1YZBA

Solution structure of the josephin domain of ataxin-3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Machado-Joseph disease protein 1
publication title The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1yzbA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1yzbA01
5A2QN 2ZM6O 1D2DA 1XNRO 2Z0AA 5IT9N 2UUAO 2UXDO 4YY3O 3J80N 2VQFO 2HHHO 2E5LO 2FKXA 4K0KO 1IBKO 2UU9O 4DR6O 5BY1A 4X62O 4KHPO 4JI2O 4NXNO 2N74A 1J5EO 3J81N 5IWAO 1XMQO 1HNZO 1HR0O 1XEQA 2LW7A 4JV5O 2UUCO 4JI5O 4OX9O 4X65O 5BR8O 5H5NA 4JYAO 1N33O 2F4VO 4JI6O 1DK1A 1G1XB 1NS1A 2UXCO 5LL6Y 3RT3C 2ZKOA 4DUYO 4DV5O 1XNQO 4DR5O 1X59A 4LF4O 4GKJO 4DUZO 1XMOO 4DV2O 4JI4O 4DV6O 1I94O 4LFAO 1AB3A 4X66O 4DV1O 1A32A 2UUBO 4NXMO 3SDLA 4B3TO 1YZBA 4B3MO 4DR2O 4B3SO 1HNWO 4DV0O 4OPAA 1KUQA 1R6TA 4LF6O 4DR1O 3J7AU 4GKKO 4DV3O 5FLXN 2UXBO 4YHHO 1N36O 4JI8O 4DR3O 1N32O 5LMNO 4DV7O 1FJGO 4DR7O 4LFBO 1HNXO 4JI3O 5LMUO 3F5TA 4JI0O 4LF5O 4AQYO 3R66A 1FYJA 5BXZA 3M8AA 1N34O 3JAMN 2VQEO 3O65A 4X64O 2DOSA 1FKAO 4LFCO 1R1BA 2DJVA 4OPHA 4DV4O 4JI7O 3OTOO 4DR4O 1AILA 4LF9O 4JI1O 4LF7O 3T1HO 4LF8O 4B3RO 1F7YA 2AGAA 1IBLO 4A5UB 2JRIA 3T1YO 1IBMO
chains in the Genus database with same CATH superfamily
4N21A 2ZM6O 3SJQC 1ZLZA 4P9OA 2UXDO 4YY3O 3F7VC 5DECA 1GN2A 1OHHG 3GWOA 1IBKO 4PV1B 1BCCH 4DV4B 4ZI7A 3FYEB 4JI1B 3JSLA 3U11A 3L74H 4F6RB 4RF0A 2ZE7A 2CH7A 5F2VO 1FS0G 2R9IA 1F23A 1CPJA 4JV5O 3PBHA 3HKDA 2XHBA 4OVZA 1VJVA 4I9WA 4XBFA 2CDYA 2YI8A 2IJJA 4PELA 2XTAA 3UCSC 2FMLA 1ROPA 5B1NA 2HKOA 3RYIB 2DW4A 4PA6A 3ASNC 4JF3A 1K8AW 2Q6AA 2DJGB 2ETNA 4DV6O 1F2BA 3QO7A 1OCZB 1OCCC 1GM8A 3K03A 1Q82W 1SKVA 1A32A 1N0JA 5EIBD 2F7DA 1ENVA 2AZ2A 1XNQB 1AU4A 3OGCC 4FLZA 1KUQA 1CB5A 4DUZB 2DQ0A 1PP9H 4GKKO 1WLEA 2DYSB 1S76D 5B5EZ 4X66B 3JASB 5LP6C 2ZD9A 2B9ZA 3AG3C 3QG5A 3D6SA 4BIZA 5DM6V 1M93A 3FB8C 1RSOA 3CC4V 4BAYA 3H1IH 5E1AC 3JAKA 4RAIA 3B2EE 4W5CA 3M8AA 3CC7V 2FRQA 4WF9V 2PYLA 3ZMVA 1VSNA 2DC9A 4UFZA 4ZTBA 4YJ2B 3OF9A 2HHNA 4J80A 3OAAG 1E1RG 4LFBB 2E00A 1PNLA 2HWKA 1XNRO 5IJ0B 1AROP 1AI7A 2VQFO 4Z1VA 2BTWA 4DW0A 1M57B 2WLIB 3K79A 2O57A 4K0KO 5CVMA 1QXPA 3PRPA 3VQVA 4HZ3A 4TV8B 4NB5A 5FNVB 1Q6UA 1D5AA 2HR3A 4IYIA 4LF7B 1NH2B 5EZQA 2IJHA 3OTFA 1L0NH 1NL6A 4F4LA 3KW9A 1IXBA 4H13B 4DYLA 2LW1A 3KG2A 1WJZA 1EWPA 1AYVA 2HJDA 2G8EA 1W59A 2XASA 1PPOA 1VQLV 1VQMV 3BHPA 1SQQH 4BWAA 3ZRSA 5KUKA 3CCUV 2ZDIA 3CD6V 3WB0A 5CB4A 3ASOB 2PNSA 2NN4A 3ZN0A 3I3TA 3DC6A 4FMTA 3IMAA 1GK9A 1KMIZ 4FLYA 4MTFA 2YIAA 2UXCB 3A0HZ 4B3TO 1G4YB 2DCAA 4FIPC 4B3MO 3BA9A 4JYYA 4MVOA 3CCLV 1JMKC 1VF7A 1R6TA 2KSDA 2ZE5A 2FT2A 1PNKA 2Y5BA 4OEMA 1CTEA 4YHHO 4NTYA 4DMYA 2O6XA 3T4DA 2M7WA 3HKDB 1PPNA 3FFQA 3DGEA 3DSQA 3W7SA 4OVZB 4U3JB 5L3GA 2DE0X 4NXMB 1K7DA 1DF5A 1HP8A 4LH6A 2JJ2G 4EFBA 1MABG 5B1BC 1FYJA 3E2EA 2GSMB 2R9MA 4UCOA 2VQEO 4O4LB 4FVMA 2BTOA 2WSSG 2WLLA 1AILA 3E83A 1VQ4V 1ZIVA 4CS3A 4B3RO 1SQXH 1IBLO 2CB5A 2OWOA 1JR9A 2YJ9A 2W0FC 1VF6A 2NNUA 2B1IA 2QR4A 3OEEG 3RYHA 5J2UA 3JD4A 5LMUB 3VQXA 2IM9A 4AHCA 4YYSA 2RMKB 5JQGA 3BFRA 1W0KG 1K5SA 4R7CA 1Q43A 3CWBH 1QNMA 3WXEA 2YC0A 1E1QG 3CPWU 3DTUB 1KQSU 2Y0PA 2P4VA 1H8EG 5LHGA 2QWOB 4NYKA 2AU1A 2ZM6B 1WB8A 5JJJB 4E4EA 2LO1A 2Q67A 2YXYA 4MTOA 2UXDB 4HXDB 5ITZA 4YY3B 1F4MA 3E8HA 2IU0A 1EN4A 2X6BA 1QHTA 1K92A 3E8BA 4G2KA 4N79A 1RSOB 5C93A 2GFOA 1IBKB 2GDSA 3OFNG 1F4NA 3CJHA 4GUAA 3KWZA 5CA1A 4CDEB 4DUYO 1MSDA 1V9PA 1ZTEA 3K04A 4JV5B 3P5WA 3K08A 4GKJO 4DV2O 2ZNJA 2EILC 1IX9A 2YIBD 3FB5C 4FLUA 1XOUA 1GTOA 4RF1A 1QQCA 1GMYA 3K8UA 2GHUA 3WG7B 4P16A 2E74B 2R9FA 4NKGB 4J42A 1SS3A 4DR2O 3PDFA 2R9CA 3SPGA 1WP7A 1U9WA 3QO5A 4DV6B 4J10A 4ABMA 5JJEB 3Q4HB 5B66Z 2Y69B 5LGNA 3CSXA 1IXMA 1MEMA 1KKCA 1TAEA 4YXWG 3IAYA 3OEHG 5KHHA 2P0RA 1SA0B 3KZIZ 3OR6C 3HKCB 4BQVA 1GH6A 1DEUA 3JCZA 4GKKB 4LFCO 1BGYH 4QPKA 1R3JC 3OD4A 1RM1C 2ZT9B 1JOYA 3T1YO 3G67A 1K73W 4H33A 5A2QN 3CCVV 4L87A 2G7YA 1QOLA 3RWRD 3B40A 3QT4A 4KFMA 3H8BA 3RFRA 1NH2D 4REZA 3ML0A 3CS5A 1VQPV 2FKXA 3OISA 2R72A 1B04A 5K1PA 1M9NA 4G28B 2XT9A 1IURA 1TU6A 1NR7A 4HWYA 3PHXA 4O2BA 1I08A 2ITDC 2VHSA 2LW7A 1DKIA 4R6ZA 2F1GA 1URFA 5JZEA 3EHBB 4MW3A 1XNRB 4FLVA 4O4JA 1YJ9V 5CBFA 3V6EA 2VQFB 3ZHUA 3OMAB 1H2KA 2QWRB 4K0KB 2DZYA 4XUIA 4MZSA 1NVPB 5LL6Y 6PADA 2VWKA 3SJBC 2ZCEA 3FAVA 3STLC 1JCHA 1WN7A 3BPZA 1KFUL 3E8GA 2WLLB 1LNQA 4X1YA 5FPRA 1ME4A 2KG7A 1KP3A 4BS5A 4JZGA 4AI8A 3QNEA 1YI2V 1JFFB 1V55B 3SDLA 1YZBA 2DWDC 2Z5UA 3RYCA 1AI4A 5JQGB 4BS6A 4UVCA 1JJ2U 4NTWA 3ZJZA 5BZBA 3MHSC 3SPJA 4B7EA 2G6DA 4DR1O 4JZ2A 1AR4A 1QR8A 2QKSA 3OR7C 2L35A 1N36O 2CGOA 5LOVA 4CC6A 3L73H 3CCSV 4DV7O 3X2QB 4CBCA 2WBFX 2UXXA 5ITZB 2QA4V 4B3TB 4JTCB 2EIJB 3W7WA 3G6BA 3BC3A 3CMAV 4B3MB 1STFE 1PPDA 1VF6C 4AQYO 3CJHB 4X9QA 4EFEA 2YICA 3JAMN 5CA1B 3L9DA 1VQ9V 2UZJA 3K24A 4YHHB 4UVBA 3OUFA 2W0XA 3A0RA 1S0VA 2JS3A 3N2GA 3BRCA 3SJCC 3CC2V 1AECA 1EWLA 3ZIAG 3JATA 1MZFA 2XNDG 4UUJC 2ADPA 3ZMZA 2PREA 3CX5F 4JASA 4K35A 4P2ZA 1KC8W 2VQEB 3GCBA 3RYIA 3E9SA 1J95A 3JD2A 4UCVA 2ADQB 4FM2A 4B3RB 5EC1C 1IBLB 1S77D 4DXWA 3JCUZ 1XMQO 3PSEA 4CDFB 4XDLA 5CBHA 1EWOA 4PT5A 1XDCA 4G27B 4QGPA 3B77A 3ZHSA 2GBOA 5K1XA 1TUEB 5EIBC 2ZR3A 1BT8A 4IHJA 1Q3EA 4PDVA 2JVDA 1BS3A 1BY8A 2Y48A 1EF7A 4CS4A 2Q7HA 3BEHA 3LSQA 4RUFA 4TUYA 2W6JG 4AILC 3UT5B 1JA8A 2EULA 5CVOB 3I56V 1NT2B 1AB3A 4IP3A 3AG2B 