA 2GFOA 3JALB 4YJ2A 4QJFB 4IT5A 1W0KG 3MJ5A 3ABLB 3WXEA 2EULA 4DV3O 2IJHA 2XAFA 3OMIB 1FS0G 5C8YB 2RJZA 1XI1A 3MD0A 4I9QA 2QM4A 1M4UA 1E1QG 3KFQA 1ZUQA 2R9AA 3P5VA 4DV3B 1TUEB 1GECE 4JI0O 2H8PC 4WFBV 4XDLA 2YC0A 2M6YA 4X1IA 4OXSA 1UKFA 1IVSA 5B1OA 3QF7A 2HR3A 2ZT9B 5CA1B 2P0RA 4PI0A 4W5BA 1TA8A 3APQA 4MZSA 1FJGO 4AXMA 2A0LA 3CMAV 2JS3A 4BIZA 4OPAA 1ROPA 3KX1A 4X1IB 1MMMA 1JX9A 4I4TB 5LGUA 3JCUZ 5PADA 5L3FA 2K9PA 2ZE7A 5B1BB 2YI9A 5K1XA 2R9FA 2VQEB 2FTDA 3H1HH 5LYJB 2UUCB 4TUYB 5LA6A 1YHQV 1H2MA 5CHTA 1URFA 4DUYO 2UXDB 4B3MO 4GKJO 4JI2B 1QCEA 1EFRG 2ZDIC 5E6JA 4JZGA 2Q0OC 1POPA 4ZOLA 2ITCC 2QWQB 2V1DA 3BVOA 1N34B 3P3NA 4I7ZB 3ETEA 3ZS8C 2BTQA 1BP4A 2X0LA 2YXHA 2FO5A 1S5JA 1U97A 5L3GA 1VF5B 4AILC 1KKCA 3TRKA 2JEXA 4MVSA 2Q68A 1Z5VA 2QTOA 3AG1C 5JQGB 4KXRA 1VQOV 4JASA 4ZOLB 1GM9A 2QWPB 4BPVA 1LR1A 2F1MA 1RM1C 3GB7C 2R9OA 3ZN0A 1XBLA 4DMXA 2DYSB 2IH3C 1THEA 5CBGA 2IJJA 3FFQA 3PNRA 4U3JA 3AK2A 1ORQC 4CZWA 2AYOA 4BOZA 4LF8B 1I5YA 3ASOB 1KHQA 2GHUA 1I94O 1W59A 3K79A 5CA0B 4LFBB 2ZINA 3AEIA 2ZE6A 2FE8A 4UCRA 1EWPA 2F93B 2A79B 4CBCA 4DW0A 1ZAUA 3KG2A 3D3QA 4O2BA 1XEQA 2CUGA 2YJ9A 3LNMB 4F6EA 2EINB 2JQGR 2YXYA 3M8AA 1AU2A 4WFEA 4KL1A 2NR5A 2EIKC 1FYJA 5J94A 1NR1A 5GONA 3DSQA 4WFGA 5BZBA 1VQ4V 1YJWV 2H7JA 1Q90D 4X65B 4O2BB 4LF7B 2X6CA 2B1GA 1YDXA 1Y08A 2LJ2A 3K9AA 3C3SA 3BPFA 4FLVA 1IDSA 2WPDG 3DTUB 4X8AA 3MTNA 2Y5BA 3OFNG 3JSNA 1Q6HA 4LF6O 3GWKC 5GONB 4DXWA 4Z2WA 5LGTA 3IGAC 3K24A 1PD3A 3RYIB 3IC9A 1TU6A 2FKXA 3LSQA 2OTLV 1Q3EA 4OX9O 1DEUA 3S3RA 3B40A 2AU1A 2Z5UA 3UM7A 2ZKOA 3L72H 1MZEA 4X20A 3ERVA 1JQ0A 2CTRA 3PHUA 4O4JA 1BSMA 3PT2A 2P06A 2WLJA 1DK1A 1CJLA 3LSSA 1IBMO 1QOLA 3IUTA 1YVBA 3HKDA 4JAVA 2P67A 4JTAB 4K0KO 2F95B 4PD4F 1CXZB 1IBMB 3VOUA 3ABMB 4DMYA 4YYWA 2QWOB 4R50A 4O4JB 3LFYA 1VQ5V 4UCVA 1HP8A 3ZCCA 4FFBA 1E1RG 4YYVA 2GDSA 3ZRWA 1P84F 2UU9O 3C9EA 4FPPA 2DN9A 4FZ0A 1IBKB 3BA8A 4EB6A 1Y4HA 3WB2A 3SJBC 1IXMA 4J7ZA 5E1AC 2UU9B 3VQYA 4W4UA 1JOYA 4QBBA 5K16A 4JGSA 4FFBB 1STFE 3AG4B 2OZ2A 2OIGA 2YJ8A 1AJQA 4L8JA 5JJEB 3JARB 1VARA 3KKUA 1PKXA 3X2QB 1EWOA 3OVXA 4EEQA 1S76D 1SZTA 3E22A 2EX3A 1RSOB 3E8HA 4DR6B 3RT3C 4ZI7B 2DC8A 4O2AA 4MTFA 1FH0A 4IIJA 5EIBD 2DE0X 3E86A 5B3SC 1OCRC 3E22B 2FUDA 2ATOA 1F4NA 3CCVV 1BMFG 4K35A 2UUBB 4MVZA 2KG7B 4JI6B 1AU4A 2UXBO 2EIMC 2AZ2A 4O2AB 1TLOA 4IIJB 1YCIA 5CVNB 1KQSU 1H2GA 4BOSA 3SR2C 2PYLA 1H38A 2CGNA 2Y69C 1P7GA 2NQIA 1JMKC 1J95A 1BL8A 3VQXA 3H9VA 2ETNA 5LMUO 2LFRA 4ZTBA 1NTZH 4NTXA 2CTQA 4LFAB 3OW2U 1NL6A 1OCCB 4PA3A 5LMUB 3FYIB 1IBLO 2QJ1A 5CMUA 4TQFA 2XNDG 4GX5A 3HKBA 1VQPV 1AI4A 4RF1A 3VQWA 3QG5A 3WB1A 1WN7A 5IJ9A 1QVGU 4P9PA 1XKGA 1JA8A 5JH3A 2KQXA 2M7WA 2EZOA 2J7QA 4I05A 5FLXN 5EC2C 4FIPC 2ZQMA 1SETA 3FX7A 3QO5A 3HKBB 4HYOA 4LF5B 2EJRA 3BA9A 5LP6C 3Q4HA 4QPKA 2DWEC 4LNUA 4BOUA 1KMIZ 1FXKC 5IJ9B 3BCCH 2FRAA 1H2NA 1HDJA 2G8JA 4DV7O 5JJJB 1BE3H 3BOWA 2EBOA 2QM7A 2FMLA 3RBZA 3IC7A 2Q8VA 4GX2A 1BQZA 3I56V 2CIOA 4J80A 3CBKA 1MSWD 4OGQB 3GWOA 5CVOB 1ZWIC 4PELA 4D7TA 1Q43A 4YJ3A 1CPJA 2PBHA 5IYDO 4JV5O 3RFRA 4TSFG 4IUMA 2WLKA 4GUAA 1XMQB 1F2CA 4CH4A 1XQ8A 1CP9A 2BCCH 4J10A 2WA4A 1PADA 2R9MA 3AG3C 3R66A 1VQNV 4GLXA 4F4LA 1Y6XA 1JJ2U 4YJ3B 4JI1B 1XOUA 3JASA 4BSQA 1Z2GA 1QLNA 3THOA 1GO3F 4CC5A 1G4YB 3SYCA 3NXSA 2YIBA 4REZA 3ZNHA 1LNQA 3CC4V 1M93A 1GK9A 1SP4B 3EFFK 1V54C 3RVWA 1YTFD 4RY2A 4MTXA 4N23A 3CXCU 3BBAA 4X62B 1HUCB 4FLUA 4DK0A 3JASB 1GCBA 2E5LO 3LDEA 4W4KA 2LFSA 2IBIA 5J9PC 1WPXA 1K8AW 1OJHA 2P4KA 3CCQV 2DJFB 3E83A 4PDMA 3ZRXA 2EILB 4A5UA 4KFMA 3I3TA 4DV5O 1UFIA 4FLWA 3V6EA 1K5QA 4G2KA 1H8EG 5JCOA 3QVNA 3CD6V 1IXBA 4IGGA 2B1NA 2XHBA 1EZVH 1M57C 1AROP 3CH3X 3WG7B 4DYLA 3UO2A 5CB4A 4UB8Z 4I0XA 3DXRA 1SQXH 4A5UB 1AYWA 3ZHSA 5KHIA 5KLVH 4YYUA 6PADA 1JPXA 1ZLZA 3CCLV 3L74H 1PPJH 3SJAC 1XNRB 2BTWA 3OF9A 4JF3A 4CZZA 4CDCB 3OVZA 1NB3A 2XU4A 3OF8A 5FPRA 3JD1A 5KHGA 1EF7A 2EIJB 2XAGA 3RYFA 4FLXA 4YYQA 1YK8A 4I0XB 2A3QA 4LFCO 3DXRB 1AR4A 4TV8A 1QHTA 3LXSA 4BIOA 4I04A 