1YZBA

Solution structure of the josephin domain of ataxin-3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
MESIFHEKQEGSLCAQHCLNNLLQGEYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQQPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDPINERSFICNYKEHWFTVRKLGKQWFNLNSLLTGPELISDTYLALFLAQLQQEGYSIFVVKGDLPDCEADQLLQMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the Josephin domain of ataxin-3: Structural determinants for molecular recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Machado-Joseph disease protein 1
total genus 48
structure length 182
sequence length 182
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02099 Josephin Josephin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1yzbA02
3.90.70.40 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 1yzbA01
4DV6O 2UU9O 4JI6O 3R66A 1HR0O 2VQFO 2ZM6O 4JI5O 4YHHO 1HNXO 4LFBO 1NS1A 2AGAA 4JI4O 4DR4O 5LMNO 4DR7O 1N34O 1IBKO 3J7AU 3O65A 4DR3O 1FKAO 3M8AA 5BR8O 4KHPO 5BY1A 2N74A 4OPHA 3OTOO 2DJVA 4JI1O 1D2DA 5BXZA 1AILA 1G1XB 2Z0AA 2DOSA 4DR6O 4LF5O 4NXMO 1HNWO 2UUBO 1J5EO 4A5UB 4JI2O 4B3SO 4JV5O 4B3RO 1DK1A 4DR2O 4DV0O 3T1HO 4DUZO 5IWAO 4LF6O 4LFCO 4JI7O 4DR5O 1N32O 2E5LO 1F7YA 4X62O 4JYAO 4LF4O 3T1YO 4X66O 4LFAO 3J81N 4NXNO 2LW7A 4JI8O 1XEQA 4DV5O 1R1BA 2UXCO 1KUQA 4DV4O 1I94O 3J80N 4LF8O 2JRIA 1FYJA 4K0KO 1XMOO 4DV1O 1XMQO 4DV2O 1HNZO 2FKXA 1XNRO 4X65O 4OX9O 4JI3O 3RT3C 5H5NA 4DR1O 3JAMN 4GKKO 2ZKOA 4DV3O 5LL6Y 1YZBA 4OPAA 4DUYO 1IBMO 1AB3A 4X64O 5A2QN 4DV7O 4LF7O 1IBLO 2VQEO 3SDLA 5IT9N 4AQYO 4B3TO 2UUCO 1XNQO 1N36O 1N33O 4YY3O 2HHHO 2UUAO 2F4VO 2UXDO 2UXBO 1A32A 5FLXN 1R6TA 1FJGO 3F5TA 4LF9O 1X59A 5LMUO 4JI0O 4B3MO 4GKJO
chains in the Genus database with same CATH superfamily
7PCKA 3H6SA 4Q8HA 4UUJC 3X2QC 1MMMA 1ZSPA 4LFCB 1UFIA 1GM9A 5B1AB 1VQOV 3CCUV 4B08A 5IY5B 1SS3A 1PIPA 4DR6B 4KHPO 3QF7A 2F93B 3UQ8A 2QKAA 1AI4A 3MHSA 4YHHB 2AW9A 4CC5A 1JFFB 1L0LH 2YIDA 4OPHA 3CB2A 1PCIA 3TK1A 3T1HB 1XMOB 2BTOA 4O4IB 1XILA 1GO3F 2QJ1A 2DC8A 1AJNA 4HYOA 2RMKB 2YXLA 2P5OA 3MTNA 3PHWA 4X62B 3CC7V 3VQYA 1NR1A 3AG1B 3DXRA 2DJFB 4EB6B 2F66C 2OCHA 1MDWA 2R9FA 1AU2A 4D6TH 2RNBA 1B3QA 4ZUXU 5LA6B 4BOPA 5LBQA 1O0EA 3WB0A 3C3TA 4X20B 3N27A 2YDEA 3BRCA 4D8IA 4CH5A 2DCCA 4MVMA 4U3JB 4PDRA 4IIJB 1L0NH 3HPLC 3ICXA 1W0KG 4P9OA 3ABMB 4PA7A 3H01A 1X4TA 1S5JA 2EIKC 1VSNA 4R7CA 1N36B 3JALB 3FKSG 2AYOA 3ETGA 1Q90D 4I9WA 1N8RW 4JPRA 4O4JB 4QRGA 3FX7A 5E79Z 3RVWA 4GX5A 3LNNA 3P5XA 3JARA 2IM9A 2R9MA 3KZIZ 4LF8B 2ETNA 1SP4B 3KCYA 2QWPB 3Q4HA 2Q8VA 3ZMSA 4PI0A 2LJ2A 2FB5A 3BPZA 3BVOA 4DR5B 3S3WA 4MVUA 4RO2A 2QKCA 4NTXA 2WLHA 2VHFA 2AVWA 1S5HC 2UUBB 1NPZA 3ZHRA 1THZA 5IJ9A 1H8HG 2ZE6A 3ABLB 4B3RB 3OR6C 3OMNB 4IHJA 5CBHA 1Q81W 4HAMA 4LH6A 4TSFG 4FLYA 2HH5A 3H1LH 4JI5O 4JI4O 1OCOB 1SC5B 1YTFB 4N21A 1ME4A 2QE7G 1Q5OA 3CCMV 2CH7A 2HVJC 2R9CA 4UVAA 4U7NA 4MVRA 3JALA 4DV7B 4HNAA 5EGWA 1KECA 4EFBA 3KWBX 1Q3EA 2DJVA 4GUNA 2UXCB 1JFFA 3AG3B 3CCJV 3H8CA 3ZEDA 2QTSA 5JJNB 2BTQB 3GVMA 2DCDA 2XNDG 5F2VO 1RM1B 5EIBC 4GT1A 1IURA 2IH1C 1GKFA 4FLZA 4DR2O 1VQ8V 5B5EZ 3HKDA 3RN4A 3LUTB 4NB5A 2QM4A 3W7WA 4JI7O 2ZCEA 1PPNA 5FPWA 5CBFA 4EKWA 2FMLA 1KBHA 4BIUA 4X66O 4KUMA 4NXNO 1GN3A 4H33A 2OIGA 2CB5A 1PPOA 2ITCC 1Y76A 3ZS8C 1ZUQA 1NQCA 1B04A 3OGIB 3QG5A 3D36A 1S3JA 3J80N 4LF8O 2WAMA 3WU2Z 1FAFA 3HHIA 2YI8A 4HZ3A 3LXSA 1AR5A 4BOQA 4I0XA 2CDYA 3DSQA 1L8DA 4UVBA 4B7KA 5DEDA 3CPWU 1MA1A 2QM8A 1U9VA 4JZ2A 3O1GA 1O9GA 1NB3A 3JATB 2F4VO 1YJWV 3K04A 1JMKC 5KHHA 5BMVA 2JJ2G 1A32A 4MZSA 3OD4A 1F2CA 4HWYA 4W4UA 3CCQV 2ACTA 1CPJA 4DV5B 4JI0O 1ICFA 3K5NA 3HB3B 5KHKA 3K9MA 2QA4V 3P5WA 4DV6O 2UU9O 1AU4A 2GBOA 1B06A 5JA7A 3WXGA 1NS1A 3ZMZA 5LMNO 1WA8B 3D36C 3BB7A 4JGSA 4XZXA 5EZQA 4O4HB 2DZYA 2JDIG 2P7UA 1GCBA 4DMYA 4XDLA 3M99B 4BAYA 4GX0A 3I56V 3OTOO 3JCUZ 3USVA 3ZN0A 3K9SA 2F23A 2V4DA 1I94B 4ICGA 1EN5A 3SYAA 1KB9F 3GWOA 4JI7B 2C0YA 1F29A 2GHUA 2AU1A 4XBFA 2ATOA 2Y6EA 1PE6A 1V9PA 3W7XA 3PNRA 3HHAA 2Q6AA 2FE8A 2G7YA 2H7JA 3HR0A 5L3CA 4PADA 4X1KA 3TRKA 2PNSA 3KW9A 5CA1B 2PF4E 1K3EA 4DR5O 2A7WA 2DW4A 3QVNA 3CC2V 2E01A 1F7YA 4QGPA 2ZE8A 3V6EA 3CMAV 5LOVB 4MSWC 1R3LC 2Z5UA 3PBHA 2JEXA 3E8BA 2A9HA 4WF9V 4B3MB 1P4RA 5K1PA 1NH2B 5KAIZ 4DW0A 5J2TB 1PNMA 4YIOA 1ROPA 1KKCA 1K73W 5LXTB 5IDJA 1EF7A 2IBZH 3RYFA 4FVMA 1GLOA 5FPRA 1Q43A 4D7SA 3GCBA 1CJLA 1K4CC 3CH2X 2ITDC 4X64O 1SETA 4DV4B 1TUEB 3BFRA 1V55C 4FZ1A 4CDFB 3QO8A 3CHXA 3G6EV 2EIJC 4X6HA 3DC5A 3U11A 3AG4B 1P84F 3BEHA 1FXKB 2ZINA 1QXPA 3STLC 4J7KA 2IPPB 2NQIA 1K5QA 3L74H 1BY8A 1GMYA 2CTPA 4FK5A 5C8YA 3L72H 3T4ZA 2HJDA 3NXSA 2HXZA 3IV2A 3FD9A 3P32A 4J10A 5FNVB 1EZVH 2NNUA 3K3WA 3P5UA 4JI3B 1YT7A 4X66B 3B21A 5CA0B 1FXHA 4K35A 4NXNB 1H2KA 3M8AA 5BR8O 5LP6C 5IYBO 4MZOA 1SQVH 3LDCA 5IYDO 1SRYA 4LNUB 5K16A 3JAKB 1XHZA 2XTAA 4FM2A 2E74B 4J7ZA 1YK8A 1CTEA 5A9GA 2XAHA 1Q6IA 3OISA 3HWNA 1Q6HA 4A5UB 4PDMA 3MTVA 3SR2C 5D5PA 3JD2A 3N2GB 4IL6Z 1WB7A 3CCVV 4C7UA 3CRRA 4JTCB 2Q67A 5CA3A 2ZNJA 1FPOA 1IDSA 4U7OA 3PHXA 2P0RA 4MVOA 5LGNA 1JVMA 2L6LA 2ATKC 4YIPA 4DV6B 3QO5A 2UU9B 5B1BB 2J7QC 4ZKIA 3OR7C 2LFSA 5JH3A 4I07A 4OVZA 2YIBA 1MSWD 1QHTA 1HNWB 4O4HA 5H5NA 1M9NA 2UXXA 4WFGA 3B2EE 4OPAA 1BSMA 2EX3A 4DUYO 4OVZB 1THEA 1AVMA 2W0FC 5IY5C 1XNQO 1S76D 3VQWA 1BQ0A 5L3GA 2JQFR 1D5AA 2GV9A 2UXBO 3RYIA 1AI7A 3SYOA 4LFBB 4LFAB 3H1JH 4O4LA 1VMGA 1AU3A 4JI2B 