5BMVA 3K9AA 2NR5A 4E2LA 1QU7A 4J7KA 3LSSA 2LJ2A 5H6QA 3TMPA 1VQ8V 3CH3X 4DUYB 1BP4A 3CXCU 4QH6A 4JAAA 1VQ6V 4GKJB 4GLXA 4DV2B 1YCIA 1NI8A 2BTQB 2YDEA 4X1IB 3K5NA 4O2BB 4YJ2A 2BDLA 4J9YB 1PCIA 3PT2A 4DR3O 4X8AA 3CMEV 2BDZA 4BOQA 1ZSPA 2VHFA 1S3JA 2Q68A 3CCEV 2Y4TA 4DR2B 5F02A 2DCCA 4JI0O 1PXVA 1NJIW 1Q6IA 4WFFA 3AI8A 4X64O 2DOSA 2ZXWC 1FH0A 3FAVB 4H44B 2XAHA 4YYVA 2YS8A 4B08A 1BL8A 4W4UA 4EKWA 2Q8VA 1NTMH 3OUSA 4EEQA 5KA5A 3SYCA 2YXLA 1KYOF 4M0WA 2QM4A 2R9AA 3FB7C 2A7WA 1Q7YW 2A9HA 3D8CA 4LFCB 4PA4A 3ABLB 3CB2A 4R3DA 2G38A 2PGGA 3KCYA 3NXSA 4QE9A 5H6RA 4LBEC 3T1YB 2DJFB 5FL7G 2EINC 2P5OA 2UUCO 1SQBH 4BR6A 5LOVB 5B3SC 4I55B 2HD5A 3O0UA 2P67A 1A6RA 4YYRA 3E22A 1K5QA 4WCEV 5BR8O 3WB1A 1R73A 3BBAA 1Y4HA 1B3QA 2BCCH 4JI6O 4HYOA 2HVJC 4FFBA 4DK0A 1XL6A 4RY2A 4GCZA 5KHKA 1NZ6A 4PHZA 4FK5A 1AYWA 3RVWA 3SPIA 3LSUA 4LF4O 1PNMA 4AXMA 1YVWA 3N2GB 4MTXA 4FLWA 1I94O 3W7XA 3ZBHA 4BW5A 1VF5B 4U3JA 3JATB 4OXSA 1PIPA 2ATKC 2R9OA 5KO3A 2UUBO 3TNXA 5IE9A 1YITV 7PCKA 3ZRWB 2D2CB 4MI7A 3AG4C 2XU5A 2HEPA 1GN4A 1DLBA 1AYUA 2YXHA 4R50A 4O4LA 4OPAA 3F75A 1ZWIC 2IJKA 3RVZA 3PW3A 3OM3B 2F43G 4MVUA 4PA7A 1FPOA 3DC5A 2RNBA 5JJNB 2QGNA 2DN9A 5FPOA 1XQ8A 4IHJB 1PV0A 3R66A 4UV9A 1EBOA 1KB9F 1DTOA 4DR1B 1P7GA 4J11A 1Y74B 1QDQA 4TUYB 4WFBV 1K34A 1N36B 4YIOA 4LF9O 2E03A 4KL1A 4DV7B 2Q73A 1NTKH 1VMGA 1IBMO 2Q0OC 5BMVB 2HLDG 5JCOA 3RNVA 2JGUA 2ARYA 4QRGA 3I06A 4RO2A 4AQYB 4FZ1A 1MIRA 3IOQA 4CH3A 4TWKA 4YYUA 2YJCA 3ICXA 1OCZC 2OIGA 3L71H 1QLEB 1X9YA 1R3KC 4TQFA 4WBNA 4X62O 4BOPA 4NXNO 1HNZO 1CPYA 2ZIMA 3K58A 2Y0IA 2PADA 4MSWC 2EJ7A 2LFSA 3U8EA 1SZXA 2KQXA 3QO8A 2FE8A 1P49A 2DYSC 4BIUA 4RQFA 5JH3A 3LFYA 3LNNA 1VEWA 3CHXA 1AI5A 2Q7GA 1G6UA 1PL4A 4DV5O 3KFQA 3SYQA 1XMQB 2P7TC 5B1AB 4OELA 4X6IA 5GTIZ 2OCHA 5D5PA 2NQDB 3ERVA 3LDDA 1QBZA 2HXZA 3Q4HA 3S3XA 2F66C 5IJ9A 1B06A 2VRZA 2CTQA 3ZHVA 4CH6A 4HAMA 1WB7A 4RKXA 5L3EA 1E79G 1V54B 3LDEA 3IV2A 2M6YA 1O9GA 4U7OA 2E02A 1UPGA 1SA0A 1BHAA 3HKCA 4P30A 3AEIA 3SGIA 2QTSA 1FFTB 1YALA 1W0JG 3VQWA 3SPHA 2Q69A 3J7AU 3K3WA 1UKFA 4W4LA 2QWNB 3ZN1A 2UXBO 3JAWB 4OW0A 1M57C 5E79Z 4I4TA 2R6NA 1OCRB 1U9QX 3E22B 3P30A 3IGAC 4DR7O 9PAPA 3F5TA 3CXHF 4FFBB 1THZA 4O2AA 3VBBA 1M5IA 4QBBA 1N34O 3OGIB 2KB1A 2V1DA 3O65A 3BB7A 1W2BU 2YJ8A 2J7QC 3ZNHA 4DR3B 3ZHTA 2AGAA 2JRIA 3ABMB 1PADA 2VWJA 2B1NA 3M7MX 2P90A 4MVRA 1BHBA 1K33A 3ASOC 4DW1A 4D6TH 5IY5B 4JI0B 3OMNB 4X64B 2E5LO 1GCBA 1Y6XA 2UU9O 4DV3B 3N3GA 1KFXL 3K57A 3FD9A 5IWAO 1N8RW 3AG1B 2XU1A 2CAZC 4PP2E 3HKBB 4HNAA 4FLTA 2AVWA 4BOSA 2AXTZ 3BABA 3ZEDA 4OX9O 1GMGA 2IPPB 2B5UA 1U96A 1M4UA 1AP6A 3IJ4A 2F4VO 1JFFA 3N2KA 3WB2A 1CSBB 3ETDA 4PD4F 1K97A 1KHQA 5KHIA 1AU3A 1PKXA 2F93B 1GN3A 2UUCB 2P7UA 1M90W 2E01A 5BR8B 4JI6B 2ILMA 4DV1O 4BIOA 2XOKG 3OW2U 3KKUA 1K3BB 3L75H 4TT3G 1S5HC 3OF8A 5CA0A 1JJOA 3USVA 4LF4B 3CYOA 3MAQA 4WBNB 4ASUG 3H89A 1I94B 2R9RB 3ABTA 5CN0A 5J9PC 1YVBA 4D8BA 1N32O 2IH3C 2UUBB 5JVDA 1CP9A 1R3IC 2A79B 1BSMA 2MW2B 1PD3A 1XREA 2JIZG 3E8FA 1EN5A 2P22C 2DYRB 1Q90D 2OYQA 3WXFA 4MSXA 2GTSA 1YTFB 4FFKA 3T4ZA 5KX5B 4I5SA 4TSFG 2VS0A 4ZIBA 5CBGA 5JWPA 1MDWA 5LHIA 4D8EA 3A0BZ 5IJ9B 1SQFA 3OT7A 4GT1A 5L3CA 1EWMA 4BPVA 1YJWV 3STZC 2DCBA 1ME3A 1X4TA 5IYBO 3G71V 4WFGA 4KP4A 1AR5A 4LF9B 2ZIOA 1T5EA 4MZOA 4WFAV 4IYHA 4TV9B 3WG7C 2QM7A 3TK1A 2N74A 1OV9A 3UKMA 4JGSA 3UT5A 1IBMB 2JQGR 3A2FA 4JI5O 2V7QG 4I4TB 4MT8A 3VOUA 4U3FH 4C7UA 2XAQA 1N4CA 2B1GA 5KMGA 1Q8IA 4O2AB 2Y69C 2CUGA 4X62B 5EZSA 4NXNB 3CRRA 1HNZB 3IEJA 3GVMA 5GONA 2YSUB 3HWNA 8PCHA 2BTQA 2FUDA 1S5JA 4X1IA 3ABKB 4JI4O 3H1KH 3SYOA 1OJHA 1FXHA 1CEZA 3W31A 5A9GA 4YV8A 1L0LH 2ZDIC 3ZRVA 3LXSA 4GYCB 4Q20A 2CTRA 3W30A 2WPDG 2E76B 4DV5B 4I05A 4B3SO 1ICFA 2YJ2A 4AXLA 4W4KA 4BOUA 4LF6O 1DF4A 1JPXA 5EF4A 5LBQA 4MM3B 1NB3A 3L72H 3QSDA 1TA8A 2DZZA 1L1FA 4HNAB 4QNHB 1YT7A 4X1KB 1XBLA 3NR7A 3E89A 3CCRV 5LHHA 5EBWC 3D36A 2A3QA 2DC7A 1TGOA 1HNXO 3N2KB 2UXNA 4GUNA 4UB8Z 1SC5B 1ITOA 1L8DA 5JH7A 4LF5O 5KAFZ 1OCOB 3C90A 1FXKA 3S3WA 4JTDB 2AUZA 3AK1A 1RPOA 2QDOA 2XUMA 2UXBB 2YIDA 2P6JA 3E35A 4OPHA 1NTZH 4LF8O 2ZE6A 3CE2A 2GUZA 4X20B 1NKDA 2EIKB 2WA3A 4LP8A 4BSQA 1NR1A 4DR7B 4I55A 2XAFA 3PHUA 4X88A 3I5DA 2QKCA 4YYWA 4PI2A 2YEVB 3E1ZB 1VQNV 2UUAO 1YHQV 2PYJA 1SQGA 3J80N 2LFRA 1N34B 1S5LZ 2AUXA 5CA0B 3UO3A 3BPMA 1PPPA 2F23A 4PDLA 4CZWA 4K8ZA 1EFRG 1V55C 2R70A 5CMUA 1I0HA 3P3NA 4UCSA 4D7TA 5L3DA 4I7ZB 3UO2A 2L6LA 1VP7A 2K1EA 1TLOA 2FQ9A 5JVDB 1H8HG 1R6KA 3BWKA 3RGBA 4Z1MG 3ZRWA 2UU9B 2JK5C 1XI1A 4P6GA 5KHGA 1BE3H 3X2QC 1YF2A 2ZKOA 2RCVA 2WLMA 2EIJC 4DR5O 5IWAB 4UV8A 4MTGA 3R65A 3BPFA 4OX9B 4FJCA 1TUBB 2F4VB 4UCUA 3MTVA 1NQCA 4J9ZB 3KSEA 2JGDA 3RW0A 4XZXA 2DC6A 2RN9A 1MA1A 4K3AA 3C3SA 4BW9A 3F7YC 1O0EA 1XL4A 3S3QA 1MNGA 3F5VA 2OCCB 5J94A 2EIMB 1Y74A 3I55V 1Q81W 2HG5C 1MHWA 4ZKIA 1JX9A 1D5NA 1M56B 4WURA 1YIJV 2OIEA 4DV1B 1SERA 3BOWA 3H1HH 2QM8A 5GTHZ 3APQA 3QTCA 4I0XB 1PL0A 1U9VA 5PADA 5KMGB 3TJTA 3C3TA 3ZRXA 4W5BA 3FKSG 3V6CA 3JD3A 2QWQB 1FD9A 5GONB 4I04A 3ZMTA 1N32B 3RYFA 4DK1A 2CTPA 4UB6Z 1PM9A 5LGUA 4CC5A 1U97A 3FYIB 4QPJA 1VARA 3IC9A 3AG2C 4P6EA 2DWEC 4HBNA 2NQAA 1SQPH 1AU2A 1F29A 4RNAA 3QF7A 4JI2O 3SYPA 3J81N 2GV9A 3RVXA 4B7KA 3H01A 4O4IB 1O9HA 4N23A 3EXAA 1F2CA 1EZJA 4X65O 5K16A 3B09A 4YJ3B 5KAIZ 1LR1A 4X6HA 3P5VA 5JH7B 1SZTA 4J7ZA 1FXKB 4ZBMA 2N05A 