3K04A 3W7TA 2R9NA 3E8FA 1ZX3A 1F4MA 3BCNA 2KB1A 5CN0A 2BTWB 1NTMH 4DW1A 1CV8A 3H8CA 3RVYA 1Y4MA 3BY6A 3MORA 3N3GA 2DW4A 3RYCA 1HNXO 5BR8O 3B21A 1COWG 3STZC 2YIBD 2X6BA 4HNAA 2F1GA 1SA0A 3P30A 5IYCO 2H94A 4XZXA 1NS1A 4BOPA 4TV8B 2P6JA 1O9HA 1PNKA 2Y48A 4MVUA 3ZUAA 3IJ4A 1R3KC 1AECA 1F29A 3CXHF 1I0HA 1ZL8A 4RNAA 3FAVA 1N33O 1ZTEA 4Z1MG 4JI7O 4X6HA 2P4VA 4CS2A 3OUFA 5A24A 3RYCB 1KD1W 1NB5A 1FAFA 2MK3A 3C3TA 4HNAB 3KWZA 3HKCA 1LUWA 2DC6A 1VEWA 2DWDC 4P30A 5FNVB 1ZL8B 1K3BB 4DV0B 4JI8B 1EN6A 3FAVB 5EYPA 5K1PA 3N2KB 4BAYA 4Z1VA 4CDEB 1GH6A 1IURA 1BQIA 1Q81W 4BIUA 3K0DA 3A0HZ 4NTYA 3HKCB 1G8MA 5IYBO 5DEDA 2VQFB 2BSKA 2A7WA 1I7FA 4QRXA 3KKYA 4TWKA 3ABKC 3OMAB 1BZKA 1JQPA 4ZUXU 2WLMA 1U9XA 4QH6A 2YI8A 3LSUA 3F5TA 4NR1A 4YY3B 4FLZA 2YJBA 1H2KA 4JTCB 5B66Z 4DK1A 3UT5A 1AYVA 4DV2B 5H2FZ 3ZHQA 3G6EV 3PBHA 1GN3A 4B3TB 2OCCB 1IX9A 2BSKB 2AUZA 1KP3A 2N05A 5IY5C 9PAPA 4YJ2B 1N32O 2FQ9A 3L73H 1LUVA 1VQ8V 1AU3A 4WCEV 4H44B 4FJCC 3C0RA 1TAEA 3L70H 1KB9F 1JR9A 2P22C 1N32B 2O57A 3E1ZB 1H2LA 3SJQC 2Z0AA 3WXFA 2XAQA 1PBHA 2B9ZA 2Q4PA 1BHBA 2WLLA 1GRJA 3JCZA 2VWJA 3CB2A
chains in the Genus database with same CATH topology
3OTOO 2FKXA 3JAMN 4JV5O 5E6JA 3TMPA 2VQEO 4MM3B 4OX9O 4B3RO 1HNXO 2UXBO 1YZBA 1XNQO 5BR8O 2UUCO 2F4VO 1AILA 3B21A 4KHPO 3OQCA 4IUMA 4GUAA 4DV6O 2ZKOA 4D8IA 2DOSA 1X59A 4XZXA 1NS1A 3PSEA 3W31A 4BOPA 2UXDO 3PHWA 3PRPA 5IT9N 5H5NA 3IFUA 4RKXA 3PHUA 4JI2O 4M0WA 4BOSA 4RNAA 3R66A 3PT2A 2HHHO 2UUBO 1N33O 1DK1A 5EZSA 3TRKA 4AQYO 1IBMO 4JI6O 4JI7O 4JI5O 5A2QN 4DR4O 4B3SO 4DR5O 1N34O 1XMQO 4RF0A 4GKJO 2JTCA 3MTVA 5JZEA 4K0KO 1G1XB 1R6TA 5LMUO 4GKKO 4ZTBA 5KO3A 4REZA 3ZNHA 3MJ5A 4NXMO 3RNVA 2AGAA 5IWAO 4DV3O 4JI1O 4P16A 2HWKA 2J7QC 3J7AU 3BBAA 3O65A 4DR3O 4YHHO 1IBLO 2E5LO 4OW0A 4BOZA 2N74A 1I94O 1AB3A 1HNZO 1F7YA 4X66O 2JRIA 1PVJA 4DV4O 4LFAO 4JI0O 4DV0O 4LF9O 4JI8O 4RF1A 4A5UA 2FE8A 2UU9O 1HNWO 4JI3O 4DV5O 4DR7O 4HXDB 3T1HO 4X62O 2UXCO 4OVZA 1UKFA 4OPHA 1XEQA 3F5TA 4BOQA 5BXZA 1R1BA 4LF8O 4DUZO 1A32A 2J7QA 5FLXN 3M8AA 4DR2O 1D2DA 4LFBO 2ZM6O 1FJGO 4D8EA 1N36O 4IP3A 3SDLA 2VQFO 2UZJA 1FYJA 3PRMA 1FKAO 1KUQA 1IBKO 4A5UB 4OPAA 4NXNO 1DKIA 4BOUA 3PHXA 2UUAO 4MI7A 4PT5A 4YY3O 4LF4O 2BTWA 4DV7O 1HR0O 4OVZB 5LMNO 1N32O 3T1YO 5BY1A 1XMOO 2Z84A 3W30A 3RT3C 5LL6Y 2LW7A 4X64O 4DV1O 4DR1O 3C0RA 3MP2A 4DV2O 4LF5O 3BB7A 4R3DA 3BY4A 1J5EO 2BU3A 3E9SA 4B3TO 4LFCO 5EZQA 4LF6O 4D8BA 2Z0AA 4X65O 3J80N 1XNRO 4LF7O 4WURA 4JYAO 4DUYO 3J81N 4JI4O 4B3MO 4DR6O 2DJVA 2BTWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO O;  2FKX A;  3JAM N;  4JV5 O;  2VQE O;  4OX9 O;  4B3R O;  1HNX O;  2UXB O;  1YZB A;  1XNQ O;  5BR8 O;  2UUC O;  2F4V O;  1AIL A;  4KHP O;  4DV6 O;  2ZKO A;  2DOS A;  1X59 A;  1NS1 A;  2UXD O;  5IT9 N;  5H5N A;  4JI2 O;  3R66 A;  2HHH O;  2UUB O;  1N33 O;  1DK1 A;  4AQY O;  1IBM O;  4JI6 O;  4JI7 O;  4JI5 O;  5A2Q N;  4DR4 O;  4B3S O;  4DR5 O;  1N34 O;  1XMQ O;  4GKJ O;  4K0K O;  1G1X B;  1R6T A;  5LMU O;  4GKK O;  4NXM O;  2AGA A;  5IWA O;  4DV3 O;  4JI1 O;  3J7A U;  3O65 A;  4DR3 O;  4YHH O;  1IBL O;  2E5L O;  2N74 A;  1I94 O;  1AB3 A;  1HNZ O;  1F7Y A;  4X66 O;  2JRI A;  4DV4 O;  4LFA O;  4JI0 O;  4DV0 O;  4LF9 O;  4JI8 O;  2UU9 O;  1HNW O;  4JI3 O;  4DV5 O;  4DR7 O;  3T1H O;  4X62 O;  2UXC O;  4OPH A;  1XEQ A;  3F5T A;  5BXZ A;  1R1B A;  4LF8 O;  4DUZ O;  1A32 A;  5FLX N;  3M8A A;  4DR2 O;  1D2D A;  4LFB O;  2ZM6 O;  1FJG O;  1N36 O;  3SDL A;  2VQF O;  1FYJ A;  1FKA O;  1KUQ A;  1IBK O;  4A5U B;  4OPA A;  4NXN O;  2UUA O;  4YY3 O;  4LF4 O;  4DV7 O;  1HR0 O;  5LMN O;  1N32 O;  3T1Y O;  5BY1 A;  1XMO O;  3RT3 C;  5LL6 Y;  2LW7 A;  4X64 O;  4DV1 O;  4DR1 O;  4DV2 O;  4LF5 O;  1J5E O;  4B3T O;  4LFC O;  4LF6 O;  2Z0A A;  4X65 O;  3J80 N;  1XNR O;  4LF7 O;  4JYA O;  4DUY O;  3J81 N;  4JI4 O;  4B3M O;  4DR6 O;  2DJV A; 
#chains in the Genus database with same CATH topology