1SA0A 3OF8A 2DCBA 3R65A 3LFYA 1SQQH 4DO2A 2JGUA 1KQSU 3RW0A 1PNLA 1N34O 1CPYA 2JJ1G 4FPPA 2Q73A 3A8TA 2JQGR 4J80A 3TNXA 5EBMC 5L3FA 2YUAA 3VQVA 1HDJA 4ZI7A 2A79B 4MTOA 5KHGA 3E8HA 4J42A 4CS2A 4QE9A 4UCUA 1JQPA 4JI1O 4X6JA 4NTWA 4I4TB 2BCCH 5LHHA 5H6RA 1N4CA 1QLEB 1VQKV 2DYRB 3T4DA 5HFLA 2OZ2A 3HKBB 3PN1A 3LDDA 1NVPD 1VQ4V 1MG1A 1VARA 4AHCA 1YTFD 4REZA 2IW5A 1XQ8A 5IE9A 5EZSA 1DF5A 1F4MA 1BT8A 2VWKA 1ITOA 4JYAO 4P16A 5IJ9B 2P86A 1TU6A 3WG7B 1PBHA 1OCRB 2JK5C 2VRZA 1OCCC 3ZRWA 4OW0A 2X6AA 2R70A 2HVKC 1Y4HA 4DUYB 1M57C 1TA8A 4CZZA 2JRIA 4K0KO 3QNEA 1FD9A 5CBGA 1SZTA 3SJQC 4IYIA 3SJBC 1AYWA 4F6RB 4O4JA 1PP9H 5LL6Y 1IBMO 5LXTA 1I5XA 3KSEA 2HD5A 3TCUA 3SPIA 3BC3A 3JCZA 4W5BA 1COWG 4YY3O 3IOQA 1EN6A 4DV2B 5JH7B 2IJKA 1Z5VA 2C2AA 2AZ0A 2RQ6A 2HHHO 1VQ5V 3IEJA 1R3JC 3OEEG 2GUZB 3SYQA 4OEMA 1FJGO 1FXKA 2YJBA 1PV0A 2Q7GA 1M56B 2EIMB 4G27B 3IFXA 4ABMA 4GYCB 1KXRA 1CXZB 4PA9A 4TV9A 3PHUA 3TMPA 1QVFU 2VQFO 3H1IH 4WFFA 1RPRA 1NU1H 1WN7A 4LBEC 1O9HA 1VQ9V 3BPMA 2JVDA 4BOSA 1TGOA 1EBOA 4GKJB 1SNKA 3OT7A 4LH7A 3PRPA 3BCCH 1U9QX 3OEHG 2N74A 2ODMA 5LHGA 4PA3A 5KMGA 2HWKA 4UXNA 4BS6A 1Q6UA 5B1OA 1AILA 3JYCA 4QBBA 4DV0B 4PP2E 1DLBA 4L87A 1Q6KA 4LF5O 4PP1A 1HNWO 4MTXA 4MM3B 4DXWA 1AR1B 5GONA 3E8GA 1J5EO 4D7TA 2KSDA 4RUFA 1SQBH 2FTKA 2Q0AA 4PELA 4JV5O 2QGNA 5CA1A 3BA9A 4PV1B 4FMTA 3MJ5A 2DZZA 4QE7A 5KA6A 4XR7A 1NI8A 3CS5A 1YJNV 3DXRB 2BSKA 3BA8A 4LF4O 3ML0A 3RBZA 4K0KB 2NN4A 3J81N 3OGCC 2PUSA 5LMUB 2HFEC 1XEQA 3OM3B 2QWNB 3RYIB 1YEWA 2CGNA 4I4TA 2WBFX 3U8EA 3PT2A 2DN9A 4BQVA 1KFXL 4P2ZA 2JTCA 3THOA 2YICA 3N2KB 5EZYA 1K4DC 2WPDG 2QKSA 4J9ZB 3MHHA 1N34B 4DK0A 1YIJV 1MEMA 4DV2O 2PREA 3EXAA 1JJ2U 4I5SA 2ZNIA 2Y0IA 4J7JA 1UJWB 4DV3O 5KHJA 2B1IA 1WNSA 1ZAUA 3K5MA 1BGYH 4DUZB 2EJRA 3W7SA 5H2FZ 2P6JA 4WURA 4OX9B 1JR9A 2F95B 3K8UA 2GTAA 2ZM6B 1A6RA 2PBHA 1R6TA 2JS3A 1M1KW 1GN4A 1Y6XA 3G6BA 1S77D 3SYCA 2OP3A 3C90A 1FFXB 4GKJO 4XUIA 4RUEA 3N2GA 4H44B 1IWDA 1HR0O 4K8XA 5KO3A 4BW5A 4DV1B 2G38A 2YIAA 2OYQA 3W7TA 3L73H 1CS8A 4HXDB 3TXSA 1RM1C 2ZDIA 4DRXA 3JAWB 2BDZA 1YVBA 5IJ0B 1MEGA 3AG3C 1VP7A 2P4VA 1Y76B 2A0LA 4Q20A 4OELA 4X1YA 1NR7A 3D6SA 4TV8B 1AYUA 1ZCMA 1VJVA 4JAUA 1R73A 5DM6V 1KD1W 1IBMB 2EIMC 5FNVA 3B40A 1AYVA 3P3PA 1BZKA 1DK1A 5B3SB 1OCOC 3D8CA 1Y67A 5LYJB 4UV9A 3E8FA 3IUTA 1CV8A 5L3DA 1K5SA 2PI5A 5EYPB 1NT2B 3IFUA 4JASA 3ASNB 1PD3A 1Q86W 4AILC 1KP2A 5KUMA 2CAZC 4LNUA 1KMIZ 3CRAA 2R6NA 2EILB 2HJFC 4H37A 1Z5WA 2G6DA 5JVDA 1GM8A 4YJ2A 2FKXA 1XOUA 4OX9O 1YSCA 3JAMN 1IX9A 4W5CA 4PJ0Z 4PI2A 4O2AA 1AB3A 3MHSC 2HR3A 4YYWA 2PYLA 3SDLA 2ZIMA 3UT5B 5JZEA 4H0LB 2XAQA 2B5UA 2EIKB 2H3OA 4NYKA 1XNRB 3RYHA 3A0RA 5DN6G 2AHYA 2E5LB 4DYLA 1HR0B 3ZBHA 2FT2A 1SQPH 2QWRB 4TT3G 4FK5C 4PA4A 5CVMA 4LF9O 3CJHB 4B3TB 2UUCB 4JV5B 3RYHB 1ZLZA 4B7EA 2FRQA 5KAFZ 3FFQA 3JD3A 3CBKA 4MI7A 5LYJA 4JI6O 3OQCA 2X6BA 1YALA 1D5NA 4EB6A 1LNQA 4K3AA 5DECA 1WP7A 3O65A 3K06A 4DR3O 1FKAO 1DF4A 4TV8A 3IC9A 4MW8A 3KWZA 2ZE5A 2WLLA 2OCCB 4F6EA 3ZRSA 3F75A 3RVYA 2LQTA 3JASB 2ZR3A 4ZHQB 2FUDA 3CXCU 3M99A 1TVKA 4DR6O 2ZXWC 4OXSA 4PT5A 2UXNA 5LOVA 2RCVA 2QM7A 1EWLA 3PRMA 2WLMA 4R50A 4J41A 1CB5A 2XOKG 4B3RO 2PADA 2WSSG 5B3SC 3T1HO 4CZWA 3KKYA 2PGGA 5EBWC 2DYSB 2GFOA 4LF6O 3ZRVA 1XI1A 3K59A 3ZRXA 4JI4B 5CVOB 1SA0B 1ZL8B 4X89A 2XU4A 4UCOA 1IBKB 4X62O 3I3TA 2IJHA 5FPOA 3E1ZB 3OW2U 2OTJV 3T1YO 3QSDA 5JQGA 2YS8A 5GTHZ 5C93A 5B1NA 4N8WA 5J2UB 1JPXA 2ZT9B 3JATA 1WB8A 5CMUA 1GTOA 1BHAA 5D5QA 4CH3A 4DV1O 1MZEA 2IJIA 3UO3A 4JI8B 1HNZO 2BDLA 2EZPA 1NVPB 1XNRO 2ZQMA 4KXRA 2J7QA 1BE3H 3CYOA 4MVZA 1WPXA 3UM7A 3UCSC 2NR5A 3PJSK 1N36O 3QT4A 3ABMC 3W31A 1FFXA 4CS4A 5KA5A 2Q5ZA 4BWAA 1PL0A 2DC7A 4H13B 5CVNB 3LNMB 4DR4B 1S0VA 3ZCCA 4MVQA 2Q7HA 5JQGB 1IBLB 1X59A 2RJZA 3LSSA 2PZSA 4I04A 1I5YA 4AQYB 2E76B 4XDJA 2B1NA 4UCVA 4FLTA 1JOYA 2NQGA 1DF0A 2KKWA 3MAQA 3AG1C 2EZOA 2Z3YA 4DR7O 3L70H 3IHPA 4NR1A 1W59A 4I0XB 2OCCC 3A0HZ 2CUGA 1NBMG 4J11A 2OIEA 1TUBA 3WFVA 1E79G 3MD0A 5IYZA 4ZHQA 3B8NA 1OV9A 1NH2D 5KLVH 5CHTA 2OT5A 1N33B 2RDCA 1BQZA 3U0ZA 1OCZB 4K7CA 3LSQA 3OMIB 3CCSV 4GKKB 3SPJA 1NTZH 2CH7B 1STFE 5B1AC 1AI5A 4X6IA 1XHXA 3CEIA 3E35A 3B79A 3BBAA 4YJ3B 3ZJZA 4IHJB 4RWUA 4X9QA 5LMNB 3ZMTA 2E5LO 1RSOB 2H94A 2QWQB 4JAAA 4MSXA 1JJOA 3FAVA 2FTDA 1QLEC 4JI8O 4DR2B 1YF2A 2XU3A 2X6CA 4UV8A 4FM1A 2EINB 4RF1A 2EJ7A 5EC2C 1G6UA 1YXBA 2WLLB 1KUQA 1I94O 2P06A 5E1AC 4GX1A 1MABG 5CA0A 2V1DA 3RVVA 2YEVA 2YEVB 4N4ZA 4ZBMA 5GW7A 1F23A 4ZOLA 4CDDB 3K57A 4QIWF 2PYJA 1IBLO 3SPHA 2H8PC 1NTKH 3ASNC 4AQYO 4BS5A 4P6GA 2QTOA 1PPDA 1HWYA 1GM7A 2HHNA 3I5DA 2BOBC 1H8EG 2AS8A 4NXMB 1EWOA 4E2LA 4BR6A 3ASOC 4B3MO 1MSDA 5JH7A 1AIMA 2GDSA 2OULA 2IJJA 2KQXA 1AU0A 3JD1A 4FLXA 1VIBA 4YHHO 2AGAA 1E1QG 1OCZC 3HKBA 1IBKO 4JI0B 3T1YB 4FLVA 5JVDB 2W0XA 2Q68A 2F7DA 1QDQA 4BOZA 2CTWA 3VOUA 4ZIBA 3ZN1A 4FLWA 1AJQA 1VQ7V 1AROP 1ATKA 1TLOA 3WB1A 3RYCB 1GAXA 3WG7C 4U3JA 2LP7A 3WXEA 2M7WA 2B1MA 2QR4A 2EILC 5PADA 3BHPA 1V54C 4Q8GA 4CH6A 1ZX3A 4TUYA 4B3SO 1GK9A 3JSLA 2ADPA 4LR3A 4YYVA 4PI3A 3PW3A 5LP6A 1K34A 3CH3X 3TETA 2GSMB 3APOA 2LGQA 5IWAB 2DJGB 5JCOC 3K03A 1OJHA 1IVSA 3F5WC 1M90W 5IYZB 2FYUH 1QNMA 3O0UA 2GTSA 1N0NA 2KG7A 3FB7C 4DR1O 2Y4UA 1PL4A 2FQ9A 3IMAA 4GZRB 3HKCA 5A2QN 4UCRA 1KU9A 3HKEA 1NKDA 3EVKA 4IUMA 2LFRA 4KLBA 1N33O 1RPOA 4GUAA 4RQEA 1NQTA 3MORA 1WP8A 2AIMA 3L9DA 3K5OA 4TQFA 3ASOB 2DC9A 1NLJA 1R3KC 1W2BU 3CC4V 3WB2A 1G8MA 