2H8PC 5J2TB 3C9EA 2FYEA 2XU3A 2ARHA 3B79A 4JI5B 3JAWA 4PDMA 1XMOO 4IUMA 2GUZB 2LQTA 1SF9A 3SR2C 3AG7A 1NVPD 5IDJA 3P3PA 4FIPA 4K7CA 1KU9A 2GTAA 2WAMA 4Q8GA 2PUSA 5LGTA 1CXZB 2Q4PA 1UFIA 2FYUH 5LA6B 3BAAA 3D36C 1VQ7V 3PN1A 4DMXA 4JI4B 4L8JA 1QR9A 5FLXN 5C8YB 4JYBA 1GKFA 1PE6A 3ABLC 4BOZA 1K4CC 1S4VA 3FB6C 1YJNV 3ASNB 3IC7A 2Y4UA 4EB6A 1U9XA 4PI0A 3ABUA 1VQ5V 1GM7A 3UQ8A 4B3SB 2QEXV 1XILA 1F51A 1GRJA 3K0DA 4LF6B 4R8CA 1NLJA 1OCCB 3KKYA 4J41A 4I9QA 4IT5A 4JI7O 3OTOO 1Y4MA 4TQDA 1Q86W 4WA6A 4KLBA 1MS6A 3HKBA 2H7JA 3CCMV 2FL4A 3E86A 2ATOA 3D3QA 2XAJA 1HNXB 2JGDB 1D2DA 3CRAA 3RVVA 3ETEA 4ZHQA 4LF5B 5LYJA 2HHHO 2IH1C 1POPA 5LP6B 2OULA 1Y66A 1YDXA 4DR6O 3T2MA 2PTMA 2WLHA 3LUTB 4JTAB 5EYPB 3MDSA 3AG3B 2ITCC 4JYCA 4LF8B 3ETQA 1XUQA 1WAZA 5EK0A 1Q6HA 1BQZA 3UM7A 3S3RA 3G6EV 2UUAB 2E3CA 4JYAO 1WNSA 1N33O 5DN6G 2OT5A 1MG1A 2Q9LA 3KWBX 1MZEA 4FJCC 2H94A 1G1XB 5KUMA 5CVNB 2CK3G 3CCQV 1QVFU 4UCRA 4CZZA 2JJ1G 2RJZA 4TOIA 2AW9A 3F5WC 3CBKA 5KHJA 1Y08A 4MW8A 3CP1A 3RBZA 3ZHQA 3K9MA 3FX7A 2DC8A 1PVJA 1US6A 1NB5A 4LFAO 4A5UA 3RYFB 1RFYA 5EC2C 1ZCMA 1NU1H 3OQCA 1THEA 3TCUA 3W7TA 2IU3A 3HB3B 5DEDA 2FTDA 4PJ0Z 1GN6A 4KUMA 3PJSK 1KP2A 4UCTA 2H3OA 2CGNA 3GWKC 4DR5B 1JQPA 2FRAA 1AJQA 4JAUA 5KX5A 4DRXB 4Z2WA 5L3BA 3BY6A 2JDIG 3ZCCA 1I5YA 1QLEC 2YUAA 2AS8A 5H2FZ 1XKGA 1FJGO 3M99A 4CDDB 3CEIA 2X6AA 1NQTA 4JI3O 5LXTB 3W7UA 1H2LA 2AYNA 4I50A 2DQ3A 2MK3A 3ZUAA 2OZ2A 3WFVA 1AP5A 1R1BA 2WA4A 4D8IA 3BCNA 2DJVA 1TL9A 1K3EA 4TV9A 1SQVH 1VQKV 2ODMA 3DXRA 3CCJV 1BGOA 2Q0AA 5B1OA 1H38A 5B1AC 1COWG 3WXGA 5CHVA 4CS2A 5IT9N 3TGUH 1HUCB 3H1LH 2EZOA 3CRQA 4QRXA 5IYZB 3N27A 2G8JA 1MMMA 2QTOA 4YIPA 1SESA 1QVGU 4MVSA 1V54C 4O4HA 5BY1A 4KHPO 1GO3F 1BZKA 2D3OW 5IYDO 1ZUQA 1ZL8A 5B1BB 1ZX3A 3K5LA 3G80A 1ATKA 1AI6A 1HWYA 3BA8A 3HR0A 3AK2A 4PI3A 4EB6B 4D7SA 3LNMB 1R6NA 2P4KA 1DK1A 2PI5A 2C0YA 4J7JA 1AJPA 1OCRC 3JALA 3P5UA 3MD0A 4OGQB 4JI2B 4ZI7B 1HW7A 3B8MA 3K5OA 2BE3A 5EBMC 1CVZA 2CH7B 3ETGA 4MVQA 4X65B 1AJNA 2HP8A 2OTJV 4X1KA 1H2NA 4FK5C 5FPWA 3IFUA 1IDSA 2W6IG 3MHSA 2A06H 4F6EA 4ZHQB 5LYJB 4CH5A 4IL6Z 4LWSA 3ABMC 4MS2A 1YSCA 4XR7A 2E75B 4PP1A 2JEXA 4DV0O 3JD0A 2EZPA 4LNUA 5IY5C 1XMOB 1JVMA 1RP3B 2IBZH 4WFHA 2CIOA 4GX2A 1Z5WA 4IIJA 4X20A 2RDCA 5IYCO 3O1GA 5LMNO 1SNKA 4K8XA 5CA3A 5AG2A 2YEVA 3AG1C 2JQFR 3NHEA 3APOA 2BOCC 4U7NA 2DCDA 2EILB 1FKAO 2Q7EA 3SPCA 3MJ5A 1RPRA 4DR4O 2IW5A 4QE7A 1NPZA 5A24A 3QJ3A 1WPXA 2Q5ZA 3T1HO 4A5UB 4CH4A 1BMFG 4X6JA 2IJIA 1Z5VA 5H9CA 2Z0AA 3CRMA 2P06A 5D5QA 2X7RB 3MHHA 4MVMA 2ZR2A 4GX1A 2OP3A 2Y6EA 3JAKB 1WP8A 4GX0A 4X89A 5EZYA 1B6QA 5JCOC 2WWWA 4JI7B 3OTOB 1TVKA 2PY5A 3L70H 1J5EO 1P84F 1OZ0A 1KBHA 1HR0O 2ZINA 1TUBA 4YVAA 3TETA 3RVYA 3M99B 2QE7G 1UJWB 1ZAUA 2HHHB 2N04A 3MP2A 2ACTA 2BTWB 1NS1A 2BU3A 1RM1B 4I50B 3P32A 4DR6B 3RT3C 3H1JH 4MVZA 2C2AA 3PNRA 3ZS8C 4GX5A 4LH7A 2DYRC 2PBHA 3DXRB 4JYAB 2ZE8A 1N33B 3QVNA 4NVPA 2HVKC 1MOFA 3HPLC 2PI4A 1Y76A 2XAGA 1Q5OA 1IZ3A 3RN4A 2F1MA 1XHXA 4I0XA 4ICGA 3N3KA 2OTLV 2AHYA 2PF4E 1QMYA 1HNWO 5JA7A 2WLJA 4O4HB 5CB4B 4H0LB 4LFAB 1KXRA 2HJFC 1FXVA 3HHAA 1H2GA 1ZL8B 2Z84A 3ZHRA 4FM1A 4JI8O 5L3FA 3H7DA 1BQIA 1GM9A 3TXSA 1I7FA 4LC1A 5E6JA 3K06A 4FM0A 3JALB 5BXZA 1NBMG 1R3LC 1GLOA 1FAFA 2Z3YA 2WLNA 3H9VA 3B8NA 3HKEA 4DV4O 4JI1O 1PBHA 1BQ0A 3BCCH 1FJGB 4O4IA 3LDCA 3N4CA 1P4RA 1FFXA 1F2AA 2QKAA 4JI3B 1DF0A 1AVMA 4YJ3A 3ZX6A 3ABKC 4LR3A 2AIMA 2LGWA 1K4DC 4LWSB 4GZRB 1WA8A 1KKDA 3JYCA 1YEWA 3K0GA 1SETA 5TISZ 3ZMSA 1YXBA 4LNUB 5J2TA 2DMXA 3OMIB 1SRYA 1YK8A 2YI9A 4IIJB 5EBLC 3RYHB 3AK3A 5J2UB 2BSKA 5H5NA 3PHWA 2ZQMA 3CRCA 3WU2Z 3A8TA 4NTXA 3B4SA 1P7BA 3T1CA 3JARA 5LA6A 4KHPB 2X6CA 1XNQO 4PADA 4ZOLA 3EVKA 2R9NA 4JPRA 1X59A 1CQDA 1Z2GA 4DUZO 4UVAA 5C8YA 1VQOV 1OCOC 2IBIA 2FB5A 5HFMA 4X66O 3U0ZA 3HHIA 1DGSA 2E5LB 2NQIA 2EIKC 4QRVA 5HFLA 4WFEA 5EZYB 2B1MA 2PZSA 4QIWF 3IUTA 1TVKB 2WLKA 4LCUC 1K9MW 4F6RA 1ORQC 1KD1W 3IFXA 1EM1A 2A0LA 2V4DA 1VIBA 1XHZA 4RQEA 4G54A 4IGGA 1IVSA 3KX1A 4PA3A 1M1KW 3JD1A 1H2MA 1S72V 4LFBO 3P5XA 3D3IA 4NR1A 5KA6A 1MEGA 4I07A 2F95B 3TXQA 2CE4A 3OVZA 3JSNA 4DV0B 5LP6A 3K5MA 1CV8A 3ZMUA 1CS8A 4XDKA 3CBJA 3U10A 4PA9A 1EN6A 5EYPA 3MHHC 3BY4A 1PPJH 3VQYA 2JTCA 4LF7O 2AYOA 1Q6KA 4N4ZA 1F7YA 5LMNB 3K59A 4FPPA 3SYAA 3EFFK 1YTFD 1AIMA 3TRKA 3CH2X 1Y76B 3MORA 1U5IA 1KECA 4RWUA 4N8WA 3SJAC 3GB7C 2YIBA 5CHTA 4DR4B 2NQGA 3T1HB 3K9SA 3BVOA 4H37A 1XEQA 2EX3A 3JASA 3OE7G 2OCCC 2EIMC 3H6SA 2QWPB 1H2SB 2ZXWB 1AU0A 1M56C 3MTNA 2FTKA 4Q8HA 3G4SV 2P86A 2X0LA 2EBOA 1LUWA 2UXCO 2FO5A 3PRMA 1YK7A 4YYQA 4PDRA 1J5EB 2YJBA 4XDJA 1HR0B 1N0NA 3B21A 2JEUA 2QJ1A 3HKEB 4DRXA 5KLVH 1GECE 4FZ0A 2XU4A 2AZ0A 5GW7A 3THOA 1AR1B 1FFXB 1QCEA 4O4JB 3IHPA 2LP7A 1JQ0A 4NXMO 5IJ0A 5LXTA 4P9PA 2K9PA 4UXNA 2WLIA 1HDJA 2EINB 2JS5A 3O9OA 2BOBC 4JAVA 1EZVH 1G8MA 4Q6GA 1WA8B 2EJRA 2LGQA 5B3SB 3DF0A 4TV8A 5FNVA 1GAXA 2ZNIA 4X1YB 3C0RA 4DV3O 2KG7B 4FLXA 2NLJC 1LUVA 2RQ6A 1QLNA 3OVXA 1Y67A 2BSKB 2KKWA 1WPBA 1CJLA 3HD3A 2HFEC 4CDCB 4DO2A 5LMUO 1KHPA 5EGWA 2CTWA 3RYCB 5IYZA 3JARB 1HNWB 1M6DA 2J7QA 1IWDA 2GHYA 1MSWD 4ZOLB 2HH5A 4QJFB 2QSAA 3KCXA 4ZUXU 4JI8B 4KXRA 4RUEA 3AG4B 1I5XA 1SP4B 3H8CA 1FXKC 2AHZA
chains in the Genus database with same CATH topology