 4LWS A;  3FB6 C;  3T1C A;  2R6N A;  2WLI A;  2VQE O;  4AQY B;  4TQD A;  3CRA A;  3O0U A;  2UUC O;  3G71 V;  1OZ0 A;  1GN6 A;  1X59 A;  2AHY A;  2UXD O;  1NTK H;  5TIS Z;  1MHW A;  2BOB C;  2L6L A;  4JI2 O;  3EXA A;  5LOV A;  5EZS A;  1O9G A;  3QTC A;  3WB0 A;  4CC6 A;  1NPZ A;  2XAS A;  3ZJZ A;  4X89 A;  1N34 O;  1K73 W;  4HAM A;  2ZDI A;  3B2E E;  2YJ2 A;  4P2Z A;  4LP8 A;  2ZE8 A;  2QWN B;  5EC1 C;  2XAJ A;  2XUM A;  1K33 A;  2A9H A;  4PAD A;  1RPO A;  5HFL A;  2GV9 A;  1HNZ B;  2Z3Y A;  3MAQ A;  2PAD A;  1GMG A;  3S3W A;  4P16 A;  5KHH A;  5LA6 B;  5LOV B;  3CRC A;  1TUB A;  1RP3 B;  4DRX A;  4UVB A;  2ZR2 A;  3K5L A;  3T1H B;  2W6J G;  4YYS A;  1DF4 A;  4NKG B;  1VQL V;  3F5W C;  3F75 A;  1VF6 C;  4ZIB A;  4DUZ B;  2PF4 E;  2ODM A;  2JRI A;  1DLB A;  1EWM A;  3TJT A;  2CDY A;  1QBZ A;  1T5E A;  3ZBH A;  2BTQ B;  3E8B A;  4LBE C;  4DRX B;  3K5O A;  2DQ0 A;  5BXZ A;  4LF8 O;  1QLE C;  2ZR3 A;  1ZSP A;  1MIR A;  4LFB O;  3AG1 B;  5LBQ A;  4K8Z A;  1PL0 A;  4PA9 A;  4YYR A;  5L3C A;  1AI7 A;  1M9N A;  2Q7H A;  4KLB A;  1KYO F;  3R65 A;  5EBM C;  4J41 A;  3CJH A;  5FPO A;  3O9O A;  4IHJ A;  4U3J B;  5D5Q A;  4D7S A;  1M6D A;  2NN4 A;  2PGG A;  1XNQ B;  4KHP B;  2EIN C;  3OMN B;  1N4C A;  4X65 O;  1V55 C;  4LF7 O;  4XDK A;  3J81 N;  2WLH A;  3A0R A;  2AXT Z;  3KSE A;  2HEP A;  4LH7 A;  4PA6 A;  2UXX A;  2JQF R;  1MG1 A;  4TOI A;  2XOK G;  5DEC A;  3CSX A;  1K7D A;  3MHS C;  2HG5 C;  2RQ6 A;  4IHJ B;  3K9S A;  4H0L B;  2IJI A;  3B8M A;  1GMY A;  4RKX A;  2EIK B;  4GKK B;  4QPJ A;  1CB5 A;  1NJI W;  1OHH G;  4ZHQ A;  3SPJ A;  2E74 B;  3O1G A;  3T4D A;  4B7K A;  4MVM A;  4EFB A;  2DC7 A;  3E8G A;  4U7N A;  4GYC B;  2LGW A;  2ZIO A;  1ZIV A;  4LF9 B;  1Y76 A;  1OCO B;  3EVK A;  4ZHQ B;  4I9W A;  4JI3 B;  4XBF A;  5EBL C;  1YI2 V;  4H13 B;  1F7Y A;  4BW9 A;  4DR2 B;  1MS6 A;  3S3Q A;  3M7M X;  1N36 B;  3BHP A;  5EZY A;  1PPD A;  1CQD A;  2V4D A;  1Y76 B;  4X20 B;  4FM2 A;  1NI8 A;  4GZR B;  2IU0 A;  2PI5 A;  1PNM A;  2ZM6 O;  1WP7 A;  2QWR B;  4D8E A;  4DV1 B;  2B1I A;  3B77 A;  3HKD B;  2OCH A;  1J5E B;  1IBK O;  3CRM A;  1KP2 A;  4IYH A;  5EZY B;  5B1A C;  2PYJ A;  4CS4 A;  1SER A;  2ZM6 B;  2PI4 A;  4GUN A;  4JYA B;  3W7W A;  1MEM A;  1QMY A;  3W30 A;  1CVZ A;  3OTO B;  2JVD A;  3CPW U;  1THZ A;  3QO8 A;  1R3I C;  4MW8 A;  4NB5 A;  1P4R A;  4FM1 A;  3K5M A;  4N8W A;  1QR8 A;  4JYC A;  2BDL A;  3OUS A;  3QSD A;  3BWK A;  4DR6 O;  3TXQ A;  3ZRW B;  5AG2 A;  4EB6 B;  4JI5 B;  4QRV A;  5F02 A;  3CRR A;  1ITO A;  2DYR C;  3OQC A;  4YIO A;  4NTW A;  2ITD C;  3PRP A;  2Q6A A;  3CCS V;  2A06 H;  4ABM A;  2UUB O;  4RO2 A;  2X7R B;  1VQ9 V;  1AU0 A;  4JI6 O;  4DR4 O;  3JAW A;  2HFE C;  2HKO A;  5KUM A;  1SQV H;  5ITZ A;  1QXP A;  1SRY A;  4DR4 B;  1AI6 A;  2D3O W;  4X66 B;  2DJG B;  3AG2 C;  2F23 A;  1CSB B;  2F66 C;  2E75 B;  3FYE B;  3CC7 V;  1BS3 A;  2MW2 B;  4U7O A;  3RVZ A;  2B5U A;  4BR6 A;  2BOC C;  2HJF C;  5B3S B;  1OCR B;  3IEJ A;  3OGC C;  3W7X A;  2AUX A;  3DC6 A;  1M1K W;  2CTW A;  4P6E A;  2C0Y A;  3ZHR A;  5E79 Z;  3AI8 A;  5ITZ B;  3ABU A;  5A9G A;  3H1I H;  2EIM B;  1SNK A;  4LFA O;  3ZRS A;  4I5S A;  1AVM A;  3USV A;  1AJP A;  1D5A A;  1NQT A;  5EK0 A;  4TV9 A;  4BOQ A;  1OCZ C;  2E3C A;  1A32 A;  4MVQ A;  3T1Y B;  1XMO B;  1L0L H;  1XRE A;  1YAL A;  1NR7 A;  2Y69 B;  4X64 B;  4DR1 B;  2QKS A;  3TET A;  1KUQ A;  2JGD A;  1PXV A;  1OV9 A;  2Y4U A;  5LMN O;  4JI4 B;  4TV9 B;  3E89 A;  3D3I A;  4JPR A;  5LL6 Y;  5JWP A;  4LF5 O;  1XDC A;  1NVP D;  1U9Q X;  3K58 A;  5LMN B;  1H2S B;  3UCS C;  5L3E A;  3I06 A;  2ZXW C;  3FD9 A;  4FIP A;  3PDF A;  2CE4 A;  2HP8 A;  1HW7 A;  3TGU H;  3KZI Z;  2Q7E A;  3KCX A;  5LP6 A;  3ETD A;  2ZCE A;  3SPH A;  1ATK A;  4MTO A;  1DF5 A;  3SYO A;  2OYQ A;  1Q6K A;  1FXK A;  3MHH C;  4K7C A;  4X1K A;  1YZB A;  1AIL A;  4PDL A;  3ZRV A;  4UV9 A;  2BTO A;  5GTI Z;  3L75 H;  1XL6 A;  2DOS A;  