5KX5B 3OUFA 2DQ3A 1BP4A 2F1GA 3KX1A 1QVGU 1WAZA 2OTLV 5K1XA 1AECA 3CX5F 3ZHQA 1IXMA 3IGAC 2YJCA 1Q8IA 2LW1A 2P90A 2A06H 1V55B 5B66Z 2ZXWB 1M4UA 2WLIB 2Y48A 3H89A 3QJ3A 1MOFA 3M7MX 4F4LA 4NVPA 5GONB 1EFRG 4U3FH 1SQGA 2M6YA 3W30A 3MDSA 1M6DA 2BTWB 5J94A 3CWBH 4Z1MG 1R3IC 4QPKA 2ZR2A 2ARHA 1D2DA 5BXZA 2R9AA 1DGSA 4DMXA 4P30A 5BR8B 3UKMA 1M56C 3AK3A 2YXHA 2YI9A 4D8EA 4JI2O 1T5EA 5KHIA 1GMGA 3CXHF 3V6CA 2XT9A 2XAFA 5LGUA 1Y4MA 5IWAO 3CP1A 4X1IB 3DF0A 1VEWA 4QRVA 2W6JG 4A5UA 4O2BB 4IGGA 3ZHVA 3K9AA 2EBOA 4PDLA 3G4SV 5KUKA 2K9PA 3ZHSA 2BTQA 3CCEV 4AXLA 3FYIB 3RVZA 3SJAC 1VF6A 2VHSA 4P6EA 1I0HA 4DR1B 4JAVA 4CC6A 3E86A 1KKDA 4FLUA 3W7UA 3OMAB 1FYJA 4JI5B 3A2FA 1SKVA 2JGDB 4I55B 2WLJA 2VS0A 4O2AB 2F4VB 2E3CA 1URFA 3BPFA 1OCRC 2YJ2A 4DV7O 3BY4A 2VQEO 3B4SA 1VQNV 2XAJA 2QSAA 4UFZA 2HKOA 4BPVA 3BAAA 1G4YB 4WFHA 1RFYA 1DKIA 4GX2A 2XUMA 2F1MA 3FB5C 4IIJA 3FAVB 4FFBB 2Y5BA 1ZIVA 3N3KA 1EM1A 1Q7YW 1CVZA 4O2BA 2DYRC 4QH6A 5EYPA 4MTGA 3Q4HB 1MIRA 3PSEA 4UCTA 3UT5A 3OVZA 5CHVA 1F2AA 4L8JA 4YV8A 4LFBO 2WA4A 1VF6C 3E22B 1N0JA 2K1EA 1S72V 3S3XA 3J7AU 1DEUA 4YJ2B 3JSNA 1JA8A 3K24A 2Z84A 2R72A 3APQA 4RY2A 3F7VC 3VBBA 2IU3A 1TUBB 2AYNA 2XU1A 3RFRA 1CSBB 3S3RA 5H6QA 4BIZA 1FJGB 2EINC 2FO5A 4WA6A 1ZTEA 3X2QB 2CIOA 4MS2A 3ZNHA 1WA8A 1U5IA 4JYYA 4X1IA 3T2MA 3RVXA 1K92A 1R6NA 1SF9A 4YJ3A 4UB6Z 4BIOA 4YXWG 2CGOA 2NQAA 1YHQV 1MS6A 1U9WA 4CDEB 3B09A 1QBZA 2GHYA 4I9QA 2LW7A 2Y4TA 2ZE7A 5A24A 4X1YB 1QCEA 4BOUA 4Z1VA 4DV5O 4KFMA 3C3SA 3EFFK 3P3NA 4E4EA 1K9MW 2XAGA 4YYRA 1BGOA 3WXFA 4DV4O 4JYAB 5IJ0A 3VQXA 2VQEB 1GN2A 3HKEB 3HKCB 1GN6A 5B1BC 3MHHC 5ITZA 3KCXA 4N79A 1HP8A 3RT3C 3ZX6A 4WFAV 3FB8C 4BSQA 2HG5C 3AK1A 4WFBV 4LF7O 3AG2B 1U97A 2QDOA 4GCZA 3OTOB 3IAYA 1QR9A 3L75H 5J9PC 3K79A 4JF3A 1PVJA 3QTCA 3ZMUA 2HEPA 1YVWA 2Q4PA 1KP3A 3ABLC 3ABUA 1DTOA 2UZJA 5LMUO 1I7FA 2YIBD 2CE4A 2AXTZ 2PTMA 4AXMA 4YY3B 4LC1A 5CB4B 2BSKB 1TL9A 1U96A 5FL7G 3TJTA 1AR4A 2P7TC 3R66A 3AG7A 3RGBA 1XMQB 4QRXA 3ERVA 1YI2V 1F51A 1VQ6V 4TUYB 2DE0X 1QOLA 3N3GA 4LWSA 5L3EA 1M5IA 2BU3A 3MP2A 1TVKB 4XDKA 3ABTA 2VQFB 2FYEA 4UB8Z 1L1FA 1H2NA 9PAPA 2YC0A 2CK3G 1HW7A 2W6IG 4I05A 2OWOA 2BOCC 2D2CB 1QQCA 3OE7G 3ZHUA 4Q6GA 3CE2A 1ENVA 2IH3C 4X64B 1MZFA 2DC6A 3E22A 5EBLC 3HKDB 1Y08A 4DV0O 1EWMA 3OF9A 1SQXH 2D3OW 2IU0A 4YYUA 1FS0G 3ETQA 1N32O 1XREA 2YSUB 4LCUC 1J5EB 2EIJB 3K0GA 2DYSC 4R3DA 4DW1A 3CJHA 1KC8W 4JTAB 1X9YA 2QEXV 4KP4A 3QO7A 2R9IA 1YDXA 3JASA 1R1BA 3ETEA 4HNAB 1AP6A 1XNQB 3BCNA 1I08A 3U10A 4FFKA 1AP5A 1JQ0A 4ZOLB 3E89A 4F6RA 4JI3O 4WCEV 1NB5A 4NTYA 3KFQA 1YZBA 3RYFB 2JGDA 1ME3A 4P9PA 3P5VA 1IZ3A 3A0BZ 4QJFB 3LSUA 1S4VA 2HP8A 4RQFA 1NZ6A 1FH0A 1FFTB 1M57B 4RF0A 2YJ8A 3E9SA 4G2KA 4ZTBA 4DV3B 4FFBA 3LDEA 5FLXN 1BL8A 2DCAA 3H8BA 2GUZA 4FJCA 3F5TA 1R6KA 2ILMA 3STZC 3TXQA 2ADQB 5EF4A 1Z2GA 3TGUH 1YK7A 4X20A 4G28B 4TOIA 3GB7C 2KB1A 2MK3A 2ZM6O 3E83A 3I06A 2Y0PA 1FXKC 1H2SB 3AG4C 4K8ZA 5EIBD 2ZDIC 5LHIA 5JCOA 4I55A 4NKGB 1KHQA 4O4IA 5BY1A 2E00A 1US6A 1BS3A 4MTFA 1PPJH 4ZI7B 3ZRWB 4OGQB 6PADA 2Z0AA 1K7DA 2P4KA 2G8JA 2EULA 2FL4A 4YYQA 4CS3A 4LF9B 1H2GA 1LR1A 1QU7A 5EC1C 4RAIA 1EWPA 3D3IA 3KG2A 3OTFA 1XBLA 1XDCA 5GTIZ 4MT8A 3CRMA 3CMEV 4LF7B 3OVXA 2AZ2A 4IT5A 1EN4A 1XKGA 4JI6B 1SQFA 4JZGA 4UVCA 1Y66A 3CSXA 2NLJC 3H9VA 4FZ0A 2UXBB 4M0WA 4PDVA 1LUWA 2DWDC 1UPGA 4LFAO 2E03A 4DR3B 2HLDG 1PXVA 5BMVB 1WPBA 3H7DA 1LUVA 3F7YC 1PPPA 2FRAA 1K97A 2CTRA 1H2LA 1TAEA 3HD3A 2BTWA 3P30A 3K0DA 4JYBA 5JJEB 4LP8A 1XMQO 3B8MA 2X7RB 5AG2A 1K3BB 4LWSB 3CD6V 2G8EA 2QWOB 2WLIA 2CTQA 2KG7B 1PM9A 4WFEA 2O57A 3CCRV 1MNGA 1PKXA 4N23A 4J9YB 4UCSA 2R9OA 4JI1B 3ETDA 5CB4A 1P7BA 1OCCB 3ABKC 2UUAO 2UXDO 4YVAA 2MW2B 2BE3A 4MW3A 5KX5A 1IXBA 2DQ0A 1P7GA 4YYSA 4I50B 4I50A 3K08A 1W0JG 5E6JA 2ZD9A 1RP3B 1ZL8A 3L71H 1BHBA 1KYOF 2DMXA 2WLKA 3B77A 3SJCC 4D8BA 1N32B 3CRCA 1ZWIC 3AG2C 1Y74B 4X65B 1BQIA 3SYPA 1ORQC 4FM0A 1V54B 5H9CA 5ITZB 4LF5B 4R6ZA 4QNHB 3CRQA 2ZIOA 3RYCA 2B1GA 2LGWA 4CH4A 2A3QA 1JCHA 1CP9A 1F4NA 1POPA 2P67A 5KMGB 2Y69B 5J2UA 2DOSA 3UO2A 5JWPA 3SPGA 4MVSA 4RNAA 3DTUB 5LGTA 3DC6A 5LP6B 1WLEA 4LF4B 2AHZA 5F02A 1NL6A 2E75B 1E1RG 4PD4F 4TV9B 2AUXA 2WLNA 4LFCO 1AI6A 4X8AA 2Q0OC 1M93A 4W4KA 2HHHB 4DR7B 1SZXA 3AK2A 4WBNA 2V7QG 1XUQA 4QPJA 2JIZG 2X0LA 4ASUG 3D3QA 1GH6A 1KHPA 2NQDB 1OHHG 3FYEB 4KHPB 2R9NA 2F43G 3G71V 1VQLV 4LF6B 3JD4A 3JAKA 2JEUA 1NTMH 3FB6C 2Q9LA 1AJPA 1XMOO 2XASA 1K33A 4R8CA 4X88A 3OAAG 3ZHTA 4G54A 4KL1A 3F5VA 1NJIW 2UUAB 2UXDB 4JTDB 1H2MA 4GKKO 1VF5B 5IYCO 4GLXA 2ZKOA 3C9EA 1XL6A 1J95A 1QLNA 3ZIAG 1BCCH 5J2TA 3OFNG 3GWKC 5C8YB 1Q82W 3O9OA 1CQDA 1HUCB 1XL4A 1HNZB 3ZUAA 5L3BA 3H1KH 1YJ9V 3H1HH 1QR8A 4FIPA 2E02A 2LO1A 5HFMA 2O6XA 4I7ZB 4CBCA 4WBNB 1RSOA 4W4LA 1VF7A 3RNVA 4IP3A 3JD0A 4X1KB 1FXVA 4BW9A 2DWEC 1HNXO 4DR4O 3JARB 1U9XA 1YCIA 2IBIA 2Q69A 1CEZA 3RWRD 1F2BA 3BOWA 1H38A 3K58A 2PY5A 1K8AW 1GECE 1P49A 5TISZ 3BABA 5CN0A 4EEQA 2ARYA 1SERA 1MHWA 3S3QA 1G1XB 1BMFG 1PNKA 1S5LZ 3DGEA 3EHBB 1KFUL 4NXMO 2UUBO 3NHEA 5BZBA 1UKFA 1WJZA 2R9RB 2B9ZA 1EZJA 1GRJA 2L35A 1PADA 5LA6A 3BWKA 4AI8A 4DUZO 4EFEA 2JS5A 3NR7A 3SPCA 3I55V 3BY6A 3CBJA 2Q7EA 4HBNA 1YITV 2AUZA 4FJCC 2P22C 1OZ0A 2Y69C 3IJ4A 3E2EA 2YXYA 1VQPV 3G80A 4CDCB 1JX9A 1SESA 2N05A 2UXCO 3SGIA 2RN9A 4TWKA 1QMYA 2WWWA 1VQMV 3JAWA 4DRXB 5EK0A 2VWJA 8PCHA 3PDFA 4X65O 3AI8A 1Y74A 2XHBA 4JYCA 4Z2WA 3AEIA 4B3SB 3OUSA 3ZMVA 3G67A 5IT9N 4B3TO 2UUCO 3N4CA 3N2KA 5EZYB 2PI4A 4IYHA 2XU5A 4PHZA 3T1CA 5JJJB 4DK1A 2YJ9A 1B6QA 3IC7A 3CCLV 2N04A 4O4LB 1HNXB 4FIPC 4RKXA 4PA6A 3ABKB 4TQDA 3K5LA 3C0RA 2WA3A 3KKUA