5A2QN 3PHUA 2ZM6O 3RNVA 3TRKA 1D2DA 2HWKA 1XNRO 4M0WA 2Z0AA 5IT9N 2UUAO 2UXDO 4YY3O 4REZA 3J80N 2VQFO 2HHHO 2BTWA 2E5LO 2FKXA 4K0KO 1IBKO 2UU9O 3E9SA 3PRPA 4R3DA 4DR6O 4BOPA 5BY1A 4X62O 4KHPO 4RNAA 4JI2O 5EZQA 4NXNO 2N74A 1J5EO 3J81N 5IWAO 1XMQO 1HNZO 3PHXA 1HR0O 4RF0A 1XEQA 3PSEA 2LW7A 4JV5O 1DKIA 4BOSA 2UUCO 5JZEA 4PT5A 4JI5O 4OX9O 4OVZA 4X65O 5BR8O 5H5NA 3PHWA 4HXDB 4JYAO 3BBAA 1N33O 2F4VO 2FE8A 4JI6O 1DK1A 3MP2A 1G1XB 2BTWB 1NS1A 2UXCO 2BU3A 5LL6Y 3PRMA 4GUAA 3RT3C 5EZSA 2ZKOA 4DUYO 4DV5O 1XNQO 4DR5O 3B21A 1X59A 4LF4O 4GKJO 4DUZO 1PVJA 1XMOO 4DV2O 4IUMA 4JI4O 4DV6O 1I94O 4LFAO 4A5UA 1AB3A 4IP3A 3OQCA 3W31A 4X66O 3MTVA 4DV1O 3IFUA 4XZXA 4RKXA 1A32A 4RF1A 5KO3A 2UUBO 4NXMO 4MI7A 3SDLA 4B3TO 4P16A 1YZBA 3TMPA 3W30A 4B3MO 4DR2O 4B3SO 1HNWO 4DV0O 4OPAA 1KUQA 4BOUA 1R6TA 4LF6O 4DR1O 3J7AU 1UKFA 4GKKO 3C0RA 4DV3O 5FLXN 2UXBO 4MM3B 4YHHO 4OW0A 4WURA 1N36O 2Z84A 3PT2A 4JI8O 4D8BA 4BOZA 4OVZB 4DR3O 1N32O 5LMNO 4DV7O 1FJGO 4BOQA 4DR7O 4LFBO 1HNXO 4JI3O 5LMUO 3F5TA 2J7QA 4JI0O 4LF5O 5E6JA 4AQYO 3R66A 1FYJA 5BXZA 3M8AA 1N34O 3JAMN 2VQEO 3O65A 4X64O 2DOSA 1FKAO 2UZJA 4LFCO 1R1BA 3BB7A 4D8IA 2DJVA 4OPHA 4DV4O 3BY4A 4JI7O 3OTOO 4DR4O 1AILA 4LF9O 3MJ5A 4JI1O 2JTCA 4ZTBA 4LF7O 3T1HO 4LF8O 4B3RO 2J7QC 3ZNHA 1F7YA 2AGAA 1IBLO 4A5UB 2JRIA 3T1YO 4D8EA 1IBMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q N;  2ZM6 O;  1D2D A;  1XNR O;  2Z0A A;  5IT9 N;  2UUA O;  2UXD O;  4YY3 O;  3J80 N;  2VQF O;  2HHH O;  2E5L O;  2FKX A;  4K0K O;  1IBK O;  2UU9 O;  4DR6 O;  5BY1 A;  4X62 O;  4KHP O;  4JI2 O;  4NXN O;  2N74 A;  1J5E O;  3J81 N;  5IWA O;  1XMQ O;  1HNZ O;  1HR0 O;  1XEQ A;  2LW7 A;  4JV5 O;  2UUC O;  4JI5 O;  4OX9 O;  4X65 O;  5BR8 O;  5H5N A;  4JYA O;  1N33 O;  2F4V O;  4JI6 O;  1DK1 A;  1G1X B;  1NS1 A;  2UXC O;  5LL6 Y;  3RT3 C;  2ZKO A;  4DUY O;  4DV5 O;  1XNQ O;  4DR5 O;  1X59 A;  4LF4 O;  4GKJ O;  4DUZ O;  1XMO O;  4DV2 O;  4JI4 O;  4DV6 O;  1I94 O;  4LFA O;  1AB3 A;  4X66 O;  4DV1 O;  1A32 A;  2UUB O;  4NXM O;  3SDL A;  4B3T O;  1YZB A;  4B3M O;  4DR2 O;  4B3S O;  1HNW O;  4DV0 O;  4OPA A;  1KUQ A;  1R6T A;  4LF6 O;  4DR1 O;  3J7A U;  4GKK O;  4DV3 O;  5FLX N;  2UXB O;  4YHH O;  1N36 O;  4JI8 O;  4DR3 O;  1N32 O;  5LMN O;  4DV7 O;  1FJG O;  4DR7 O;  4LFB O;  1HNX O;  4JI3 O;  5LMU O;  3F5T A;  4JI0 O;  4LF5 O;  4AQY O;  3R66 A;  1FYJ A;  5BXZ A;  3M8A A;  1N34 O;  3JAM N;  2VQE O;  3O65 A;  4X64 O;  2DOS A;  1FKA O;  4LFC O;  1R1B A;  2DJV A;  4OPH A;  4DV4 O;  4JI7 O;  3OTO O;  4DR4 O;  1AIL A;  4LF9 O;  4JI1 O;  4LF7 O;  3T1H O;  4LF8 O;  4B3R O;  1F7Y A;  2AGA A;  1IBL O;  4A5U B;  2JRI A;  3T1Y O;  1IBM O; 
#chains in the Genus database with same CATH topology
 4N21 A;  2ZM6 O;  3SJQ C;  1ZLZ A;  4P9O A;  2UXD O;  4YY3 O;  3F7V C;  5DEC A;  1GN2 A;  1OHH G;  3GWO A;  1IBK O;  4PV1 B;  1BCC H;  4DV4 B;  4ZI7 A;  3FYE B;  4JI1 B;  3JSL A;  3U11 A;  3L74 H;  4F6R B;  4RF0 A;  2ZE7 A;  2CH7 A;  5F2V O;  1FS0 G;  2R9I A;  1F23 A;  1CPJ A;  4JV5 O;  3PBH A;  3HKD A;  2XHB A;  4OVZ A;  1VJV A;  4I9W A;  4XBF A;  2CDY A;  2YI8 A;  2IJJ A;  4PEL A;  2XTA A;  3UCS C;  2FML A;  1ROP A;  5B1N A;  2HKO A;  3RYI B;  2DW4 A;  4PA6 A;  3ASN C;  4JF3 A;  1K8A W;  2Q6A A;  2DJG B;  2ETN A;  4DV6 O;  1F2B A;  3QO7 A;  1OCZ B;  1OCC C;  1GM8 A;  3K03 A;  1Q82 W;  1SKV A;  1A32 A;  1N0J A;  5EIB D;  2F7D A;  1ENV A;  2AZ2 A;  1XNQ B;  1AU4 A;  3OGC C;  4FLZ A;  1KUQ A;  1CB5 A;  4DUZ B;  2DQ0 A;  1PP9 H;  4GKK O;  1WLE A;  2DYS B;  1S76 D;  5B5E Z;  4X66 B;  3JAS B;  5LP6 C;  2ZD9 A;  2B9Z A;  3AG3 C;  3QG5 A;  3D6S A;  4BIZ A;  5DM6 V;  1M93 A;  3FB8 C;  1RSO A;  3CC4 V;  4BAY A;  3H1I H;  5E1A C;  3JAK A;  4RAI A;  3B2E E;  4W5C A;  3M8A A;  3CC7 V;  2FRQ A;  4WF9 V;  2PYL A;  3ZMV A;  1VSN A;  2DC9 A;  4UFZ A;  4ZTB A;  4YJ2 B;  3OF9 A;  2HHN A;  4J80 A;  3OAA G;  1E1R G;  4LFB B;  2E00 A;  1PNL A;  2HWK A;  1XNR O;  5IJ0 B;  1ARO P;  1AI7 A;  2VQF O;  4Z1V A;  2BTW A;  4DW0 A;  1M57 B;  2WLI B;  3K79 A;  2O57 A;  4K0K O;  5CVM A;  1QXP A;  3PRP A;  3VQV A;  4HZ3 A;  4TV8 B;  4NB5 A;  5FNV B;  1Q6U A;  1D5A A;  2HR3 A;  4IYI A;  4LF7 B;  1NH2 B;  5EZQ A;  2IJH A;  3OTF A;  1L0N H;  1NL6 A;  4F4L A;  3KW9 A;  1IXB A;  4H13 B;  4DYL A;  2LW1 A;  3KG2 A;  1WJZ A;  1EWP A;  1AYV A;  2HJD A;  2G8E A;  1W59 A;  2XAS A;  1PPO A;  1VQL V;  1VQM V;  3BHP A;  1SQQ H;  4BWA A;  3ZRS A;  5KUK A;  3CCU V;  2ZDI A;  3CD6 V;  3WB0 A;  5CB4 A;  3ASO B;  2PNS A;  2NN4 A;  3ZN0 A;  3I3T A;  3DC6 A;  4FMT A;  3IMA A;  1GK9 A;  1KMI Z;  4FLY A;  4MTF A;  2YIA A;  2UXC B;  3A0H Z;  4B3T O;  1G4Y B;  2DCA A;  4FIP C;  4B3M O;  3BA9 A;  4JYY A;  4MVO A;  3CCL V;  1JMK C;  1VF7 A;  1R6T A;  2KSD A;  2ZE5 A;  2FT2 A;  1PNK A;  2Y5B A;  4OEM A;  1CTE A;  4YHH O;  4NTY A;  4DMY A;  2O6X A;  3T4D A;  2M7W A;  3HKD B;  1PPN A;  3FFQ A;  3DGE A;  3DSQ A;  3W7S A;  4OVZ B;  4U3J B;  5L3G A;  2DE0 X;  4NXM B;  1K7D A;  1DF5 A;  1HP8 A;  4LH6 A;  2JJ2 G;  4EFB A;  1MAB G;  5B1B C;  1FYJ A;  3E2E A;  2GSM B;  2R9M A;  4UCO A;  2VQE O;  4O4L B;  4FVM A;  2BTO A;  2WSS G;  2WLL A;  1AIL A;  3E83 A;  1VQ4 V;  1ZIV A;  4CS3 A;  4B3R O;  1SQX H;  1IBL O;  2CB5 A;  2OWO A;  1JR9 A;  2YJ9 A;  2W0F C;  1VF6 A;  2NNU A;  2B1I A;  2QR4 A;  3OEE G;  3RYH A;  5J2U A;  3JD4 A;  5LMU B;  