1YTF B;  1K5S A;  2HH5 A;  3IFU A;  3OE7 G;  3CWB H;  3KW9 A;  1AIM A;  3QJ3 A;  3A2F A;  3ZHV A;  3LNN A;  3Q4H B;  4CS3 A;  3F5V A;  3AG7 A;  1Q7Y W;  3W7S A;  4LNU B;  4GX0 A;  1FXK B;  5B1N A;  1VF7 A;  2FYE A;  4MSX A;  5KAI Z;  4X1K B;  1XMQ O;  1X9Y A;  4RF0 A;  1PE6 A;  1FXH A;  3U0Z A;  5JZE A;  4YHH B;  5EF4 A;  4PA7 A;  1Y66 A;  3RNV A;  2AGA A;  3K0G A;  4JI1 O;  3HWN A;  5CA3 A;  1PIP A;  1SKV A;  3HHA A;  1SQF A;  3HHI A;  3O65 A;  4BW5 A;  3QNE A;  2R9R B;  2AYN A;  3DGE A;  1KXR A;  1QR9 A;  3CC2 V;  2QGN A;  1S77 D;  2LO1 A;  1GTO A;  4I07 A;  1W2B U;  2WA3 A;  4PJ0 Z;  3ASN C;  5FL7 G;  4HXD B;  1BHA A;  3P5X A;  4X62 O;  4R7C A;  3CP1 A;  4NXN B;  3I5D A;  3H8B A;  4UVA A;  4LF4 B;  4BS6 A;  1HR0 B;  4UCS A;  1G6U A;  2X6A A;  5IJ0 A;  1CEZ A;  4O4H A;  2G8E A;  3P32 A;  3S3X A;  1FFT B;  1AI5 A;  3CX5 F;  1YIJ V;  4WFF A;  5HFM A;  1YK7 A;  2CK3 G;  3JAT A;  4G27 B;  2UUA O;  3IOQ A;  2AVW A;  3B79 A;  3PHX A;  4QRG A;  1M56 C;  3TNX A;  1JVM A;  4HBN A;  4PA4 A;  1KFU L;  1PPP A;  2EIL C;  4X1Y A;  4QE7 A;  3T2M A;  2Y4T A;  1PCI A;  1B3Q A;  1V54 B;  1H8H G;  3RGB A;  4R3D A;  3BY4 A;  5IJ0 B;  2LQT A;  2UUA B;  3E9S A;  4B3R B;  2VHF A;  1WA8 A;  3JSL A;  3IAY A;  3E2E A;  4XUI A;  3K9M A;  1NKD A;  2R70 A;  1KC8 W;  5KMG A;  3F7V C;  4HWY A;  1XNR O;  3D36 C;  4J9Z B;  4RAI A;  3FB8 C;  4IYI A;  2G7Y A;  2EZP A;  2XT9 A;  2IU3 A;  2ARH A;  1MOF A;  4B3S B;  1M57 B;  2CGO A;  1WA8 B;  4D8I A;  3K3W A;  3PSE A;  2LW1 A;  2QDO A;  5KMG B;  1VQK V;  4X6I A;  1BCC H;  5CB4 B;  4W5C A;  3HD3 A;  2HVJ C;  3VBB A;  4NXM B;  3IV2 A;  4BWA A;  1S4V A;  1U5I A;  4YV8 A;  4H33 A;  1PNL A;  4JAU A;  2Y0P A;  4DR3 B;  3VQV A;  3SPC A;  4X9Q A;  3RYF B;  1F23 A;  3GVM A;  4DV4 B;  3ZMZ A;  3JAK A;  3RN4 A;  2JIZ G;  1CS8 A;  3CCR V;  1KBH A;  1WP8 A;  1S5L Z;  2JK5 C;  2ZD9 A;  2DCC A;  2YID A;  3OIS A;  2RN9 A;  1SQG A;  4UVC A;  1YJN V;  3ZN1 A;  3K03 A;  4D6T H;  3JD2 A;  2PY5 A;  2N74 A;  3G80 A;  4GX1 A;  3NR7 A;  3K5N A;  2BDZ A;  4DV0 O;  3FKS G;  4JI8 O;  4UB6 Z;  3H6S A;  3IHP A;  2Y6E A;  1SA0 B;  3JAK B;  4AI8 A;  4R6Z A;  5CBF A;  4OVZ A;  3AK1 A;  3H7D A;  3UQ8 A;  1SF9 A;  1K34 A;  4G28 B;  2VRZ A;  4ZBM A;  2OTJ V;  5IE9 A;  1N0J A;  2VQF O;  1SZX A;  2WSS G;  3OR6 C;  2XU1 A;  1U9W A;  1GM8 A;  3JYC A;  3ZMS A;  4YY3 O;  4Q8H A;  4OVZ B;  5J2U A;  3JAL A;  2HXZ A;  5EYP B;  4DV2 O;  3BB7 A;  2BU3 A;  4B3T O;  3ABL C;  2F4V B;  4N79 A;  1PM9 A;  4K8X A;  4DV6 B;  2LP7 A;  3ETG A;  4Q8G A;  5C8Y A;  1GM7 A;  1AYU A;  2PTM A;  4QNH B;  3PN1 A;  5J2U B;  3ABK B;  5BMV A;  1Y74 A;  2WLN A;  2PUS A;  3IMA A;  1WB8 A;  1I5X A;  1SC5 B;  4FJC A;  4I55 A;  3H89 A;  3PHW A;  2L35 A;  3V6C A;  1F2B A;  3UT5 B;  5CA1 A;  4M0W A;  2R9I A;  2PNS A;  2ZNI A;  3P3P A;  4AQY O;  2VHS A;  5IY5 B;  2IW5 A;  2DZY A;  1VJV A;  2KKW A;  5BMV B;  1NH2 B;  3SYP A;  1Y74 B;  3CHX A;  1MSD A;  4UV8 A;  1SQP H;  4K3A A;  2CTP A;  1KHP A;  2FT2 A;  1QU7 A;  3T4Z A;  1Y67 A;  1ZCM A;  2HJD A;  4I55 B;  2HLD G;  3OT7 A;  1CPY A;  1JCH A;  1GAX A;  4I4T A;  3ZHT A;  4JI0 B;  3P5W A;  1K4C C;  4KUM A;  2XU3 A;  3J7A U;  5B1B C;  5JVD A;  1WB7 A;  5LYJ A;  1P7B A;  2WLL B;  1QNM A;  4TUY A;  2IH1 C;  1S3J A;  4LWS B;  4UCU A;  1Z5W A;  2DZZ A;  3AK3 A;  4WA6 A;  1HNZ O;  2WLI B;  3CME V;  3DC5 A;  5IYZ A;  1FJG B;  2YS8 A;  1HNW O;  1XUQ A;  4XDJ A;  5JJN B;  1SQB H;  3T1H O;  4PV1 B;  3LDD A;  4RWU A;  1ME3 A;  4JZ2 A;  4J7J A;  1BY8 A;  5JVD B;  4ICG A;  4DUZ O;  3N2G A;  1HNW B;  5L3D A;  4FVM A;  1Q6I A;  3B8N A;  2UZJ A;  3L71 H;  1VF6 A;  1XIL A;  3ZMU A;  5IYZ B;  3G67 A;  2HVK C;  3BAA A;  2R72 A;  4X88 A;  1DKI A;  1GLO A;  2JJ1 G;  1BQ0 A;  5JQG A;  1NH2 D;  2P7T C;  4DUY B;  4W4L A;  2YXL A;  1F51 A;  4B3M B;  4GKJ B;  1Q6U A;  4J11 A;  2QTS A;  3N2G B;  4X6J A;  1MA1 A;  1V9P A;  2JJ2 