chains in the Genus database with same CATH topology
3RNVA 4IP3A 3PSEA 4DV6O 2UU9O 3PHUA 4MI7A 4JI6O 3R66A 1HR0O 3TMPA 3OQCA 2VQFO 2ZM6O 4JI5O 4YHHO 1HNXO 4LFBO 1NS1A 2AGAA 4JI4O 4DR4O 4D8BA 5LMNO 4DR7O 1N34O 1IBKO 3BB7A 4HXDB 4XZXA 5EZQA 4BOSA 3J7AU 3O65A 3B21A 4DR3O 1FKAO 2BU3A 3M8AA 5BR8O 4KHPO 3PRPA 3W30A 3MP2A 2BTWB 4BOZA 5BY1A 2N74A 2HWKA 2Z84A 4OPHA 3OTOO 2DJVA 4JI1O 1D2DA 5BXZA 1AILA 1G1XB 2Z0AA 2DOSA 4DR6O 4PT5A 4RNAA 4LF5O 4NXMO 1HNWO 4MM3B 2UUBO 3PRMA 1J5EO 3PHWA 4A5UB 3ZNHA 4D8EA 3MTVA 1UKFA 4JI2O 4B3SO 4JV5O 4B3RO 2FE8A 1DK1A 4DR2O 3BBAA 4DV0O 3T1HO 4DUZO 4REZA 3MJ5A 3TRKA 5IWAO 4BOPA 4LF6O 4LFCO 5EZSA 4JI7O 4DR5O 1N32O 4M0WA 2E5LO 1F7YA 4A5UA 4X62O 4JYAO 4LF4O 3IFUA 4P16A 4R3DA 4D8IA 5KO3A 3T1YO 4X66O 4LFAO 3J81N 4NXNO 2LW7A 3PHXA 4JI8O 1XEQA 4BOUA 4DV5O 4OW0A 1R1BA 3PT2A 4RF1A 2JTCA 2UXCO 1KUQA 4DV4O 1I94O 2J7QC 3J80N 4LF8O 2JRIA 1FYJA 2BTWA 4K0KO 1XMOO 4DV1O 1XMQO 4OVZA 4DV2O 1HNZO 2FKXA 1XNRO 4X65O 4OX9O 4JI3O 3RT3C 5H5NA 4DR1O 3JAMN 4GKKO 2J7QA 4BOQA 2ZKOA 4DV3O 5LL6Y 1YZBA 4OPAA 4DUYO 1IBMO 1AB3A 4OVZB 4X64O 5A2QN 3BY4A 4DV7O 4LF7O 1IBLO 2VQEO 3SDLA 5IT9N 4AQYO 4B3TO 2UUCO 1XNQO 4IUMA 5JZEA 1N36O 1N33O 4YY3O 3W31A 4GUAA 4WURA 2HHHO 4RF0A 2UUAO 2F4VO 2UXDO 3E9SA 1PVJA 2UXBO 1DKIA 4ZTBA 1A32A 5FLXN 1R6TA 1FJGO 2UZJA 3F5TA 4LF9O 1X59A 5LMUO 4RKXA 5E6JA 3C0RA 4JI0O 4B3MO 4GKJO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 O;  2UU9 O;  4JI6 O;  3R66 A;  1HR0 O;  2VQF O;  2ZM6 O;  4JI5 O;  4YHH O;  1HNX O;  4LFB O;  1NS1 A;  2AGA A;  4JI4 O;  4DR4 O;  5LMN O;  4DR7 O;  1N34 O;  1IBK O;  3J7A U;  3O65 A;  4DR3 O;  1FKA O;  3M8A A;  5BR8 O;  4KHP O;  5BY1 A;  2N74 A;  4OPH A;  3OTO O;  2DJV A;  4JI1 O;  1D2D A;  5BXZ A;  1AIL A;  1G1X B;  2Z0A A;  2DOS A;  4DR6 O;  4LF5 O;  4NXM O;  1HNW O;  2UUB O;  1J5E O;  4A5U B;  4JI2 O;  4B3S O;  4JV5 O;  4B3R O;  1DK1 A;  4DR2 O;  4DV0 O;  3T1H O;  4DUZ O;  5IWA O;  4LF6 O;  4LFC O;  4JI7 O;  4DR5 O;  1N32 O;  2E5L O;  1F7Y A;  4X62 O;  4JYA O;  4LF4 O;  3T1Y O;  4X66 O;  4LFA O;  3J81 N;  4NXN O;  2LW7 A;  4JI8 O;  1XEQ A;  4DV5 O;  1R1B A;  2UXC O;  1KUQ A;  4DV4 O;  1I94 O;  3J80 N;  4LF8 O;  2JRI A;  1FYJ A;  4K0K O;  1XMO O;  4DV1 O;  1XMQ O;  4DV2 O;  1HNZ O;  2FKX A;  1XNR O;  4X65 O;  4OX9 O;  4JI3 O;  3RT3 C;  5H5N A;  4DR1 O;  3JAM N;  4GKK O;  2ZKO A;  4DV3 O;  5LL6 Y;  1YZB A;  4OPA A;  4DUY O;  1IBM O;  1AB3 A;  4X64 O;  5A2Q N;  4DV7 O;  4LF7 O;  1IBL O;  2VQE O;  3SDL A;  5IT9 N;  4AQY O;  4B3T O;  2UUC O;  1XNQ O;  1N36 O;  1N33 O;  4YY3 O;  2HHH O;  2UUA O;  2F4V O;  2UXD O;  2UXB O;  1A32 A;  5FLX N;  1R6T A;  1FJG O;  3F5T A;  4LF9 O;  1X59 A;  5LMU O;  4JI0 O;  4B3M O;  4GKJ O; 
#chains in the Genus database with same CATH topology
 7PCK A;  3H6S A;  4Q8H A;  4UUJ C;  3X2Q C;  1MMM A;  1ZSP A;  4LFC B;  1UFI A;  1GM9 A;  5B1A B;  1VQO V;  3CCU V;  4B08 A;  5IY5 B;  1SS3 A;  1PIP A;  4DR6 B;  4KHP O;  3QF7 A;  2F93 B;  3UQ8 A;  2QKA A;  1AI4 A;  3MHS A;  4YHH B;  2AW9 A;  4CC5 A;  1JFF B;  1L0L H;  2YID A;  4OPH A;  3CB2 A;  1PCI A;  3TK1 A;  3T1H B;  1XMO B;  2BTO A;  4O4I B;  1XIL A;  1GO3 F;  2QJ1 A;  2DC8 A;  1AJN A;  4HYO A;  2RMK B;  2YXL A;  2P5O A;  3MTN A;  3PHW A;  4X62 B;  3CC7 V;  3VQY A;  1NR1 A;  3AG1 B;  3DXR A;  2DJF B;  4EB6 B;  2F66 C;  2OCH A;  1MDW A;  2R9F A;  1AU2 A;  4D6T H;  2RNB A;  1B3Q A;  4ZUX U;  5LA6 B;  4BOP A;  5LBQ A;  1O0E A;  3WB0 A;  3C3T A;  4X20 B;  3N27 A;  2YDE A;  3BRC A;  4D8I A;  4CH5 A;  2DCC A;  4MVM A;  4U3J B;  4PDR A;  4IIJ B;  1L0N H;  3HPL C;  3ICX A;  1W0K G;  4P9O A;  3ABM B;  4PA7 A;  3H01 A;  1X4T A;  1S5J A;  2EIK C;  1VSN A;  4R7C A;  1N36 B;  3JAL B;  3FKS G;  2AYO A;  3ETG A;  1Q90 D;  4I9W A;  1N8R W;  4JPR A;  4O4J B;  4QRG A;  3FX7 A;  5E79 Z;  3RVW A;  4GX5 A;  3LNN A;  3P5X A;  3JAR A;  2IM9 A;  2R9M A;  3KZI Z;  4LF8 B;  2ETN A;  1SP4 B;  3KCY A;  2QWP B;  3Q4H A;  2Q8V A;  3ZMS A;  4PI0 A;  2LJ2 A;  2FB5 A;  3BPZ A;  3BVO A;  4DR5 B;  3S3W A;  4MVU A;  4RO2 A;  2QKC A;  4NTX A;  2WLH A;  2VHF A;  2AVW A;  1S5H C;  2UUB B;  1NPZ A;  3ZHR A;  1THZ A;  5IJ9 A;  1H8H G;  2ZE6 A;  3ABL B;  4B3R B;  3OR6 C;  3OMN B;  4IHJ A;  5CBH A;  1Q81 W;  4HAM A;  4LH6 A;  4TSF G;  4FLY A;  2HH5 A;  3H1L H;  4JI5 O;  4JI4 O;  1OCO B;  1SC5 B;  1YTF B;  4N21 A;  1ME4 A;  2QE7 G;  1Q5O A;  3CCM V;  2CH7 A;  2HVJ C;  2R9C A;  4UVA A;  4U7N A;  4MVR A;  3JAL A;  4DV7 B;  4HNA A;  5EGW A;  1KEC A;  4EFB A;  3KWB X;  1Q3E A;  2DJV A;  4GUN A;  2UXC B;  1JFF A;  3AG3 B;  3CCJ V;  3H8C A;  3ZED A;  2QTS A;  5JJN B;  2BTQ B;  3GVM A;  2DCD A;  2XND G;  5F2V O;  1RM1 B;  5EIB C;  4GT1 A;  1IUR A;  2IH1 C;  1GKF A;  4FLZ A;  4DR2 O;  1VQ8 V;  5B5E Z;  3HKD A;  3RN4 A;  3LUT B;  4NB5 A;  2QM4 A;  3W7W A;  4JI7 O;  2ZCE A;  1PPN A;  5FPW A;  5CBF A;  4EKW A;  2FML A;  1KBH A;  4BIU A;  4X66 O;  4KUM A;  4NXN O;  1GN3 A;  4H33 A;  2OIG A;  2CB5 A;  1PPO A;  2ITC C;  1Y76 A;  3ZS8 C;  1ZUQ A;  1NQC A;  1B04 A;  3OGI B;  3QG5 A;  3D36 A;  1S3J A;  3J80 N;  4LF8 O;  2WAM A;  3WU2 Z;  1FAF A;  3HHI A;  2YI8 A;  4HZ3 