3VQX A;  2IM9 A;  4AHC A;  4YYS A;  2RMK B;  5JQG A;  3BFR A;  1W0K G;  1K5S A;  4R7C A;  1Q43 A;  3CWB H;  1QNM A;  3WXE A;  2YC0 A;  1E1Q G;  3CPW U;  3DTU B;  1KQS U;  2Y0P A;  2P4V A;  1H8E G;  5LHG A;  2QWO B;  4NYK A;  2AU1 A;  2ZM6 B;  1WB8 A;  5JJJ B;  4E4E A;  2LO1 A;  2Q67 A;  2YXY A;  4MTO A;  2UXD B;  4HXD B;  5ITZ A;  4YY3 B;  1F4M A;  3E8H A;  2IU0 A;  1EN4 A;  2X6B A;  1QHT A;  1K92 A;  3E8B A;  4G2K A;  4N79 A;  1RSO B;  5C93 A;  2GFO A;  1IBK B;  2GDS A;  3OFN G;  1F4N A;  3CJH A;  4GUA A;  3KWZ A;  5CA1 A;  4CDE B;  4DUY O;  1MSD A;  1V9P A;  1ZTE A;  3K04 A;  4JV5 B;  3P5W A;  3K08 A;  4GKJ O;  4DV2 O;  2ZNJ A;  2EIL C;  1IX9 A;  2YIB D;  3FB5 C;  4FLU A;  1XOU A;  1GTO A;  4RF1 A;  1QQC A;  1GMY A;  3K8U A;  2GHU A;  3WG7 B;  4P16 A;  2E74 B;  2R9F A;  4NKG B;  4J42 A;  1SS3 A;  4DR2 O;  3PDF A;  2R9C A;  3SPG A;  1WP7 A;  1U9W A;  3QO5 A;  4DV6 B;  4J10 A;  4ABM A;  5JJE B;  3Q4H B;  5B66 Z;  2Y69 B;  5LGN A;  3CSX A;  1IXM A;  1MEM A;  1KKC A;  1TAE A;  4YXW G;  3IAY A;  3OEH G;  5KHH A;  2P0R A;  1SA0 B;  3KZI Z;  3OR6 C;  3HKC B;  4BQV A;  1GH6 A;  1DEU A;  3JCZ A;  4GKK B;  4LFC O;  1BGY H;  4QPK A;  1R3J C;  3OD4 A;  1RM1 C;  2ZT9 B;  1JOY A;  3T1Y O;  3G67 A;  1K73 W;  4H33 A;  5A2Q N;  3CCV V;  4L87 A;  2G7Y A;  1QOL A;  3RWR D;  3B40 A;  3QT4 A;  4KFM A;  3H8B A;  3RFR A;  1NH2 D;  4REZ A;  3ML0 A;  3CS5 A;  1VQP V;  2FKX A;  3OIS A;  2R72 A;  1B04 A;  5K1P A;  1M9N A;  4G28 B;  2XT9 A;  1IUR A;  1TU6 A;  1NR7 A;  4HWY A;  3PHX A;  4O2B A;  1I08 A;  2ITD C;  2VHS A;  2LW7 A;  1DKI A;  4R6Z A;  2F1G A;  1URF A;  5JZE A;  3EHB B;  4MW3 A;  1XNR B;  4FLV A;  4O4J A;  1YJ9 V;  5CBF A;  3V6E A;  2VQF B;  3ZHU A;  3OMA B;  1H2K A;  2QWR B;  4K0K B;  2DZY A;  4XUI A;  4MZS A;  1NVP B;  5LL6 Y;  6PAD A;  2VWK A;  3SJB C;  2ZCE A;  3FAV A;  3STL C;  1JCH A;  1WN7 A;  3BPZ A;  1KFU L;  3E8G A;  2WLL B;  1LNQ A;  4X1Y A;  5FPR A;  1ME4 A;  2KG7 A;  1KP3 A;  4BS5 A;  4JZG A;  4AI8 A;  3QNE A;  1YI2 V;  1JFF B;  1V55 B;  3SDL A;  1YZB A;  2DWD C;  2Z5U A;  3RYC A;  1AI4 A;  5JQG B;  4BS6 A;  4UVC A;  1JJ2 U;  4NTW A;  3ZJZ A;  5BZB A;  3MHS C;  3SPJ A;  4B7E A;  2G6D A;  4DR1 O;  4JZ2 A;  1AR4 A;  1QR8 A;  2QKS A;  3OR7 C;  2L35 A;  1N36 O;  2CGO A;  5LOV A;  4CC6 A;  3L73 H;  3CCS V;  4DV7 O;  3X2Q B;  4CBC A;  2WBF X;  2UXX A;  5ITZ B;  2QA4 V;  4B3T B;  4JTC B;  2EIJ B;  3W7W A;  3G6B A;  3BC3 A;  3CMA V;  4B3M B;  1STF E;  1PPD A;  1VF6 C;  4AQY O;  3CJH B;  4X9Q A;  4EFE A;  2YIC A;  3JAM N;  5CA1 B;  3L9D A;  1VQ9 V;  2UZJ A;  3K24 A;  4YHH B;  4UVB A;  3OUF A;  2W0X A;  3A0R A;  1S0V A;  2JS3 A;  3N2G A;  3BRC A;  3SJC C;  3CC2 V;  1AEC A;  1EWL A;  3ZIA G;  3JAT A;  1MZF A;  2XND G;  4UUJ C;  2ADP A;  3ZMZ A;  2PRE A;  3CX5 F;  4JAS A;  4K35 A;  4P2Z A;  1KC8 W;  2VQE B;  3GCB A;  3RYI A;  3E9S A;  1J95 A;  3JD2 A;  4UCV A;  2ADQ B;  4FM2 A;  4B3R B;  5EC1 C;  1IBL B;  1S77 D;  4DXW A;  3JCU Z;  1XMQ O;  3PSE A;  4CDF B;  4XDL A;  5CBH A;  1EWO A;  4PT5 A;  1XDC A;  4G27 B;  4QGP A;  3B77 A;  3ZHS A;  2GBO A;  5K1X A;  1TUE B;  5EIB C;  2ZR3 A;  1BT8 A;  4IHJ A;  1Q3E A;  4PDV A;  2JVD A;  1BS3 A;  1BY8 A;  2Y48 A;  1EF7 A;  4CS4 A;  2Q7H A;  3BEH A;  3LSQ A;  4RUF A;  4TUY A;  2W6J G;  4AIL C;  3UT5 B;  1JA8 A;  2EUL A;  5CVO B;  3I56 V;  1NT2 B;  1AB3 A;  4IP3 A;  3AG2 B;  5BMV A;  3K9A A;  2NR5 A;  4E2L A;  1QU7 A;  4J7K A;  3LSS A;  2LJ2 A;  5H6Q A;  3TMP A;  1VQ8 V;  3CH3 X;  4DUY B;  1BP4 A;  3CXC U;  4QH6 A;  4JAA A;  1VQ6 V;  4GKJ B;  4GLX A;  4DV2 B;  1YCI A;  1NI8 A;  2BTQ B;  2YDE A;  4X1I B;  3K5N A;  4O2B B;  4YJ2 A;  2BDL A;  4J9Y B;  1PCI A;  3PT2 A;  4DR3 O;  4X8A A;  3CME V;  2BDZ A;  4BOQ A;  1ZSP A;  2VHF A;  1S3J A;  2Q68 A;  3CCE V;  2Y4T A;  4DR2 B;  5F02 A;  2DCC A;  4JI0 O;  1PXV A;  1NJI W;  1Q6I A;  4WFF A;  3AI8 A;  4X64 O;  2DOS A;  2ZXW C;  1FH0 A;  3FAV B;  4H44 B;  2XAH A;  4YYV A;  2YS8 A;  4B08 A;  1BL8 A;  4W4U A;  4EKW A;  2Q8V A;  1NTM H;  3OUS A;  4EEQ A;  5KA5 A;  3SYC A;  2YXL A;  1KYO F;  4M0W A;  2QM4 A;  2R9A A;  3FB7 C;  2A7W A;  1Q7Y W;  2A9H A;  3D8C A;  4LFC B;  4PA4 A;  3ABL B;  3CB2 A;  4R3D A;  2G38 A;  2PGG A;  3KCY A;  3NXS A;  4QE9 A;  5H6R A;  4LBE C;  3T1Y B;  2DJF B;  5FL7 G;  2EIN C;  2P5O A;  2UUC O;  1SQB H;  4BR6 A;  5LOV B;  5B3S C;  4I55 B;  2HD5 A;  3O0U A;  2P67 A;  1A6R A;  4YYR A;  3E22 A;  1K5Q A;  4WCE V;  5BR8 O;  3WB1 A;  1R73 A;  3BBA A;  1Y4H A;  1B3Q A;  2BCC H;  4JI6 O;  4HYO A;  2HVJ C;  4FFB A;  4DK0 A;  1XL6 A;  4RY2 A;  4GCZ A;  5KHK A;  1NZ6 A;  4PHZ A;  4FK5 A;  1AYW A;  3RVW A;  3SPI A;  3LSU A;  4LF4 O;  1PNM A;  4AXM A;  1YVW A;  3N2G B;  4MTX A;  4FLW A;  1I94 O;  3W7X A;  3ZBH A;  4BW5 A;  1VF5 B;  4U3J A;  3JAT B;  4OXS A;  1PIP A;  2ATK C;  2R9O A;  5KO3 A;  2UUB O;  3TNX A;  5IE9 A;  1YIT V;  7PCK A;  3ZRW B;  2D2C B;  4MI7 A;  3AG4 C;  2XU5 A;  2HEP A;  1GN4 A;  1DLB A;  1AYU A;  2YXH A;  4R50 A;  4O4L A;  4OPA A;  3F75 A;  1ZWI C;  2IJK A;  3RVZ A;  3PW3 A;  3OM3 B;  2F43 G;  4MVU A;  4PA7 A;  1FPO A;  3DC5 A;  2RNB A;  5JJN B;  2QGN A;  2DN9 A;  5FPO A;  1XQ8 A;  4IHJ B;  1PV0 A;  3R66 A;  4UV9 A;  1EBO A;  1KB9 