G;  1TUB B;  4AHC A;  2DYS C;  3BFR A;  1VMG A;  2O6X A;  3J80 N;  3SGI A;  1QDQ A;  2BE3 A;  3BRC A;  1ICF A;  1VQ7 V;  4MVO A;  2ILM A;  4JYY A;  1R3J C;  3ASO C;  1RM1 B;  2E02 A;  3ZX6 A;  5CA0 A;  3STL C;  1XNQ O;  1VSN A;  1DGS A;  1YVW A;  2VWK A;  1BT8 A;  1UPG A;  4KHP O;  5H6R A;  4I50 A;  5LHG A;  3DF0 A;  1QLE B;  2P86 A;  2QKA A;  3K59 A;  2HHH O;  4LCU C;  1US6 A;  4L87 A;  1P49 A;  1YEW A;  4DR5 O;  1PP9 H;  2OUL A;  1NQC A;  2JTC A;  3SYQ A;  2Q73 A;  2HHH B;  2DMX A;  4I50 B;  5LHI A;  3CJH B;  4P6G A;  3K57 A;  2K1E A;  4GKK O;  4J9Y B;  2GTS A;  1I94 B;  3MHS A;  4DR5 B;  4KP4 A;  1V55 B;  4J7K A;  1MDW A;  4UFZ A;  4TT3 G;  2V7Q G;  2ZNJ A;  5H6Q A;  2P90 A;  3ZMT A;  1AB3 A;  3ZIA G;  3TXS A;  3RYI A;  4LF9 O;  1XHX A;  3WFV A;  4JI3 O;  3CYO A;  3SYA A;  2AHZ A;  1EBO A;  3ETQ A;  3LUT B;  1MNG A;  4YIP A;  1VQM V;  2H3O A;  4OPH A;  4AXL A;  1WPB A;  1R1B A;  3SJC C;  3U8E A;  4PP2 E;  1OCO C;  4DR2 O;  1D2D A;  1KU9 A;  1Q86 W;  1N36 O;  4RQF A;  5F2V O;  1AP5 A;  2WWW A;  3CCE V;  1VP7 A;  4LF6 B;  1Q82 W;  2G38 A;  4PT5 A;  5L3B A;  5KX5 A;  1NZ6 A;  2C2A A;  1BGO A;  3IFX A;  4DV1 O;  3ABM C;  1J5E O;  4OX9 B;  4F6R A;  4CH3 A;  5EIB C;  4RQE A;  5EZQ A;  2W0F C;  4D8B A;  4FMT A;  3QO7 A;  1K9M W;  4WUR A;  4JYA O;  2Q9L A;  3F7Y C;  4RUF A;  1JFF A;  5KX5 B;  5DM6 V;  3OTO O;  3JAM N;  2ARY A;  3MDS A;  1SQQ H;  4YXW G;  1L1F A;  3ZMV A;  8PCH A;  4LC1 A;  1MAB G;  1QVF U;  4E2L A;  2B1M A;  3SPG A;  4F6R B;  5GTH Z;  5EGW A;  2QKC A;  1YSC A;  4QIW F;  4CDF B;  3D8C A;  3B09 A;  3HPL C;  4IL6 Z;  4K0K B;  1YT7 A;  3KCY A;  2QE7 G;  3A0B Z;  4JAA A;  3K06 A;  1JFF B;  3RWR D;  4WFA V;  2RMK B;  2XAH A;  3BEH A;  2IJK A;  4PI2 A;  5B1A B;  4JI5 O;  1I08 A;  3AG4 C;  3OTF A;  4ZKI A;  4N4Z A;  3OAA G;  2HHN A;  3JAR A;  3X2Q C;  4J42 A;  1R6T A;  2AW9 A;  1RSO A;  2FTK A;  4CDD B;  2ZIM A;  4ZI7 A;  2HWK A;  3HR0 A;  3GCB A;  1WAZ A;  2CB5 A;  3OR7 C;  1FXV A;  2P7U A;  2ADP A;  3RW0 A;  2AIM A;  1EN4 A;  4LR3 A;  2Q0A A;  3TK1 A;  1KKD A;  2NQA A;  4MZO A;  4X66 O;  2IBZ H;  1F2A A;  3CCU V;  4MTG A;  1O0E A;  2DYR B;  1PPO A;  4NYK A;  1KEC A;  1SES A;  2KG7 A;  1WJZ A;  3OM3 B;  3K8U A;  2DQ3 A;  2UXC O;  1NVP B;  1ME4 A;  4MS2 A;  2JS5 A;  5CHV A;  3N3K A;  1MEG A;  5DN6 G;  2RCV A;  3HKE A;  2ZE5 A;  1QQC A;  1NLJ A;  2UXC B;  5FPW A;  3JAW B;  3PRM A;  1X4T A;  4PHZ A;  5LGN A;  1FFX A;  2YJC A;  1Q8I A;  2E76 B;  4MI7 A;  3G6B A;  1K4D C;  2UXN A;  3OD4 A;  3CBJ A;  5LXT A;  3T1Y O;  4DO2 A;  3AG2 B;  3U11 A;  5BY1 A;  1N0N A;  1XMO O;  2GUZ A;  2JGU A;  2Z84 A;  3ZHU A;  2LW7 A;  4JYB A;  3JD3 A;  2QR4 A;  4X64 O;  2EJ7 A;  1R6K A;  4MT8 A;  2VS0 A;  1B6Q A;  4DR1 O;  3HKE B;  4OEL A;  2UXB B;  2F43 G;  3WU2 Z;  1OCC C;  1AJN A;  1FFX B;  1R3L C;  1XL4 A;  4FLT A;  1CTE A;  4FK5 A;  2GBO A;  3JD4 A;  4FK5 C;  3LDC A;  4JI4 O;  2WBF X;  3H01 A;  2OIE A;  2DJV A;  4GCZ A;  2GSM B;  5LXT B;  5CBH A;  3CS5 A;  1GN2 A;  1GKF A;  3TMP A;  1KFX L;  2GUZ B;  4CH6 A;  4H37 A;  3FB7 C;  1DTO A;  1OCZ B;  1TVK A;  3K08 A;  3BAB A;  4FFK A;  1HWY A;  3D6S A;  1AR1 B;  3JD0 A;  1GN4 A;  2FB5 A;  2NNU A;  3PJS K;  2QM8 A;  1L8D A;  5EBW C;  4N21 A;  3TCU A;  2JGD B;  5KA5 A;  4MVR A;  1FD9 A;  3W7U A;  2FRQ A;  4UXN A;  1K3E A;  1IBL B;  1NU1 H;  2WAM A;  1TVK B;  3BC3 A;  3MHH A;  1TL9 A;  1D5N A;  1BGY H;  1PPN A;  1Q5O A;  5KO3 A;  2YIC A;  2Y0I A;  4GT1 A;  4BQV A;  5JH7 A;  3BPM A;  2ACT A;  2DCA A;  2ZXW B;  2RDC A;  4O4L A;  1SS3 A;  1R6N A;  2J7Q C;  3SPI A;  5LP6 B;  1AP6 A;  4YHH O;  3RVX A;  1XHZ A;  4Q6G A;  4WF9 V;  1PVJ A;  2AZ0 A;  3QT4 A;  4O4I A;  2YDE A;  2IM9 A;  4QE9 A;  1EN5 A;  5JH7 B;  1U9V A;  4DR7 O;  2OP3 A;  4O4L B;  3EHB B;  3KWB X;  4FZ1 A;  4PP1 A;  1UJW B;  2Q7G A;  4DV7 B;  4B08 A;  4G54 A;  2ADQ B;  1M5I A;  3N27 A;  4E4E A;  4DR7 