A;  3LXS A;  1AR5 A;  4BOQ A;  4I0X A;  2CDY A;  3DSQ A;  1L8D A;  4UVB A;  4B7K A;  5DED A;  3CPW U;  1MA1 A;  2QM8 A;  1U9V A;  4JZ2 A;  3O1G A;  1O9G A;  1NB3 A;  3JAT B;  2F4V O;  1YJW V;  3K04 A;  1JMK C;  5KHH A;  5BMV A;  2JJ2 G;  1A32 A;  4MZS A;  3OD4 A;  1F2C A;  4HWY A;  4W4U A;  3CCQ V;  2ACT A;  1CPJ A;  4DV5 B;  4JI0 O;  1ICF A;  3K5N A;  3HB3 B;  5KHK A;  3K9M A;  2QA4 V;  3P5W A;  4DV6 O;  2UU9 O;  1AU4 A;  2GBO A;  1B06 A;  5JA7 A;  3WXG A;  1NS1 A;  3ZMZ A;  5LMN O;  1WA8 B;  3D36 C;  3BB7 A;  4JGS A;  4XZX A;  5EZQ A;  4O4H B;  2DZY A;  2JDI G;  2P7U A;  1GCB A;  4DMY A;  4XDL A;  3M99 B;  4BAY A;  4GX0 A;  3I56 V;  3OTO O;  3JCU Z;  3USV A;  3ZN0 A;  3K9S A;  2F23 A;  2V4D A;  1I94 B;  4ICG A;  1EN5 A;  3SYA A;  1KB9 F;  3GWO A;  4JI7 B;  2C0Y A;  1F29 A;  2GHU A;  2AU1 A;  4XBF A;  2ATO A;  2Y6E A;  1PE6 A;  1V9P A;  3W7X A;  3PNR A;  3HHA A;  2Q6A A;  2FE8 A;  2G7Y A;  2H7J A;  3HR0 A;  5L3C A;  4PAD A;  4X1K A;  3TRK A;  2PNS A;  3KW9 A;  5CA1 B;  2PF4 E;  1K3E A;  4DR5 O;  2A7W A;  2DW4 A;  3QVN A;  3CC2 V;  2E01 A;  1F7Y A;  4QGP A;  2ZE8 A;  3V6E A;  3CMA V;  5LOV B;  4MSW C;  1R3L C;  2Z5U A;  3PBH A;  2JEX A;  3E8B A;  2A9H A;  4WF9 V;  4B3M B;  1P4R A;  5K1P A;  1NH2 B;  5KAI Z;  4DW0 A;  5J2T B;  1PNM A;  4YIO A;  1ROP A;  1KKC A;  1K73 W;  5LXT B;  5IDJ A;  1EF7 A;  2IBZ H;  3RYF A;  4FVM A;  1GLO A;  5FPR A;  1Q43 A;  4D7S A;  3GCB A;  1CJL A;  1K4C C;  3CH2 X;  2ITD C;  4X64 O;  1SET A;  4DV4 B;  1TUE B;  3BFR A;  1V55 C;  4FZ1 A;  4CDF B;  3QO8 A;  3CHX A;  3G6E V;  2EIJ C;  4X6H A;  3DC5 A;  3U11 A;  3AG4 B;  1P84 F;  3BEH A;  1FXK B;  2ZIN A;  1QXP A;  3STL C;  4J7K A;  2IPP B;  2NQI A;  1K5Q A;  3L74 H;  1BY8 A;  1GMY A;  2CTP A;  4FK5 A;  5C8Y A;  3L72 H;  3T4Z A;  2HJD A;  3NXS A;  2HXZ A;  3IV2 A;  3FD9 A;  3P32 A;  4J10 A;  5FNV B;  1EZV H;  2NNU A;  3K3W A;  3P5U A;  4JI3 B;  1YT7 A;  4X66 B;  3B21 A;  5CA0 B;  1FXH A;  4K35 A;  4NXN B;  1H2K A;  3M8A A;  5BR8 O;  5LP6 C;  5IYB O;  4MZO A;  1SQV H;  3LDC A;  5IYD O;  1SRY A;  4LNU B;  5K16 A;  3JAK B;  1XHZ A;  2XTA A;  4FM2 A;  2E74 B;  4J7Z A;  1YK8 A;  1CTE A;  5A9G A;  2XAH A;  1Q6I A;  3OIS A;  3HWN A;  1Q6H A;  4A5U B;  4PDM A;  3MTV A;  3SR2 C;  5D5P A;  3JD2 A;  3N2G B;  4IL6 Z;  1WB7 A;  3CCV V;  4C7U A;  3CRR A;  4JTC B;  2Q67 A;  5CA3 A;  2ZNJ A;  1FPO A;  1IDS A;  4U7O A;  3PHX A;  2P0R A;  4MVO A;  5LGN A;  1JVM A;  2L6L A;  2ATK C;  4YIP A;  4DV6 B;  3QO5 A;  2UU9 B;  5B1B B;  2J7Q C;  4ZKI A;  3OR7 C;  2LFS A;  5JH3 A;  4I07 A;  4OVZ A;  2YIB A;  1MSW D;  1QHT A;  1HNW B;  4O4H A;  5H5N A;  1M9N A;  2UXX A;  4WFG A;  3B2E E;  4OPA A;  1BSM A;  2EX3 A;  4DUY O;  4OVZ B;  1THE A;  1AVM A;  2W0F C;  5IY5 C;  1XNQ O;  1S76 D;  3VQW A;  1BQ0 A;  5L3G A;  2JQF R;  1D5A A;  2GV9 A;  2UXB O;  3RYI A;  1AI7 A;  3SYO A;  4LFB B;  4LFA B;  3H1J H;  4O4L A;  1VMG A;  1AU3 A;  4JI2 B;  1SA0 A;  3OF8 A;  2DCB A;  3R65 A;  3LFY A;  1SQQ H;  4DO2 A;  2JGU A;  1KQS U;  3RW0 A;  1PNL A;  1N34 O;  1CPY A;  2JJ1 G;  4FPP A;  2Q73 A;  3A8T A;  2JQG R;  4J80 A;  3TNX A;  5EBM C;  5L3F A;  2YUA A;  3VQV A;  1HDJ A;  4ZI7 A;  2A79 B;  4MTO A;  5KHG A;  3E8H A;  4J42 A;  4CS2 A;  4QE9 A;  4UCU A;  1JQP A;  4JI1 O;  4X6J A;  4NTW A;  4I4T B;  2BCC H;  5LHH A;  5H6R A;  1N4C A;  1QLE B;  1VQK V;  2DYR B;  3T4D A;  5HFL A;  2OZ2 A;  3HKB B;  3PN1 A;  3LDD A;  1NVP D;  1VQ4 V;  1MG1 A;  1VAR A;  4AHC A;  1YTF D;  4REZ A;  2IW5 A;  1XQ8 A;  5IE9 A;  5EZS A;  1DF5 A;  1F4M A;  1BT8 A;  2VWK A;  1ITO A;  4JYA O;  4P16 A;  5IJ9 B;  2P86 A;  1TU6 A;  3WG7 B;  1PBH A;  1OCR B;  2JK5 C;  2VRZ A;  1OCC C;  3ZRW A;  4OW0 A;  2X6A A;  2R70 A;  2HVK C;  1Y4H A;  4DUY B;  1M57 C;  1TA8 A;  4CZZ A;  2JRI A;  4K0K O;  3QNE A;  1FD9 A;  5CBG A;  1SZT A;  3SJQ C;  4IYI A;  3SJB C;  1AYW A;  4F6R B;  4O4J A;  1PP9 H;  5LL6 Y;  1IBM O;  5LXT A;  1I5X A;  3KSE A;  2HD5 A;  3TCU A;  3SPI A;  3BC3 A;  3JCZ A;  4W5B A;  1COW G;  4YY3 O;  3IOQ A;  1EN6 A;  4DV2 B;  5JH7 B;  2IJK A;  1Z5V A;  2C2A A;  2AZ0 A;  2RQ6 A;  2HHH O;  1VQ5 V;  3IEJ A;  1R3J C;  3OEE G;  2GUZ B;  3SYQ A;  4OEM A;  1FJG O;  1FXK A;  2YJB A;  1PV0 A;  2Q7G A;  1M56 B;  2EIM B;  4G27 B;  3IFX A;  4ABM A;  4GYC B;  1KXR A;  1CXZ B;  4PA9 A;  4TV9 A;  3PHU A;  3TMP A;  1QVF U;  2VQF O;  3H1I H;  4WFF A;  1RPR A;  1NU1 H;  1WN7 A;  4LBE C;  1O9H A;  1VQ9 V;  3BPM A;  2JVD A;  4BOS A;  1TGO A;  1EBO A;  4GKJ B;  1SNK A;  3OT7 A;  4LH7 A;  3PRP A;  3BCC H;  1U9Q X;  3OEH G;  2N74 A;  2ODM A;  5LHG A;  4PA3 A;  5KMG A;  2HWK A;  4UXN A;  4BS6 A;  1Q6U A;  5B1O A;  1AIL A;  3JYC A;  4QBB A;  4DV0 B;  4PP2 E;  1DLB A;  4L87 A;  1Q6K A;  4LF5 O;  4PP1 A;  1HNW O;  4MTX A;  4MM3 B;  4DXW A;  1AR1 B;  5GON A;  3E8G A;  1J5E O;  4D7T A;  2KSD A;  4RUF A;  1SQB H;  2FTK A;  2Q0A A;  4PEL A;  4JV5 O;  2QGN A;  5CA1 A;  3BA9 A;  4PV1 B;  4FMT A;  3MJ5 A;  2DZZ A;  4QE7 A;  5KA6 A;  4XR7 A;  1NI8 A;  3CS5 A;  1YJN V;  3DXR B;  2BSK A;  3BA8 A;  4LF4 O;  3ML0 A;  3RBZ A;  4K0K B;  2NN4 A;  3J81 N;  3OGC C;  2PUS A;  5LMU B;  2HFE C;  1XEQ A;  3OM3 B;  2QWN B;  3RYI B;  1YEW A;  2CGN A;  4I4T A;  2WBF X;  3U8E A;  3PT2 A;  2DN9 A;  4BQV A;  1KFX L;  4P2Z A;  2JTC A;  3THO