F;  1DTO A;  4DR1 B;  1P7G A;  4J11 A;  1Y74 B;  1QDQ A;  4TUY B;  4WFB V;  1K34 A;  1N36 B;  4YIO A;  4LF9 O;  2E03 A;  4KL1 A;  4DV7 B;  2Q73 A;  1NTK H;  1VMG A;  1IBM O;  2Q0O C;  5BMV B;  2HLD G;  5JCO A;  3RNV A;  2JGU A;  2ARY A;  4QRG A;  3I06 A;  4RO2 A;  4AQY B;  4FZ1 A;  1MIR A;  3IOQ A;  4CH3 A;  4TWK A;  4YYU A;  2YJC A;  3ICX A;  1OCZ C;  2OIG A;  3L71 H;  1QLE B;  1X9Y A;  1R3K C;  4TQF A;  4WBN A;  4X62 O;  4BOP A;  4NXN O;  1HNZ O;  1CPY A;  2ZIM A;  3K58 A;  2Y0I A;  2PAD A;  4MSW C;  2EJ7 A;  2LFS A;  3U8E A;  1SZX A;  2KQX A;  3QO8 A;  2FE8 A;  1P49 A;  2DYS C;  4BIU A;  4RQF A;  5JH3 A;  3LFY A;  3LNN A;  1VEW A;  3CHX A;  1AI5 A;  2Q7G A;  1G6U A;  1PL4 A;  4DV5 O;  3KFQ A;  3SYQ A;  1XMQ B;  2P7T C;  5B1A B;  4OEL A;  4X6I A;  5GTI Z;  2OCH A;  5D5P A;  2NQD B;  3ERV A;  3LDD A;  1QBZ A;  2HXZ A;  3Q4H A;  3S3X A;  2F66 C;  5IJ9 A;  1B06 A;  2VRZ A;  2CTQ A;  3ZHV A;  4CH6 A;  4HAM A;  1WB7 A;  4RKX A;  5L3E A;  1E79 G;  1V54 B;  3LDE A;  3IV2 A;  2M6Y A;  1O9G A;  4U7O A;  2E02 A;  1UPG A;  1SA0 A;  1BHA A;  3HKC A;  4P30 A;  3AEI A;  3SGI A;  2QTS A;  1FFT B;  1YAL A;  1W0J G;  3VQW A;  3SPH A;  2Q69 A;  3J7A U;  3K3W A;  1UKF A;  4W4L A;  2QWN B;  3ZN1 A;  2UXB O;  3JAW B;  4OW0 A;  1M57 C;  5E79 Z;  4I4T A;  2R6N A;  1OCR B;  1U9Q X;  3E22 B;  3P30 A;  3IGA C;  4DR7 O;  9PAP A;  3F5T A;  3CXH F;  4FFB B;  1THZ A;  4O2A A;  3VBB A;  1M5I A;  4QBB A;  1N34 O;  3OGI B;  2KB1 A;  2V1D A;  3O65 A;  3BB7 A;  1W2B U;  2YJ8 A;  2J7Q C;  3ZNH A;  4DR3 B;  3ZHT A;  2AGA A;  2JRI A;  3ABM B;  1PAD A;  2VWJ A;  2B1N A;  3M7M X;  2P90 A;  4MVR A;  1BHB A;  1K33 A;  3ASO C;  4DW1 A;  4D6T H;  5IY5 B;  4JI0 B;  3OMN B;  4X64 B;  2E5L O;  1GCB A;  1Y6X A;  2UU9 O;  4DV3 B;  3N3G A;  1KFX L;  3K57 A;  3FD9 A;  5IWA O;  1N8R W;  3AG1 B;  2XU1 A;  2CAZ C;  4PP2 E;  3HKB B;  4HNA A;  4FLT A;  2AVW A;  4BOS A;  2AXT Z;  3BAB A;  3ZED A;  4OX9 O;  1GMG A;  2IPP B;  2B5U A;  1U96 A;  1M4U A;  1AP6 A;  3IJ4 A;  2F4V O;  1JFF A;  3N2K A;  3WB2 A;  1CSB B;  3ETD A;  4PD4 F;  1K97 A;  1KHQ A;  5KHI A;  1AU3 A;  1PKX A;  2F93 B;  1GN3 A;  2UUC B;  2P7U A;  1M90 W;  2E01 A;  5BR8 B;  4JI6 B;  2ILM A;  4DV1 O;  4BIO A;  2XOK G;  3OW2 U;  3KKU A;  1K3B B;  3L75 H;  4TT3 G;  1S5H C;  3OF8 A;  5CA0 A;  1JJO A;  3USV A;  4LF4 B;  3CYO A;  3MAQ A;  4WBN B;  4ASU G;  3H89 A;  1I94 B;  2R9R B;  3ABT A;  5CN0 A;  5J9P C;  1YVB A;  4D8B A;  1N32 O;  2IH3 C;  2UUB B;  5JVD A;  1CP9 A;  1R3I C;  2A79 B;  1BSM A;  2MW2 B;  1PD3 A;  1XRE A;  2JIZ G;  3E8F A;  1EN5 A;  2P22 C;  2DYR B;  1Q90 D;  2OYQ A;  3WXF A;  4MSX A;  2GTS A;  1YTF B;  4FFK A;  3T4Z A;  5KX5 B;  4I5S A;  4TSF G;  2VS0 A;  4ZIB A;  5CBG A;  5JWP A;  1MDW A;  5LHI A;  4D8E A;  3A0B Z;  5IJ9 B;  1SQF A;  3OT7 A;  4GT1 A;  5L3C A;  1EWM A;  4BPV A;  1YJW V;  3STZ C;  2DCB A;  1ME3 A;  1X4T A;  5IYB O;  3G71 V;  4WFG A;  4KP4 A;  1AR5 A;  4LF9 B;  2ZIO A;  1T5E A;  4MZO A;  4WFA V;  4IYH A;  4TV9 B;  3WG7 C;  2QM7 A;  3TK1 A;  2N74 A;  1OV9 A;  3UKM A;  4JGS A;  3UT5 A;  1IBM B;  2JQG R;  3A2F A;  4JI5 O;  2V7Q G;  4I4T B;  4MT8 A;  3VOU A;  4U3F H;  4C7U A;  2XAQ A;  1N4C A;  2B1G A;  5KMG A;  1Q8I A;  4O2A B;  2Y69 C;  2CUG A;  4X62 B;  5EZS A;  4NXN B;  3CRR A;  1HNZ B;  3IEJ A;  3GVM A;  5GON A;  2YSU B;  3HWN A;  8PCH A;  2BTQ A;  2FUD A;  1S5J A;  4X1I A;  3ABK B;  4JI4 O;  3H1K H;  3SYO A;  1OJH A;  1FXH A;  1CEZ A;  3W31 A;  5A9G A;  4YV8 A;  1L0L H;  2ZDI C;  3ZRV A;  3LXS A;  4GYC B;  4Q20 A;  2CTR A;  3W30 A;  2WPD G;  2E76 B;  4DV5 B;  4I05 A;  4B3S O;  1ICF A;  2YJ2 A;  4AXL A;  4W4K A;  4BOU A;  4LF6 O;  1DF4 A;  1JPX A;  5EF4 A;  5LBQ A;  4MM3 B;  1NB3 A;  3L72 H;  3QSD A;  1TA8 A;  2DZZ A;  1L1F A;  4HNA B;  4QNH B;  1YT7 A;  4X1K B;  1XBL A;  3NR7 A;  3E89 A;  3CCR V;  5LHH A;  5EBW C;  3D36 A;  2A3Q A;  2DC7 A;  1TGO A;  1HNX O;  3N2K B;  2UXN A;  4GUN A;  4UB8 Z;  1SC5 B;  1ITO A;  1L8D A;  5JH7 A;  4LF5 O;  5KAF Z;  1OCO B;  3C90 A;  1FXK A;  3S3W A;  4JTD B;  2AUZ A;  3AK1 A;  1RPO A;  2QDO A;  2XUM A;  2UXB B;  2YID A;  2P6J A;  3E35 A;  4OPH A;  1NTZ H;  4LF8 O;  2ZE6 A;  3CE2 A;  2GUZ A;  4X20 B;  1NKD A;  2EIK B;  2WA3 A;  4LP8 A;  4BSQ A;  1NR1 A;  4DR7 B;  4I55 A;  2XAF A;  3PHU A;  4X88 A;  3I5D A;  2QKC A;  4YYW A;  4PI2 A;  2YEV B;  3E1Z B;  1VQN V;  2UUA O;  1YHQ V;  2PYJ A;  1SQG A;  3J80 N;  2LFR A;  1N34 B;  1S5L Z;  2AUX A;  5CA0 B;  3UO3 A;  3BPM A;  1PPP A;  2F23 A;  4PDL A;  4CZW A;  4K8Z A;  1EFR G;  1V55 C;  2R70 A;  5CMU A;  1I0H A;  3P3N A;  4UCS A;  4D7T A;  5L3D A;  4I7Z B;  3UO2 A;  2L6L A;  1VP7 A;  2K1E A;  1TLO A;  2FQ9 A;  5JVD B;  1H8H G;  1R6K A;  3BWK A;  3RGB A;  4Z1M G;  3ZRW A;  2UU9 B;  2JK5 C;  1XI1 A;  4P6G A;  5KHG A;  1BE3 H;  3X2Q C;  1YF2 A;  2ZKO A;  2RCV A;  2WLM A;  2EIJ C;  4DR5 O;  5IWA B;  4UV8 A;  4MTG A;  3R65 A;  3BPF A;  4OX9 B;  4FJC A;  1TUB B;  2F4V B;  4UCU A;  3MTV A;  1NQC A;  4J9Z B;  3KSE A;  2JGD A;  3RW0 A;  4XZX A;  2DC6 A;  2RN9 A;  1MA1 A;  4K3A A;  3C3S A;  4BW9 A;  3F7Y C;  1O0E A;  1XL4 A;  3S3Q A;  1MNG A;  3F5V A;  2OCC B;  5J94 A;  2EIM B;  1Y74 A;  3I55 V;  1Q81 W;  2HG5 C;  1MHW