B;  3A8T A;  4IP3 A;  1WNS A;  2FL4 A;  4LH6 A;  4O4I B;  2PZS A;  1PV0 A;  2W6I G;  4NXN O;  4XR7 A;  2N04 A;  4LF4 O;  4YVA A;  1HR0 O;  4UCO A;  1NBM G;  4EKW A;  3H1L H;  4PDR A;  2RNB A;  1L0N H;  2F7D A;  5KHK A;  3MP2 A;  4UUJ C;  4JV5 B;  3AG3 B;  1K92 A;  3OGI B;  2QSA A;  2D2C B;  1W0J G;  3NHE A;  1EZJ A;  4B7E A;  3H1K H;  2DCD A;  2HD5 A;  2JDI G;  2PRE A;  3CCM V;  2IPP B;  2XTA A;  3ASN B;  4MM3 B;  3WXG A;  3U10 A;  2QA4 V;  4B3R O;  2GTA A;  1B04 A;  1PL4 A;  3OEH G;  4R8C A;  3CH2 X;  1YIT V;  3G4S V;  1U96 A;  4O4H B;  7PCK A;  2QEX V;  1R73 A;  1N8R W;  5KAF Z;  3WG7 C;  3JAT B;  1MZF A;  3D36 A;  3ABT A;  5A2Q N;  4B3S O;  1M56 B;  3ZED A;  3BPZ A;  3MTV A;  4X1Y B;  1YJ9 V;  2E5L B;  1G1X B;  1TGO A;  4WBN A;  4C7U A;  5JCO C;  4FM0 A;  4NXM O;  3N4C A;  5KA6 A;  1FPO A;  5IWA O;  2CAZ C;  4QGP A;  3M99 A;  2LGQ A;  4CH5 A;  4DV5 B;  2EIJ C;  2Q67 A;  4DR3 O;  3ML0 A;  2YUA A;  3CEI A;  1S0V A;  5KHJ A;  1VIB A;  4OW0 A;  4MW3 A;  5IWA B;  1M90 W;  2E01 A;  5KUK A;  4MSW C;  4EFE A;  1YF2 A;  4WBN B;  2E03 A;  3I55 V;  4DV4 O;  1ENV A;  2GHY A;  1E79 G;  1RPR A;  4HZ3 A;  2R9C A;  1A6R A;  1VQ6 V;  2YSU B;  3M99 B;  2DC9 A;  2AS8 A;  1JJO A;  4PDV A;  3APO A;  3CCJ V;  5LHH A;  1B06 A;  4JTD B;  3SDL A;  2Q5Z A;  1FKA O;  2CH7 A;  3H1J H;  3UKM A;  5GW7 A;  4LFC B;  4NVP A;  2YEV A;  5B5E Z;  5CVM A;  4PI3 A;  2E00 A;  4Q20 A;  2NLJ C;  1IZ3 A;  3HB3 B;  4U3F H;  3UO3 A;  3L9D A;  4WFH A;  5FNV A;  2XU5 A;  1DF0 A;  1HNX B;  5BR8 B;  5IDJ A;  5J2T A;  2CH7 B;  1AR5 A;  4RUE A;  3N2K A;  3CE2 A;  2G6D A;  2YEV B;  3ICX A;  1WLE A;  4ASU G;  5D5P A;  1EWL A;  1K97 A;  5H9C A;  2NQD B;  2P5O A;  1N33 B;  3P5U A;  1NT2 B;  5C93 A;  4JI7 B;  2ATK C;  3FB5 C;  2F4V O;  5JA7 A;  3RYH A;  2FYU H;  2OT5 A;  3OEE G;  4DV6 O;  5J2T B;  3W31 A;  3B4S A;  5IT9 N;  5H5N A;  2Q69 A;  1EM1 A;  3RVV A;  4OEM A;  4UCT A;  1IWD A;  2NQG A;  2KSD A;  1RFY A;  4P9O A;  1S72 V;  4BS5 A;  3E35 A;  2YIA A;  2OWO A;  1YXB A;  3CRQ A;  2JEU A;  3PW3 A;  2DCB A;  1S5H C;  2W0X A;  2OCC C;  3C90 A;  3RYH B;  4FLY A;  2GFO A;  3JAL B;  4YJ2 A;  4QJF B;  4IT5 A;  1W0K G;  3MJ5 A;  3ABL B;  3WXE A;  2EUL A;  4DV3 O;  2IJH A;  2XAF A;  3OMI B;  1FS0 G;  5C8Y B;  2RJZ A;  1XI1 A;  3MD0 A;  4I9Q A;  2QM4 A;  1M4U A;  1E1Q G;  3KFQ A;  1ZUQ A;  2R9A A;  3P5V A;  4DV3 B;  1TUE B;  1GEC E;  4JI0 O;  2H8P C;  4WFB V;  4XDL A;  2YC0 A;  2M6Y A;  4X1I A;  4OXS A;  1UKF A;  1IVS A;  5B1O A;  3QF7 A;  2HR3 A;  2ZT9 B;  5CA1 B;  2P0R A;  4PI0 A;  4W5B A;  1TA8 A;  3APQ A;  4MZS A;  1FJG O;  4AXM A;  2A0L A;  3CMA V;  2JS3 A;  4BIZ A;  4OPA A;  1ROP A;  3KX1 A;  4X1I B;  1MMM A;  1JX9 A;  4I4T B;  5LGU A;  3JCU Z;  5PAD A;  5L3F A;  2K9P A;  2ZE7 A;  5B1B B;  2YI9 A;  5K1X A;  2R9F A;  2VQE B;  2FTD A;  3H1H H;  5LYJ B;  2UUC B;  4TUY B;  5LA6 A;  1YHQ V;  1H2M A;  5CHT A;  1URF A;  4DUY O;  2UXD B;  4B3M O;  4GKJ O;  4JI2 B;  1QCE A;  1EFR G;  2ZDI C;  5E6J A;  4JZG A;  2Q0O C;  1POP A;  4ZOL A;  2ITC C;  2QWQ B;  2V1D A;  3BVO A;  1N34 B;  3P3N A;  4I7Z B;  3ETE A;  3ZS8 C;  2BTQ A;  1BP4 A;  2X0L A;  2YXH A;  2FO5 A;  1S5J A;  1U97 A;  5L3G A;  1VF5 B;  4AIL C;  1KKC A;  3TRK A;  2JEX A;  4MVS A;  2Q68 A;  1Z5V A;  2QTO A;  3AG1 C;  5JQG B;  4KXR A;  1VQO V;  4JAS A;  4ZOL B;  1GM9 A;  2QWP B;  4BPV A;  1LR1 A;  2F1M A;  1RM1 C;  3GB7 C;  2R9O A;  3ZN0 A;  1XBL A;  4DMX A;  2DYS B;  2IH3 C;  1THE A;  5CBG A;  2IJJ A;  3FFQ A;  3PNR A;  4U3J A;  3AK2 A;  1ORQ C;  4CZW A;  2AYO A;  4BOZ A;  4LF8 B;  1I5Y A;  3ASO B;  1KHQ A;  2GHU A;  1I94 O;  1W59 A;  3K79 A;  5CA0 B;  4LFB B;  2ZIN A;  3AEI A;  2ZE6 A;  2FE8 A;  4UCR A;  1EWP A;  2F93 B;  2A79 B;  4CBC A;  4DW0 A;  1ZAU A;  3KG2 A;  3D3Q A;  4O2B A;  1XEQ A;  2CUG A;  2YJ9 A;  3LNM B;  4F6E A;  2EIN B;  2JQG R;  2YXY A;  3M8A A;  1AU2 A;  4WFE A;  4KL1 A;  