A;  2YIC A;  3N2K B;  5EZY A;  1K4D C;  2WPD G;  2QKS A;  4J9Z B;  3MHH A;  1N34 B;  4DK0 A;  1YIJ V;  1MEM A;  4DV2 O;  2PRE A;  3EXA A;  1JJ2 U;  4I5S A;  2ZNI A;  2Y0I A;  4J7J A;  1UJW B;  4DV3 O;  5KHJ A;  2B1I A;  1WNS A;  1ZAU A;  3K5M A;  1BGY H;  4DUZ B;  2EJR A;  3W7S A;  5H2F Z;  2P6J A;  4WUR A;  4OX9 B;  1JR9 A;  2F95 B;  3K8U A;  2GTA A;  2ZM6 B;  1A6R A;  2PBH A;  1R6T A;  2JS3 A;  1M1K W;  1GN4 A;  1Y6X A;  3G6B A;  1S77 D;  3SYC A;  2OP3 A;  3C90 A;  1FFX B;  4GKJ O;  4XUI A;  4RUE A;  3N2G A;  4H44 B;  1IWD A;  1HR0 O;  4K8X A;  5KO3 A;  4BW5 A;  4DV1 B;  2G38 A;  2YIA A;  2OYQ A;  3W7T A;  3L73 H;  1CS8 A;  4HXD B;  3TXS A;  1RM1 C;  2ZDI A;  4DRX A;  3JAW B;  2BDZ A;  1YVB A;  5IJ0 B;  1MEG A;  3AG3 C;  1VP7 A;  2P4V A;  1Y76 B;  2A0L A;  4Q20 A;  4OEL A;  4X1Y A;  1NR7 A;  3D6S A;  4TV8 B;  1AYU A;  1ZCM A;  1VJV A;  4JAU A;  1R73 A;  5DM6 V;  1KD1 W;  1IBM B;  2EIM C;  5FNV A;  3B40 A;  1AYV A;  3P3P A;  1BZK A;  1DK1 A;  5B3S B;  1OCO C;  3D8C A;  1Y67 A;  5LYJ B;  4UV9 A;  3E8F A;  3IUT A;  1CV8 A;  5L3D A;  1K5S A;  2PI5 A;  5EYP B;  1NT2 B;  3IFU A;  4JAS A;  3ASN B;  1PD3 A;  1Q86 W;  4AIL C;  1KP2 A;  5KUM A;  2CAZ C;  4LNU A;  1KMI Z;  3CRA A;  2R6N A;  2EIL B;  2HJF C;  4H37 A;  1Z5W A;  2G6D A;  5JVD A;  1GM8 A;  4YJ2 A;  2FKX A;  1XOU A;  4OX9 O;  1YSC A;  3JAM N;  1IX9 A;  4W5C A;  4PJ0 Z;  4PI2 A;  4O2A A;  1AB3 A;  3MHS C;  2HR3 A;  4YYW A;  2PYL A;  3SDL A;  2ZIM A;  3UT5 B;  5JZE A;  4H0L B;  2XAQ A;  2B5U A;  2EIK B;  2H3O A;  4NYK A;  1XNR B;  3RYH A;  3A0R A;  5DN6 G;  2AHY A;  2E5L B;  4DYL A;  1HR0 B;  3ZBH A;  2FT2 A;  1SQP H;  2QWR B;  4TT3 G;  4FK5 C;  4PA4 A;  5CVM A;  4LF9 O;  3CJH B;  4B3T B;  2UUC B;  4JV5 B;  3RYH B;  1ZLZ A;  4B7E A;  2FRQ A;  5KAF Z;  3FFQ A;  3JD3 A;  3CBK A;  4MI7 A;  5LYJ A;  4JI6 O;  3OQC A;  2X6B A;  1YAL A;  1D5N A;  4EB6 A;  1LNQ A;  4K3A A;  5DEC A;  1WP7 A;  3O65 A;  3K06 A;  4DR3 O;  1FKA O;  1DF4 A;  4TV8 A;  3IC9 A;  4MW8 A;  3KWZ A;  2ZE5 A;  2WLL A;  2OCC B;  4F6E A;  3ZRS A;  3F75 A;  3RVY A;  2LQT A;  3JAS B;  2ZR3 A;  4ZHQ B;  2FUD A;  3CXC U;  3M99 A;  1TVK A;  4DR6 O;  2ZXW C;  4OXS A;  4PT5 A;  2UXN A;  5LOV A;  2RCV A;  2QM7 A;  1EWL A;  3PRM A;  2WLM A;  4R50 A;  4J41 A;  1CB5 A;  2XOK G;  4B3R O;  2PAD A;  2WSS G;  5B3S C;  3T1H O;  4CZW A;  3KKY A;  2PGG A;  5EBW C;  2DYS B;  2GFO A;  4LF6 O;  3ZRV A;  1XI1 A;  3K59 A;  3ZRX A;  4JI4 B;  5CVO B;  1SA0 B;  1ZL8 B;  4X89 A;  2XU4 A;  4UCO A;  1IBK B;  4X62 O;  3I3T A;  2IJH A;  5FPO A;  3E1Z B;  3OW2 U;  2OTJ V;  3T1Y O;  3QSD A;  5JQG A;  2YS8 A;  5GTH Z;  5C93 A;  5B1N A;  4N8W A;  5J2U B;  1JPX A;  2ZT9 B;  3JAT A;  1WB8 A;  5CMU A;  1GTO A;  1BHA A;  5D5Q A;  4CH3 A;  4DV1 O;  1MZE A;  2IJI A;  3UO3 A;  4JI8 B;  1HNZ O;  2BDL A;  2EZP A;  1NVP B;  1XNR O;  2ZQM A;  4KXR A;  2J7Q A;  1BE3 H;  3CYO A;  4MVZ A;  1WPX A;  3UM7 A;  3UCS C;  2NR5 A;  3PJS K;  1N36 O;  3QT4 A;  3ABM C;  3W31 A;  1FFX A;  4CS4 A;  5KA5 A;  2Q5Z A;  4BWA A;  1PL0 A;  2DC7 A;  4H13 B;  5CVN B;  3LNM B;  4DR4 B;  1S0V A;  3ZCC A;  4MVQ A;  2Q7H A;  5JQG B;  1IBL B;  1X59 A;  2RJZ A;  3LSS A;  2PZS A;  4I04 A;  1I5Y A;  4AQY B;  2E76 B;  4XDJ A;  2B1N A;  4UCV A;  4FLT A;  1JOY A;  2NQG A;  1DF0 A;  2KKW A;  3MAQ A;  3AG1 C;  2EZO A;  2Z3Y A;  4DR7 O;  3L70 H;  3IHP A;  4NR1 A;  1W59 A;  4I0X B;  2OCC C;  3A0H Z;  2CUG A;  1NBM G;  4J11 A;  2OIE A;  1TUB A;  3WFV A;  1E79 G;  3MD0 A;  5IYZ A;  4ZHQ A;  3B8N A;  1OV9 A;  1NH2 D;  5KLV H;  5CHT A;  2OT5 A;  1N33 B;  2RDC A;  1BQZ A;  3U0Z A;  1OCZ B;  4K7C A;  3LSQ A;  3OMI B;  3CCS V;  4GKK B;  3SPJ A;  1NTZ H;  2CH7 B;  1STF E;  5B1A C;  1AI5 A;  4X6I A;  1XHX A;  3CEI A;  3E35 A;  3B79 A;  3BBA A;  4YJ3 B;  3ZJZ A;  4IHJ B;  4RWU A;  4X9Q A;  5LMN B;  3ZMT A;  2E5L O;  1RSO B;  2H94 A;  2QWQ B;  4JAA A;  4MSX A;  1JJO A;  3FAV A;  2FTD A;  1QLE C;  4JI8 O;  4DR2 B;  1YF2 A;  2XU3 A;  2X6C A;  4UV8 A;  4FM1 A;  2EIN B;  4RF1 A;  2EJ7 A;  5EC2 C;  1G6U A;  1YXB A;  2WLL B;  1KUQ A;  1I94 O;  2P06 A;  5E1A C;  4GX1 A;  1MAB G;  5CA0 A;  2V1D A;  3RVV A;  2YEV A;  2YEV B;  4N4Z A;  4ZBM A;  5GW7 A;  1F23 A;  4ZOL A;  4CDD B;  3K57 A;  4QIW F;  2PYJ A;  1IBL O;  3SPH A;  2H8P C;  1NTK H;  3ASN C;  4AQY O;  4BS5 A;  4P6G A;  2QTO A;  1PPD A;  1HWY A;  1GM7 A;  2HHN A;  3I5D A;  2BOB C;  1H8E G;  2AS8 A;  4NXM B;  1EWO A;  4E2L A;  4BR6 A;  3ASO C;  4B3M O;  1MSD A;  5JH7 A;  1AIM A;  2GDS A;  2OUL A;  2IJJ A;  2KQX A;  1AU0 A;  3JD1 A;  4FLX A;  1VIB A;  4YHH O;  2AGA A;  1E1Q G;  1OCZ C;  3HKB A;  1IBK O;  4JI0 B;  3T1Y B;  4FLV A;  5JVD B;  2W0X A;  2Q68 A;  2F7D A;  1QDQ A;  4BOZ A;  2CTW A;  3VOU A;  4ZIB A;  3ZN1 A;  4FLW A;  1AJQ A;  1VQ7 V;  1ARO P;  1ATK A;  1TLO A;  3WB1 A;  3RYC B;  1GAX A;  3WG7 C;  4U3J A;  2LP7 A;  3WXE A;  2M7W A;  2B1M A;  2QR4 A;  2EIL C;  5PAD A;  3BHP A;  1V54 C;  4Q8G A;  4CH6 A;  1ZX3 A;  4TUY A;  4B3S O;  1GK9 A;  3JSL A;  2ADP A;  4LR3 A;  4YYV A;  4PI3 A;  3PW3 A;  5LP6 A;  1K34 A;  3CH3 X;  3TET A;  2GSM B;  3APO A;  2LGQ A;  5IWA B;  2DJG B;  5JCO C;  3K03 A;  1OJH A;  1IVS A;  3F5W C;  1M90 W;  5IYZ B;  2FYU H;  1QNM A;  3O0U A;  2GTS A;  1N0N A;  2KG7 A;  3FB7 C;  4DR1 O;  2Y4U A;  