A;  4ZKI A;  1JX9 A;  1D5N A;  1M56 B;  4WUR A;  1YIJ V;  2OIE A;  4DV1 B;  1SER A;  3BOW A;  3H1H H;  2QM8 A;  5GTH Z;  3APQ A;  3QTC A;  4I0X B;  1PL0 A;  1U9V A;  5PAD A;  5KMG B;  3TJT A;  3C3T A;  3ZRX A;  4W5B A;  3FKS G;  3V6C A;  3JD3 A;  2QWQ B;  1FD9 A;  5GON B;  4I04 A;  3ZMT A;  1N32 B;  3RYF A;  4DK1 A;  2CTP A;  4UB6 Z;  1PM9 A;  5LGU A;  4CC5 A;  1U97 A;  3FYI B;  4QPJ A;  1VAR A;  3IC9 A;  3AG2 C;  4P6E A;  2DWE C;  4HBN A;  2NQA A;  1SQP H;  1AU2 A;  1F29 A;  4RNA A;  3QF7 A;  4JI2 O;  3SYP A;  3J81 N;  2GV9 A;  3RVX A;  4B7K A;  3H01 A;  4O4I B;  1O9H A;  4N23 A;  3EXA A;  1F2C A;  1EZJ A;  4X65 O;  5K16 A;  3B09 A;  4YJ3 B;  5KAI Z;  1LR1 A;  4X6H A;  3P5V A;  5JH7 B;  1SZT A;  4J7Z A;  1FXK B;  4ZBM A;  2N05 A;  2H8P C;  5J2T B;  3C9E A;  2FYE A;  2XU3 A;  2ARH A;  3B79 A;  4JI5 B;  3JAW A;  4PDM A;  1XMO O;  4IUM A;  2GUZ B;  2LQT A;  1SF9 A;  3SR2 C;  3AG7 A;  1NVP D;  5IDJ A;  3P3P A;  4FIP A;  4K7C A;  1KU9 A;  2GTA A;  2WAM A;  4Q8G A;  2PUS A;  5LGT A;  1CXZ B;  2Q4P A;  1UFI A;  2FYU H;  5LA6 B;  3BAA A;  3D36 C;  1VQ7 V;  3PN1 A;  4DMX A;  4JI4 B;  4L8J A;  1QR9 A;  5FLX N;  5C8Y B;  4JYB A;  1GKF A;  1PE6 A;  3ABL C;  4BOZ A;  1K4C C;  1S4V A;  3FB6 C;  1YJN V;  3ASN B;  3IC7 A;  2Y4U A;  4EB6 A;  1U9X A;  4PI0 A;  3ABU A;  1VQ5 V;  1GM7 A;  3UQ8 A;  4B3S B;  2QEX V;  1XIL A;  1F51 A;  1GRJ A;  3K0D A;  4LF6 B;  4R8C A;  1NLJ A;  1OCC B;  3KKY A;  4J41 A;  4I9Q A;  4IT5 A;  4JI7 O;  3OTO O;  1Y4M A;  4TQD A;  1Q86 W;  4WA6 A;  4KLB A;  1MS6 A;  3HKB A;  2H7J A;  3CCM V;  2FL4 A;  3E86 A;  2ATO A;  3D3Q A;  2XAJ A;  1HNX B;  2JGD B;  1D2D A;  3CRA A;  3RVV A;  3ETE A;  4ZHQ A;  4LF5 B;  5LYJ A;  2HHH O;  2IH1 C;  1POP A;  5LP6 B;  2OUL A;  1Y66 A;  1YDX A;  4DR6 O;  3T2M A;  2PTM A;  2WLH A;  3LUT B;  4JTA B;  5EYP B;  3MDS A;  3AG3 B;  2ITC C;  4JYC A;  4LF8 B;  3ETQ A;  1XUQ A;  1WAZ A;  5EK0 A;  1Q6H A;  1BQZ A;  3UM7 A;  3S3R A;  3G6E V;  2UUA B;  2E3C A;  4JYA O;  1WNS A;  1N33 O;  5DN6 G;  2OT5 A;  1MG1 A;  2Q9L A;  3KWB X;  1MZE A;  4FJC C;  2H94 A;  1G1X B;  5KUM A;  5CVN B;  2CK3 G;  3CCQ V;  1QVF U;  4UCR A;  4CZZ A;  2JJ1 G;  2RJZ A;  4TOI A;  2AW9 A;  3F5W C;  3CBK A;  5KHJ A;  1Y08 A;  4MW8 A;  3CP1 A;  3RBZ A;  3ZHQ A;  3K9M A;  3FX7 A;  2DC8 A;  1PVJ A;  1US6 A;  1NB5 A;  4LFA O;  4A5U A;  3RYF B;  1RFY A;  5EC2 C;  1ZCM A;  1NU1 H;  3OQC A;  1THE A;  3TCU A;  3W7T A;  2IU3 A;  3HB3 B;  5DED A;  2FTD A;  4PJ0 Z;  1GN6 A;  4KUM A;  3PJS K;  1KP2 A;  4UCT A;  2H3O A;  2CGN A;  3GWK C;  4DR5 B;  1JQP A;  2FRA A;  1AJQ A;  4JAU A;  5KX5 A;  4DRX B;  4Z2W A;  5L3B A;  3BY6 A;  2JDI G;  3ZCC A;  1I5Y A;  1QLE C;  2YUA A;  2AS8 A;  5H2F Z;  1XKG A;  1FJG O;  3M99 A;  4CDD B;  3CEI A;  2X6A A;  1NQT A;  4JI3 O;  5LXT B;  3W7U A;  1H2L A;  2AYN A;  4I50 A;  2DQ3 A;  2MK3 A;  3ZUA A;  2OZ2 A;  3WFV A;  1AP5 A;  1R1B A;  2WA4 A;  4D8I A;  3BCN A;  2DJV A;  1TL9 A;  1K3E A;  4TV9 A;  1SQV H;  1VQK V;  2ODM A;  3DXR A;  3CCJ V;  1BGO A;  2Q0A A;  5B1O A;  1H38 A;  5B1A C;  1COW G;  3WXG A;  5CHV A;  4CS2 A;  5IT9 N;  3TGU H;  1HUC B;  3H1L H;  2EZO A;  3CRQ A;  4QRX A;  5IYZ B;  3N27 A;  2G8J A;  1MMM A;  2QTO A;  4YIP A;  1SES A;  1QVG U;  4MVS A;  1V54 C;  4O4H A;  5BY1 A;  4KHP O;  1GO3 F;  1BZK A;  2D3O W;  5IYD O;  1ZUQ A;  1ZL8 A;  5B1B B;  1ZX3 A;  3K5L A;  3G80 A;  1ATK A;  1AI6 A;  1HWY A;  3BA8 A;  3HR0 A;  3AK2 A;  4PI3 A;  4EB6 B;  4D7S A;  3LNM B;  1R6N A;  2P4K A;  1DK1 A;  2PI5 A;  2C0Y A;  4J7J A;  1AJP A;  1OCR C;  3JAL A;  3P5U A;  3MD0 A;  4OGQ B;  4JI2 B;  4ZI7 B;  1HW7 A;  3B8M A;  3K5O A;  2BE3 A;  5EBM C;  1CVZ A;  2CH7 B;  3ETG A;  4MVQ A;  4X65 B;  1AJN A;  2HP8 A;  2OTJ V;  4X1K A;  1H2N A;  4FK5 C;  5FPW A;  3IFU A;  1IDS A;  2W6I G;  3MHS A;  2A06 H;  4F6E A;  4ZHQ B;  5LYJ B;  4CH5 A;  4IL6 Z;  4LWS A;  3ABM C;  4MS2 A;  1YSC A;  4XR7 A;  2E75 B;  4PP1 A;  2JEX A;  4DV0 O;  3JD0 A;  2EZP A;  4LNU A;  5IY5 C;  1XMO B;  1JVM A;  1RP3 B;  2IBZ H;  4WFH A;  2CIO A;  4GX2 A;  1Z5W A;  4IIJ A;  4X20 A;  2RDC A;  5IYC O;  3O1G A;  5LMN O;  1SNK A;  4K8X A;  5CA3 A;  5AG2 A;  2YEV A;  3AG1 C;  2JQF R;  3NHE A;  3APO A;  2BOC C;  4U7N A;  2DCD A;  2EIL B;  1FKA O;  2Q7E A;  3SPC A;  3MJ5 A;  1RPR A;  4DR4 O;  2IW5 A;  4QE7 A;  1NPZ A;  5A24 A;  3QJ3 A;  1WPX A;  2Q5Z A;  3T1H O;  4A5U B;  4CH4 A;  1BMF G;  4X6J A;  2IJI A;  1Z5V A;  5H9C A;  2Z0A A;  3CRM A;  2P06 A;  5D5Q A;  2X7R B;  3MHH A;  4MVM A;  2ZR2 A;  4GX1 A;  2OP3 A;  2Y6E A;  3JAK B;  1WP8 A;  4GX0 A;  4X89 A;  5EZY A;  1B6Q A;  5JCO C;  2WWW A;  4JI7 B;  3OTO B;  1TVK A;  2PY5 A;  3L70 H;  1J5E O;  1P84 F;  1OZ0 A;  1KBH A;  1HR0 O;  2ZIN A;  1TUB A;  4YVA A;  3TET A;  3RVY A;  3M99 B;  2QE7 G;  1UJW B;  1ZAU A;  2HHH B;  2N04 A;  3MP2 A;  2ACT A;  2BTW B;  1NS1 A;  2BU3 A;  1RM1 B;  4I50 B;  3P32 A;  4DR6 B;  3RT3 C;  3H1J H;  4MVZ A;  2C2A A;  3PNR A;  3ZS8 C;  4GX5 A;  4LH7 A;  2DYR C;  2PBH A;  3DXR B;  4JYA B;  2ZE8 A;  1N33 B;  3QVN A;  4NVP A;  2HVK C;  1MOF A;  3HPL C;  2PI4 A;  1Y76 A;  2XAG A;  1Q5O A;  1IZ3 A;  3RN4 A;  2F1M A;  1XHX A;  4I0X A;  4ICG A;  3N3K A;  2OTL V;  2AHY A;  2PF4 E;  1QMY