2NR5 A;  2EIK C;  1FYJ A;  5J94 A;  1NR1 A;  5GON A;  3DSQ A;  4WFG A;  5BZB A;  1VQ4 V;  1YJW V;  2H7J A;  1Q90 D;  4X65 B;  4O2B B;  4LF7 B;  2X6C A;  2B1G A;  1YDX A;  1Y08 A;  2LJ2 A;  3K9A A;  3C3S A;  3BPF A;  4FLV A;  1IDS A;  2WPD G;  3DTU B;  4X8A A;  3MTN A;  2Y5B A;  3OFN G;  3JSN A;  1Q6H A;  4LF6 O;  3GWK C;  5GON B;  4DXW A;  4Z2W A;  5LGT A;  3IGA C;  3K24 A;  1PD3 A;  3RYI B;  3IC9 A;  1TU6 A;  2FKX A;  3LSQ A;  2OTL V;  1Q3E A;  4OX9 O;  1DEU A;  3S3R A;  3B40 A;  2AU1 A;  2Z5U A;  3UM7 A;  2ZKO A;  3L72 H;  1MZE A;  4X20 A;  3ERV A;  1JQ0 A;  2CTR A;  3PHU A;  4O4J A;  1BSM A;  3PT2 A;  2P06 A;  2WLJ A;  1DK1 A;  1CJL A;  3LSS A;  1IBM O;  1QOL A;  3IUT A;  1YVB A;  3HKD A;  4JAV A;  2P67 A;  4JTA B;  4K0K O;  2F95 B;  4PD4 F;  1CXZ B;  1IBM B;  3VOU A;  3ABM B;  4DMY A;  4YYW A;  2QWO B;  4R50 A;  4O4J B;  3LFY A;  1VQ5 V;  4UCV A;  1HP8 A;  3ZCC A;  4FFB A;  1E1R G;  4YYV A;  2GDS A;  3ZRW A;  1P84 F;  2UU9 O;  3C9E A;  4FPP A;  2DN9 A;  4FZ0 A;  1IBK B;  3BA8 A;  4EB6 A;  1Y4H A;  3WB2 A;  3SJB C;  1IXM A;  4J7Z A;  5E1A C;  2UU9 B;  3VQY A;  4W4U A;  1JOY A;  4QBB A;  5K16 A;  4JGS A;  4FFB B;  1STF E;  3AG4 B;  2OZ2 A;  2OIG A;  2YJ8 A;  1AJQ A;  4L8J A;  5JJE B;  3JAR B;  1VAR A;  3KKU A;  1PKX A;  3X2Q B;  1EWO A;  3OVX A;  4EEQ A;  1S76 D;  1SZT A;  3E22 A;  2EX3 A;  1RSO B;  3E8H A;  4DR6 B;  3RT3 C;  4ZI7 B;  2DC8 A;  4O2A A;  4MTF A;  1FH0 A;  4IIJ A;  5EIB D;  2DE0 X;  3E86 A;  5B3S C;  1OCR C;  3E22 B;  2FUD A;  2ATO A;  1F4N A;  3CCV V;  1BMF G;  4K35 A;  2UUB B;  4MVZ A;  2KG7 B;  4JI6 B;  1AU4 A;  2UXB O;  2EIM C;  2AZ2 A;  4O2A B;  1TLO A;  4IIJ B;  1YCI A;  5CVN B;  1KQS U;  1H2G A;  4BOS A;  3SR2 C;  2PYL A;  1H38 A;  2CGN A;  2Y69 C;  1P7G A;  2NQI A;  1JMK C;  1J95 A;  1BL8 A;  3VQX A;  3H9V A;  2ETN A;  5LMU O;  2LFR A;  4ZTB A;  1NTZ H;  4NTX A;  2CTQ A;  4LFA B;  3OW2 U;  1NL6 A;  1OCC B;  4PA3 A;  5LMU B;  3FYI B;  1IBL O;  2QJ1 A;  5CMU A;  4TQF A;  2XND G;  4GX5 A;  3HKB A;  1VQP V;  1AI4 A;  4RF1 A;  3VQW A;  3QG5 A;  3WB1 A;  1WN7 A;  5IJ9 A;  1QVG U;  4P9P A;  1XKG A;  1JA8 A;  5JH3 A;  2KQX A;  2M7W A;  2EZO A;  2J7Q A;  4I05 A;  5FLX N;  5EC2 C;  4FIP C;  2ZQM A;  1SET A;  3FX7 A;  3QO5 A;  3HKB B;  4HYO A;  4LF5 B;  2EJR A;  3BA9 A;  5LP6 C;  3Q4H A;  4QPK A;  2DWE C;  4LNU A;  4BOU A;  1KMI Z;  1FXK C;  5IJ9 B;  3BCC H;  2FRA A;  1H2N A;  1HDJ A;  2G8J A;  4DV7 O;  5JJJ B;  1BE3 H;  3BOW A;  2EBO A;  2QM7 A;  2FML A;  3RBZ A;  3IC7 A;  2Q8V A;  4GX2 A;  1BQZ A;  3I56 V;  2CIO A;  4J80 A;  3CBK A;  1MSW D;  4OGQ B;  3GWO A;  5CVO B;  1ZWI C;  4PEL A;  4D7T A;  1Q43 A;  4YJ3 A;  1CPJ A;  2PBH A;  5IYD O;  4JV5 O;  3RFR A;  4TSF G;  4IUM A;  2WLK A;  4GUA A;  1XMQ B;  1F2C A;  4CH4 A;  1XQ8 A;  1CP9 A;  2BCC H;  4J10 A;  2WA4 A;  1PAD A;  2R9M A;  3AG3 C;  3R66 A;  1VQN V;  4GLX A;  4F4L A;  1Y6X A;  1JJ2 U;  4YJ3 B;  4JI1 B;  1XOU A;  3JAS A;  4BSQ A;  1Z2G A;  1QLN A;  3THO A;  1GO3 F;  4CC5 A;  1G4Y B;  3SYC A;  3NXS A;  2YIB A;  4REZ A;  3ZNH A;  1LNQ A;  3CC4 V;  1M93 A;  1GK9 A;  1SP4 B;  3EFF K;  1V54 C;  3RVW A;  1YTF D;  4RY2 A;  4MTX A;  4N23 A;  3CXC U;  3BBA A;  4X62 B;  1HUC B;  4FLU A;  4DK0 A;  3JAS B;  1GCB A;  2E5L O;  3LDE A;  4W4K A;  2LFS A;  2IBI A;  5J9P C;  1WPX A;  1K8A W;  1OJH A;  2P4K A;  3CCQ V;  2DJF B;  3E83 A;  4PDM A;  3ZRX A;  2EIL B;  4A5U A;  4KFM A;  3I3T A;  4DV5 O;  1UFI A;  4FLW A;  3V6E A;  1K5Q A;  4G2K A;  1H8E G;  5JCO A;  3QVN A;  3CD6 V;  1IXB A;  4IGG A;  2B1N A;  2XHB A;  1EZV H;  1M57 C;  1ARO P;  3CH3 X;  3WG7 B;  4DYL A;  3UO2 A;  5CB4 A;  4UB8 Z;  4I0X A;  3DXR A;  1SQX H;  4A5U B;  1AYW A;  3ZHS A;  5KHI A;  5KLV H;  4YYU A;  6PAD A;  1JPX A;  1ZLZ A;  3CCL V;  3L74 H;  1PPJ H;  3SJA C;  1XNR B;  2BTW A;  3OF9 A;  4JF3 A;  4CZZ A;  4CDC B;  3OVZ A;  1NB3 A;  2XU4 A;  3OF8 A;  5FPR A;  3JD1 