1PL4 A;  2FQ9 A;  3IMA A;  4GZR B;  3HKC A;  5A2Q N;  4UCR A;  1KU9 A;  3HKE A;  1NKD A;  3EVK A;  4IUM A;  2LFR A;  4KLB A;  1N33 O;  1RPO A;  4GUA A;  4RQE A;  1NQT A;  3MOR A;  1WP8 A;  2AIM A;  3L9D A;  3K5O A;  4TQF A;  3ASO B;  2DC9 A;  1NLJ A;  1R3K C;  1W2B U;  3CC4 V;  3WB2 A;  1G8M A;  5KX5 B;  3OUF A;  2DQ3 A;  1BP4 A;  2F1G A;  3KX1 A;  1QVG U;  1WAZ A;  2OTL V;  5K1X A;  1AEC A;  3CX5 F;  3ZHQ A;  1IXM A;  3IGA C;  2YJC A;  1Q8I A;  2LW1 A;  2P90 A;  2A06 H;  1V55 B;  5B66 Z;  2ZXW B;  1M4U A;  2WLI B;  2Y48 A;  3H89 A;  3QJ3 A;  1MOF A;  3M7M X;  4F4L A;  4NVP A;  5GON B;  1EFR G;  4U3F H;  1SQG A;  2M6Y A;  3W30 A;  3MDS A;  1M6D A;  2BTW B;  5J94 A;  3CWB H;  4Z1M G;  1R3I C;  4QPK A;  2ZR2 A;  2ARH A;  1D2D A;  5BXZ A;  2R9A A;  1DGS A;  4DMX A;  4P30 A;  5BR8 B;  3UKM A;  1M56 C;  3AK3 A;  2YXH A;  2YI9 A;  4D8E A;  4JI2 O;  1T5E A;  5KHI A;  1GMG A;  3CXH F;  3V6C A;  2XT9 A;  2XAF A;  5LGU A;  1Y4M A;  5IWA O;  3CP1 A;  4X1I B;  3DF0 A;  1VEW A;  4QRV A;  2W6J G;  4A5U A;  4O2B B;  4IGG A;  3ZHV A;  3K9A A;  2EBO A;  4PDL A;  3G4S V;  5KUK A;  2K9P A;  3ZHS A;  2BTQ A;  3CCE V;  4AXL A;  3FYI B;  3RVZ A;  3SJA C;  1VF6 A;  2VHS A;  4P6E A;  1I0H A;  4DR1 B;  4JAV A;  4CC6 A;  3E86 A;  1KKD A;  4FLU A;  3W7U A;  3OMA B;  1FYJ A;  4JI5 B;  3A2F A;  1SKV A;  2JGD B;  4I55 B;  2WLJ A;  2VS0 A;  4O2A B;  2F4V B;  2E3C A;  1URF A;  3BPF A;  1OCR C;  2YJ2 A;  4DV7 O;  3BY4 A;  2VQE O;  3B4S A;  1VQN V;  2XAJ A;  2QSA A;  4UFZ A;  2HKO A;  4BPV A;  3BAA A;  1G4Y B;  4WFH A;  1RFY A;  1DKI A;  4GX2 A;  2XUM A;  2F1M A;  3FB5 C;  4IIJ A;  3FAV B;  4FFB B;  2Y5B A;  1ZIV A;  3N3K A;  1EM1 A;  1Q7Y W;  1CVZ A;  4O2B A;  2DYR C;  4QH6 A;  5EYP A;  4MTG A;  3Q4H B;  1MIR A;  3PSE A;  4UCT A;  3UT5 A;  3OVZ A;  5CHV A;  1F2A A;  4L8J A;  4YV8 A;  4LFB O;  2WA4 A;  1VF6 C;  3E22 B;  1N0J A;  2K1E A;  1S72 V;  3S3X A;  3J7A U;  1DEU A;  4YJ2 B;  3JSN A;  1JA8 A;  3K24 A;  2Z84 A;  2R72 A;  3APQ A;  4RY2 A;  3F7V C;  3VBB A;  2IU3 A;  1TUB B;  2AYN A;  2XU1 A;  3RFR A;  1CSB B;  3S3R A;  5H6Q A;  4BIZ A;  1FJG B;  2EIN C;  2FO5 A;  4WA6 A;  1ZTE A;  3X2Q B;  2CIO A;  4MS2 A;  3ZNH A;  1WA8 A;  1U5I A;  4JYY A;  4X1I A;  3T2M A;  3RVX A;  1K92 A;  1R6N A;  1SF9 A;  4YJ3 A;  4UB6 Z;  4BIO A;  4YXW G;  2CGO A;  2NQA A;  1YHQ V;  1MS6 A;  1U9W A;  4CDE B;  3B09 A;  1QBZ A;  2GHY A;  4I9Q A;  2LW7 A;  2Y4T A;  2ZE7 A;  5A24 A;  4X1Y B;  1QCE A;  4BOU A;  4Z1V A;  4DV5 O;  4KFM A;  3C3S A;  3EFF K;  3P3N A;  4E4E A;  1K9M W;  2XAG A;  4YYR A;  1BGO A;  3WXF A;  4DV4 O;  4JYA B;  5IJ0 A;  3VQX A;  2VQE B;  1GN2 A;  3HKE B;  3HKC B;  1GN6 A;  5B1B C;  3MHH C;  5ITZ A;  3KCX A;  4N79 A;  1HP8 A;  3RT3 C;  3ZX6 A;  4WFA V;  3FB8 C;  4BSQ A;  2HG5 C;  3AK1 A;  4WFB V;  4LF7 O;  3AG2 B;  1U97 A;  2QDO A;  4GCZ A;  3OTO B;  3IAY A;  1QR9 A;  3L75 H;  5J9P C;  3K79 A;  4JF3 A;  1PVJ A;  3QTC A;  3ZMU A;  2HEP A;  1YVW A;  2Q4P A;  1KP3 A;  3ABL C;  3ABU A;  1DTO A;  2UZJ A;  5LMU O;  1I7F A;  2YIB D;  2CE4 A;  2AXT Z;  2PTM A;  4AXM A;  4YY3 B;  4LC1 A;  5CB4 B;  2BSK B;  1TL9 A;  1U96 A;  5FL7 G;  3TJT A;  1AR4 A;  2P7T C;  3R66 A;  3AG7 A;  3RGB A;  1XMQ B;  4QRX A;  3ERV A;  1YI2 V;  1F51 A;  1VQ6 V;  4TUY B;  2DE0 X;  1QOL A;  3N3G A;  4LWS A;  5L3E A;  1M5I A;  2BU3 A;  3MP2 A;  1TVK B;  4XDK A;  3ABT A;  2VQF B;  2FYE A;  4UB8 Z;  1L1F A;  1H2N A;  9PAP A;  2YC0 A;  2CK3 G;  1HW7 A;  2W6I G;  4I05 A;  2OWO A;  2BOC C;  2D2C B;  1QQC A;  3OE7 G;  3ZHU A;  4Q6G A;  3CE2 A;  1ENV A;  2IH3 C;  4X64 B;  1MZF A;  2DC6 A;  3E22 A;  5EBL C;  3HKD B;  1Y08 A;  4DV0 O;  1EWM A;  3OF9 A;  1SQX H;  2D3O W;  2IU0 A;  4YYU A;  1FS0 G;  3ETQ A;  1N32 O;  1XRE A;  2YSU B;  4LCU C;  1J5E B;  2EIJ B;  3K0G A;  2DYS C;  4R3D A;  4DW1 A;  3CJH A;  1KC8 W;  4JTA B;  1X9Y A;  2QEX V;  4KP4 A;  3QO7 A;  2R9I A;  1YDX A;  3JAS A;  1R1B A;  3ETE A;  4HNA B;  1AP6 A;  1XNQ B;  3BCN A;  1I08 A;  3U10 A;  4FFK A;  1AP5 A;  1JQ0 A;  4ZOL B;  3E89 A;  4F6R A;  4JI3 O;  4WCE V;  1NB5 A;  4NTY A;  3KFQ A;  1YZB A;  3RYF B;  2JGD A;  1ME3 A;  4P9P A;  3P5V A;  1IZ3 A;  3A0B Z;  4QJF B;  3LSU A;  1S4V A;  2HP8 A;  4RQF A;  1NZ6 A;  1FH0 A;  1FFT B;  1M57 B;  4RF0 A;  2YJ8 A;  3E9S A;  4G2K A;  4ZTB A;  4DV3 B;  4FFB A;  3LDE A;  5FLX N;  1BL8 A;  2DCA A;  3H8B A;  2GUZ A;  4FJC A;  3F5T A;  1R6K A;  2ILM A;  3STZ C;  3TXQ A;  2ADQ B;  5EF4 A;  1Z2G A;  3TGU H;  1YK7 A;  4X20 A;  4G28 B;  4TOI A;  3GB7 C;  2KB1 A;  2MK3 A;  2ZM6 O;  3E83 A;  3I06 A;  2Y0P A;  1FXK C;  1H2S B;  3AG4 C;  4K8Z A;  5EIB D;  2ZDI C;  5LHI A;  5JCO A;  4I55 A;  4NKG B;  1KHQ A;  4O4I A;  5BY1 A;  2E00 A;  1US6 A;  1BS3 A;  4MTF A;  1PPJ H;  4ZI7 B;  3ZRW B;  4OGQ B;  6PAD A;  2Z0A A;  1K7D A;  2P4K A;  2G8J A;  2EUL A;  2FL4 A;  4YYQ A;  4CS3 A;  4LF9 B;  1H2G A;  1LR1 A;  1QU7 A;  5EC1 C;  4RAI A;  1EWP A;  3D3I A;  3KG2 A;  3OTF A;  1XBL A;  1XDC A;  5GTI Z;  4MT8 A;  3CRM A;  3CME V;  4LF7 B;  3OVX A;  2AZ2 A;  4IT5 A;  1EN4 A;  1XKG A;  4JI6 B;  1SQF A;  4JZG A;  4UVC A;  1Y66 A;  3CSX A;  2NLJ C;  3H9V A;  4FZ0 A;  2UXB B;  4M0W A;  4PDV A;  1LUW A;  2DWD C;  1UPG A;  4LFA O;  2E03 A;  4DR3 B;  2HLD G;  1PXV A;  5BMV B;  1WPB A;  3H7D A;  1LUV