A;  1HNW O;  5JA7 A;  2WLJ A;  4O4H B;  5CB4 B;  4H0L B;  4LFA B;  1KXR A;  2HJF C;  1FXV A;  3HHA A;  1H2G A;  1ZL8 B;  2Z84 A;  3ZHR A;  4FM1 A;  4JI8 O;  5L3F A;  3H7D A;  1BQI A;  1GM9 A;  3TXS A;  1I7F A;  4LC1 A;  5E6J A;  3K06 A;  4FM0 A;  3JAL B;  5BXZ A;  1NBM G;  1R3L C;  1GLO A;  1FAF A;  2Z3Y A;  2WLN A;  3H9V A;  3B8N A;  3HKE A;  4DV4 O;  4JI1 O;  1PBH A;  1BQ0 A;  3BCC H;  1FJG B;  4O4I A;  3LDC A;  3N4C A;  1P4R A;  1FFX A;  1F2A A;  2QKA A;  4JI3 B;  1DF0 A;  1AVM A;  4YJ3 A;  3ZX6 A;  3ABK C;  4LR3 A;  2AIM A;  2LGW A;  1K4D C;  4LWS B;  4GZR B;  1WA8 A;  1KKD A;  3JYC A;  1YEW A;  3K0G A;  1SET A;  5TIS Z;  3ZMS A;  1YXB A;  4LNU B;  5J2T A;  2DMX A;  3OMI B;  1SRY A;  1YK8 A;  2YI9 A;  4IIJ B;  5EBL C;  3RYH B;  3AK3 A;  5J2U B;  2BSK A;  5H5N A;  3PHW A;  2ZQM A;  3CRC A;  3WU2 Z;  3A8T A;  4NTX A;  3B4S A;  1P7B A;  3T1C A;  3JAR A;  5LA6 A;  4KHP B;  2X6C A;  1XNQ O;  4PAD A;  4ZOL A;  3EVK A;  2R9N A;  4JPR A;  1X59 A;  1CQD A;  1Z2G A;  4DUZ O;  4UVA A;  5C8Y A;  1VQO V;  1OCO C;  2IBI A;  2FB5 A;  5HFM A;  4X66 O;  3U0Z A;  3HHI A;  1DGS A;  2E5L B;  2NQI A;  2EIK C;  4QRV A;  5HFL A;  4WFE A;  5EZY B;  2B1M A;  2PZS A;  4QIW F;  3IUT A;  1TVK B;  2WLK A;  4LCU C;  1K9M W;  4F6R A;  1ORQ C;  1KD1 W;  3IFX A;  1EM1 A;  2A0L A;  2V4D A;  1VIB A;  1XHZ A;  4RQE A;  4G54 A;  4IGG A;  1IVS A;  3KX1 A;  4PA3 A;  1M1K W;  3JD1 A;  1H2M A;  1S72 V;  4LFB O;  3P5X A;  3D3I A;  4NR1 A;  5KA6 A;  1MEG A;  4I07 A;  2F95 B;  3TXQ A;  2CE4 A;  3OVZ A;  3JSN A;  4DV0 B;  5LP6 A;  3K5M A;  1CV8 A;  3ZMU A;  1CS8 A;  4XDK A;  3CBJ A;  3U10 A;  4PA9 A;  1EN6 A;  5EYP A;  3MHH C;  3BY4 A;  1PPJ H;  3VQY A;  2JTC A;  4LF7 O;  2AYO A;  1Q6K A;  4N4Z A;  1F7Y A;  5LMN B;  3K59 A;  4FPP A;  3SYA A;  3EFF K;  1YTF D;  1AIM A;  3TRK A;  3CH2 X;  1Y76 B;  3MOR A;  1U5I A;  1KEC A;  4RWU A;  4N8W A;  3SJA C;  3GB7 C;  2YIB A;  5CHT A;  4DR4 B;  2NQG A;  3T1H B;  3K9S A;  3BVO A;  4H37 A;  1XEQ A;  2EX3 A;  3JAS A;  3OE7 G;  2OCC C;  2EIM C;  3H6S A;  2QWP B;  1H2S B;  2ZXW B;  1AU0 A;  1M56 C;  3MTN A;  2FTK A;  4Q8H A;  3G4S V;  2P86 A;  2X0L A;  2EBO A;  1LUW A;  2UXC O;  2FO5 A;  3PRM A;  1YK7 A;  4YYQ A;  4PDR A;  1J5E B;  2YJB A;  4XDJ A;  1HR0 B;  1N0N A;  3B21 A;  2JEU A;  2QJ1 A;  3HKE B;  4DRX A;  5KLV H;  1GEC E;  4FZ0 A;  2XU4 A;  2AZ0 A;  5GW7 A;  3THO A;  1AR1 B;  1FFX B;  1QCE A;  4O4J B;  3IHP A;  2LP7 A;  1JQ0 A;  4NXM O;  5IJ0 A;  5LXT A;  4P9P A;  2K9P A;  4UXN A;  2WLI A;  1HDJ A;  2EIN B;  2JS5 A;  3O9O A;  2BOB C;  4JAV A;  1EZV H;  1G8M A;  4Q6G A;  1WA8 B;  2EJR A;  2LGQ A;  5B3S B;  3DF0 A;  4TV8 A;  5FNV A;  1GAX A;  2ZNI A;  4X1Y B;  3C0R A;  4DV3 O;  2KG7 B;  4FLX A;  2NLJ C;  1LUV A;  2RQ6 A;  1QLN A;  3OVX A;  1Y67 A;  2BSK B;  2KKW A;  1WPB A;  1CJL A;  3HD3 A;  2HFE C;  4CDC B;  4DO2 A;  5LMU O;  1KHP A;  5EGW A;  2CTW A;  3RYC B;  5IYZ A;  3JAR B;  1HNW B;  1M6D A;  2J7Q A;  1IWD A;  2GHY A;  1MSW D;  4ZOL B;  2HH5 A;  4QJF B;  2QSA A;  3KCX A;  4ZUX U;  4JI8 B;  4KXR A;  4RUE A;  3AG4 B;  1I5X A;  1SP4 B;  3H8C A;  1FXK C;  2AHZ A; 
#chains in the Genus database with same CATH homology
 5A2Q N;  3PHU A;  2ZM6 O;  3RNV A;  3TRK A;  1D2D A;  2HWK A;  1XNR O;  4M0W A;  2Z0A A;  5IT9 N;  2UUA O;  2UXD O;  4YY3 O;  4REZ A;  3J80 N;  2VQF O;  2HHH O;  2BTW A;  2E5L O;  2FKX A;  4K0K O;  1IBK O;  2UU9 O;  3E9S A;  3PRP A;  4R3D A;  4DR6 O;  4BOP A;  5BY1 A;  4X62 O;  4KHP O;  4RNA A;  4JI2 O;  5EZQ A;  4NXN O;  2N74 A;  1J5E O;  3J81 N;  5IWA O;  1XMQ O;  1HNZ O;  3PHX A;  1HR0 O;  4RF0 A;  1XEQ A;  3PSE A;  2LW7 A;  4JV5 O;  1DKI A;  4BOS A;  2UUC O;  5JZE A;  4PT5 A;  4JI5 O;  4OX9 O;  4OVZ A;  4X65 O;  5BR8 O;  5H5N A;  3PHW A;  4HXD B;  4JYA O;  3BBA A;  1N33 O;  2F4V O;  2FE8 A;  4JI6 O;  1DK1 A;  3MP2 A;  1G1X B;  2BTW B;  1NS1 A;  2UXC O;  2BU3 A;  5LL6 Y;  3PRM A;  4GUA A;  3RT3 C;  5EZS A;  2ZKO A;  4DUY O;  4DV5 O;  1XNQ O;  4DR5 O;  3B21 A;  1X59 A;  4LF4 O;  4GKJ O;  4DUZ O;  1PVJ A;  1XMO O;  4DV2 O;  4IUM A;  4JI4 O;  4DV6 O;  1I94 O;  4LFA O;  4A5U A;  1AB3 A;  4IP3 A;  3OQC A;  3W31 A;  4X66 O;  3MTV A;  4DV1 O;  3IFU A;  4XZX A;  4RKX A;  1A32 A;  4RF1 A;  5KO3 A;  2UUB O;  4NXM O;  4MI7 A;  3SDL A;  4B3T O;  4P16 A;  1YZB A;  3TMP A;  3W30 A;  4B3M O;  4DR2 O;  4B3S O;  1HNW O;  4DV0 O;  4OPA A;  1KUQ A;  4BOU A;  1R6T A;  4LF6 O;  4DR1 O;  3J7A U;  1UKF A;  4GKK O;  3C0R A;  4DV3 O;  5FLX N;  2UXB O;  4MM3 B;  4YHH O;  4OW0 A;  4WUR A;  1N36 O;  2Z84 A;  3PT2 A;  4JI8 O;  4D8B A;  4BOZ A;  4OVZ B;  4DR3 O;  1N32 O;  5LMN O;  4DV7 O;  1FJG O;  4BOQ A;  4DR7 O;  4LFB O;  1HNX O;  4JI3 O;  5LMU O;  3F5T A;  2J7Q A;  4JI0 O;  4LF5 O;  5E6J A;  4AQY O;  3R66 A;  1FYJ A;  5BXZ A;  3M8A A;  1N34 O;  3JAM N;  2VQE O;  3O65 A;  4X64 O;  2DOS A;  1FKA O;  2UZJ A;  4LFC O;  1R1B A;  3BB7 A;  4D8I A;  2DJV A;  4OPH A;  4DV4 O;  3BY4 A;  4JI7 O;  3OTO O;  4DR4 O;  1AIL A;  4LF9 O;  3MJ5 A;  4JI1 O;  2JTC A;  4ZTB A;  4LF7 O;  3T1H O;  4LF8 O;  4B3R O;  2J7Q C;  3ZNH A;  1F7Y A;  2AGA A;  1IBL O;  4A5U B;  2JRI A;  3T1Y O;  4D8E A;  1IBM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...