A;  5KHG A;  1EF7 A;  2EIJ B;  2XAG A;  3RYF A;  4FLX A;  4YYQ A;  1YK8 A;  4I0X B;  2A3Q A;  4LFC O;  3DXR B;  1AR4 A;  4TV8 A;  1QHT A;  3LXS A;  4BIO A;  4I04 A;  3K04 A;  3W7T A;  2R9N A;  3E8F A;  1ZX3 A;  1F4M A;  3BCN A;  2KB1 A;  5CN0 A;  2BTW B;  1NTM H;  4DW1 A;  1CV8 A;  3H8C A;  3RVY A;  1Y4M A;  3BY6 A;  3MOR A;  3N3G A;  2DW4 A;  3RYC A;  1HNX O;  5BR8 O;  3B21 A;  1COW G;  3STZ C;  2YIB D;  2X6B A;  4HNA A;  2F1G A;  1SA0 A;  3P30 A;  5IYC O;  2H94 A;  4XZX A;  1NS1 A;  4BOP A;  4TV8 B;  2P6J A;  1O9H A;  1PNK A;  2Y48 A;  4MVU A;  3ZUA A;  3IJ4 A;  1R3K C;  1AEC A;  1F29 A;  3CXH F;  1I0H A;  1ZL8 A;  4RNA A;  3FAV A;  1N33 O;  1ZTE A;  4Z1M G;  4JI7 O;  4X6H A;  2P4V A;  4CS2 A;  3OUF A;  5A24 A;  3RYC B;  1KD1 W;  1NB5 A;  1FAF A;  2MK3 A;  3C3T A;  4HNA B;  3KWZ A;  3HKC A;  1LUW A;  2DC6 A;  1VEW A;  2DWD C;  4P30 A;  5FNV B;  1ZL8 B;  1K3B B;  4DV0 B;  4JI8 B;  1EN6 A;  3FAV B;  5EYP A;  5K1P A;  3N2K B;  4BAY A;  4Z1V A;  4CDE B;  1GH6 A;  1IUR A;  1BQI A;  1Q81 W;  4BIU A;  3K0D A;  3A0H Z;  4NTY A;  3HKC B;  1G8M A;  5IYB O;  5DED A;  2VQF B;  2BSK A;  2A7W A;  1I7F A;  4QRX A;  3KKY A;  4TWK A;  3ABK C;  3OMA B;  1BZK A;  1JQP A;  4ZUX U;  2WLM A;  1U9X A;  4QH6 A;  2YI8 A;  3LSU A;  3F5T A;  4NR1 A;  4YY3 B;  4FLZ A;  2YJB A;  1H2K A;  4JTC B;  5B66 Z;  4DK1 A;  3UT5 A;  1AYV A;  4DV2 B;  5H2F Z;  3ZHQ A;  3G6E V;  3PBH A;  1GN3 A;  4B3T B;  2OCC B;  1IX9 A;  2BSK B;  2AUZ A;  1KP3 A;  2N05 A;  5IY5 C;  9PAP A;  4YJ2 B;  1N32 O;  2FQ9 A;  3L73 H;  1LUV A;  1VQ8 V;  1AU3 A;  4WCE V;  4H44 B;  4FJC C;  3C0R A;  1TAE A;  3L70 H;  1KB9 F;  1JR9 A;  2P22 C;  1N32 B;  2O57 A;  3E1Z B;  1H2L A;  3SJQ C;  2Z0A A;  3WXF A;  2XAQ A;  1PBH A;  2B9Z A;  2Q4P A;  1BHB A;  2WLL A;  1GRJ A;  3JCZ A;  2VWJ A;  3CB2 A; 
#chains in the Genus database with same CATH homology
 3OTO O;  2FKX A;  3JAM N;  4JV5 O;  5E6J A;  3TMP A;  2VQE O;  4MM3 B;  4OX9 O;  4B3R O;  1HNX O;  2UXB O;  1YZB A;  1XNQ O;  5BR8 O;  2UUC O;  2F4V O;  1AIL A;  3B21 A;  4KHP O;  3OQC A;  4IUM A;  4GUA A;  4DV6 O;  2ZKO A;  4D8I A;  2DOS A;  1X59 A;  4XZX A;  1NS1 A;  3PSE A;  3W31 A;  4BOP A;  2UXD O;  3PHW A;  3PRP A;  5IT9 N;  5H5N A;  3IFU A;  4RKX A;  3PHU A;  4JI2 O;  4M0W A;  4BOS A;  4RNA A;  3R66 A;  3PT2 A;  2HHH O;  2UUB O;  1N33 O;  1DK1 A;  5EZS A;  3TRK A;  4AQY O;  1IBM O;  4JI6 O;  4JI7 O;  4JI5 O;  5A2Q N;  4DR4 O;  4B3S O;  4DR5 O;  1N34 O;  1XMQ O;  4RF0 A;  4GKJ O;  2JTC A;  3MTV A;  5JZE A;  4K0K O;  1G1X B;  1R6T A;  5LMU O;  4GKK O;  4ZTB A;  5KO3 A;  4REZ A;  3ZNH A;  3MJ5 A;  4NXM O;  3RNV A;  2AGA A;  5IWA O;  4DV3 O;  4JI1 O;  4P16 A;  2HWK A;  2J7Q C;  3J7A U;  3BBA A;  3O65 A;  4DR3 O;  4YHH O;  1IBL O;  2E5L O;  4OW0 A;  4BOZ A;  2N74 A;  1I94 O;  1AB3 A;  1HNZ O;  1F7Y A;  4X66 O;  2JRI A;  1PVJ A;  4DV4 O;  4LFA O;  4JI0 O;  4DV0 O;  4LF9 O;  4JI8 O;  4RF1 A;  4A5U A;  2FE8 A;  2UU9 O;  1HNW O;  4JI3 O;  4DV5 O;  4DR7 O;  4HXD B;  3T1H O;  4X62 O;  2UXC O;  4OVZ A;  1UKF A;  4OPH A;  1XEQ A;  3F5T A;  4BOQ A;  5BXZ A;  1R1B A;  4LF8 O;  4DUZ O;  1A32 A;  2J7Q A;  5FLX N;  3M8A A;  4DR2 O;  1D2D A;  4LFB O;  2ZM6 O;  1FJG O;  4D8E A;  1N36 O;  4IP3 A;  3SDL A;  2VQF O;  2UZJ A;  1FYJ A;  3PRM A;  1FKA O;  1KUQ A;  1IBK O;  4A5U B;  4OPA A;  4NXN O;  1DKI A;  4BOU A;  3PHX A;  2UUA O;  4MI7 A;  4PT5 A;  4YY3 O;  4LF4 O;  2BTW A;  4DV7 O;  1HR0 O;  4OVZ B;  5LMN O;  1N32 O;  3T1Y O;  5BY1 A;  1XMO O;  2Z84 A;  3W30 A;  3RT3 C;  5LL6 Y;  2LW7 A;  4X64 O;  4DV1 O;  4DR1 O;  3C0R A;  3MP2 A;  4DV2 O;  4LF5 O;  3BB7 A;  4R3D A;  3BY4 A;  1J5E O;  2BU3 A;  3E9S A;  4B3T O;  4LFC O;  5EZQ A;  4LF6 O;  4D8B A;  2Z0A A;  4X65 O;  3J80 N;  1XNR O;  4LF7 O;  4WUR A;  4JYA O;  4DUY O;  3J81 N;  4JI4 O;  4B3M O;  4DR6 O;  2DJV A;  2BTW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...