A;  3F7Y C;  1PPP A;  2FRA A;  1K97 A;  2CTR A;  1H2L A;  1TAE A;  3HD3 A;  2BTW A;  3P30 A;  3K0D A;  4JYB A;  5JJE B;  4LP8 A;  1XMQ O;  3B8M A;  2X7R B;  5AG2 A;  1K3B B;  4LWS B;  3CD6 V;  2G8E A;  2QWO B;  2WLI A;  2CTQ A;  2KG7 B;  1PM9 A;  4WFE A;  2O57 A;  3CCR V;  1MNG A;  1PKX A;  4N23 A;  4J9Y B;  4UCS A;  2R9O A;  4JI1 B;  3ETD A;  5CB4 A;  1P7B A;  1OCC B;  3ABK C;  2UUA O;  2UXD O;  4YVA A;  2MW2 B;  2BE3 A;  4MW3 A;  5KX5 A;  1IXB A;  2DQ0 A;  1P7G A;  4YYS A;  4I50 B;  4I50 A;  3K08 A;  1W0J G;  5E6J A;  2ZD9 A;  1RP3 B;  1ZL8 A;  3L71 H;  1BHB A;  1KYO F;  2DMX A;  2WLK A;  3B77 A;  3SJC C;  4D8B A;  1N32 B;  3CRC A;  1ZWI C;  3AG2 C;  1Y74 B;  4X65 B;  1BQI A;  3SYP A;  1ORQ C;  4FM0 A;  1V54 B;  5H9C A;  5ITZ B;  4LF5 B;  4R6Z A;  4QNH B;  3CRQ A;  2ZIO A;  3RYC A;  2B1G A;  2LGW A;  4CH4 A;  2A3Q A;  1JCH A;  1CP9 A;  1F4N A;  1POP A;  2P67 A;  5KMG B;  2Y69 B;  5J2U A;  2DOS A;  3UO2 A;  5JWP A;  3SPG A;  4MVS A;  4RNA A;  3DTU B;  5LGT A;  3DC6 A;  5LP6 B;  1WLE A;  4LF4 B;  2AHZ A;  5F02 A;  1NL6 A;  2E75 B;  1E1R G;  4PD4 F;  4TV9 B;  2AUX A;  2WLN A;  4LFC O;  1AI6 A;  4X8A A;  2Q0O C;  1M93 A;  4W4K A;  2HHH B;  4DR7 B;  1SZX A;  3AK2 A;  4WBN A;  2V7Q G;  1XUQ A;  4QPJ A;  2JIZ G;  2X0L A;  4ASU G;  3D3Q A;  1GH6 A;  1KHP A;  2NQD B;  1OHH G;  3FYE B;  4KHP B;  2R9N A;  2F43 G;  3G71 V;  1VQL V;  4LF6 B;  3JD4 A;  3JAK A;  2JEU A;  1NTM H;  3FB6 C;  2Q9L A;  1AJP A;  1XMO O;  2XAS A;  1K33 A;  4R8C A;  4X88 A;  3OAA G;  3ZHT A;  4G54 A;  4KL1 A;  3F5V A;  1NJI W;  2UUA B;  2UXD B;  4JTD B;  1H2M A;  4GKK O;  1VF5 B;  5IYC O;  4GLX A;  2ZKO A;  3C9E A;  1XL6 A;  1J95 A;  1QLN A;  3ZIA G;  1BCC H;  5J2T A;  3OFN G;  3GWK C;  5C8Y B;  1Q82 W;  3O9O A;  1CQD A;  1HUC B;  1XL4 A;  1HNZ B;  3ZUA A;  5L3B A;  3H1K H;  1YJ9 V;  3H1H H;  1QR8 A;  4FIP A;  2E02 A;  2LO1 A;  5HFM A;  2O6X A;  4I7Z B;  4CBC A;  4WBN B;  1RSO A;  4W4L A;  1VF7 A;  3RNV A;  4IP3 A;  3JD0 A;  4X1K B;  1FXV A;  4BW9 A;  2DWE C;  1HNX O;  4DR4 O;  3JAR B;  1U9X A;  1YCI A;  2IBI A;  2Q69 A;  1CEZ A;  3RWR D;  1F2B A;  3BOW A;  1H38 A;  3K58 A;  2PY5 A;  1K8A W;  1GEC E;  1P49 A;  5TIS Z;  3BAB A;  5CN0 A;  4EEQ A;  2ARY A;  1SER A;  1MHW A;  3S3Q A;  1G1X B;  1BMF G;  1PNK A;  1S5L Z;  3DGE A;  3EHB B;  1KFU L;  4NXM O;  2UUB O;  3NHE A;  5BZB A;  1UKF A;  1WJZ A;  2R9R B;  2B9Z A;  1EZJ A;  1GRJ A;  2L35 A;  1PAD A;  5LA6 A;  3BWK A;  4AI8 A;  4DUZ O;  4EFE A;  2JS5 A;  3NR7 A;  3SPC A;  3I55 V;  3BY6 A;  3CBJ A;  2Q7E A;  4HBN A;  1YIT V;  2AUZ A;  4FJC C;  2P22 C;  1OZ0 A;  2Y69 C;  3IJ4 A;  3E2E A;  2YXY A;  1VQP V;  3G80 A;  4CDC B;  1JX9 A;  1SES A;  2N05 A;  2UXC O;  3SGI A;  2RN9 A;  4TWK A;  1QMY A;  2WWW A;  1VQM V;  3JAW A;  4DRX B;  5EK0 A;  2VWJ A;  8PCH A;  3PDF A;  4X65 O;  3AI8 A;  1Y74 A;  2XHB A;  4JYC A;  4Z2W A;  3AEI A;  4B3S B;  3OUS A;  3ZMV A;  3G67 A;  5IT9 N;  4B3T O;  2UUC O;  3N4C A;  3N2K A;  5EZY B;  2PI4 A;  4IYH A;  2XU5 A;  4PHZ A;  3T1C A;  5JJJ B;  4DK1 A;  2YJ9 A;  1B6Q A;  3IC7 A;  3CCL V;  2N04 A;  4O4L B;  1HNX B;  4FIP C;  4RKX A;  4PA6 A;  3ABK B;  4TQD A;  3K5L A;  3C0R A;  2WA3 A;  3KKU A; 
#chains in the Genus database with same CATH homology
 3RNV A;  4IP3 A;  3PSE A;  4DV6 O;  2UU9 O;  3PHU A;  4MI7 A;  4JI6 O;  3R66 A;  1HR0 O;  3TMP A;  3OQC A;  2VQF O;  2ZM6 O;  4JI5 O;  4YHH O;  1HNX O;  4LFB O;  1NS1 A;  2AGA A;  4JI4 O;  4DR4 O;  4D8B A;  5LMN O;  4DR7 O;  1N34 O;  1IBK O;  3BB7 A;  4HXD B;  4XZX A;  5EZQ A;  4BOS A;  3J7A U;  3O65 A;  3B21 A;  4DR3 O;  1FKA O;  2BU3 A;  3M8A A;  5BR8 O;  4KHP O;  3PRP A;  3W30 A;  3MP2 A;  2BTW B;  4BOZ A;  5BY1 A;  2N74 A;  2HWK A;  2Z84 A;  4OPH A;  3OTO O;  2DJV A;  4JI1 O;  1D2D A;  5BXZ A;  1AIL A;  1G1X B;  2Z0A A;  2DOS A;  4DR6 O;  4PT5 A;  4RNA A;  4LF5 O;  4NXM O;  1HNW O;  4MM3 B;  2UUB O;  3PRM A;  1J5E O;  3PHW A;  4A5U B;  3ZNH A;  4D8E A;  3MTV A;  1UKF A;  4JI2 O;  4B3S O;  4JV5 O;  4B3R O;  2FE8 A;  1DK1 A;  4DR2 O;  3BBA A;  4DV0 O;  3T1H O;  4DUZ O;  4REZ A;  3MJ5 A;  3TRK A;  5IWA O;  4BOP A;  4LF6 O;  4LFC O;  5EZS A;  4JI7 O;  4DR5 O;  1N32 O;  4M0W A;  2E5L O;  1F7Y A;  4A5U A;  4X62 O;  4JYA O;  4LF4 O;  3IFU A;  4P16 A;  4R3D A;  4D8I A;  5KO3 A;  3T1Y O;  4X66 O;  4LFA O;  3J81 N;  4NXN O;  2LW7 A;  3PHX A;  4JI8 O;  1XEQ A;  4BOU A;  4DV5 O;  4OW0 A;  1R1B A;  3PT2 A;  4RF1 A;  2JTC A;  2UXC O;  1KUQ A;  4DV4 O;  1I94 O;  2J7Q C;  3J80 N;  4LF8 O;  2JRI A;  1FYJ A;  2BTW A;  4K0K O;  1XMO O;  4DV1 O;  1XMQ O;  4OVZ A;  4DV2 O;  1HNZ O;  2FKX A;  1XNR O;  4X65 O;  4OX9 O;  4JI3 O;  3RT3 C;  5H5N A;  4DR1 O;  3JAM N;  4GKK O;  2J7Q A;  4BOQ A;  2ZKO A;  4DV3 O;  5LL6 Y;  1YZB A;  4OPA A;  4DUY O;  1IBM O;  1AB3 A;  4OVZ B;  4X64 O;  5A2Q N;  3BY4 A;  4DV7 O;  4LF7 O;  1IBL O;  2VQE O;  3SDL A;  5IT9 N;  4AQY O;  4B3T O;  2UUC O;  1XNQ O;  4IUM A;  5JZE A;  1N36 O;  1N33 O;  4YY3 O;  3W31 A;  4GUA A;  4WUR A;  2HHH O;  4RF0 A;  2UUA O;  2F4V O;  2UXD O;  3E9S A;  1PVJ A;  2UXB O;  1DKI A;  4ZTB A;  1A32 A;  5FLX N;  1R6T A;  1FJG O;  2UZJ A;  3F5T A;  4LF9 O;  1X59 A;  5LMU O;  4RKX A;  5E6J A;  3C0R A;  4JI0 O;  4B3M O;  4GKJ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...