3TMPA

The catalytic domain of human deubiquitinase duba in complex with ubiquitin aldehyde
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
169
structure length
165
Chain Sequence
AGYNEDEYEAAAARIDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords OTU domain-containing protein 5
total genus 57
structure length 165
sequence length 169
chains with identical sequence C, E, G
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.80 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3tmpA01
3PT2A 3PRMA 4BOZA 4BOPA 3BY4A 4BOUA 3PHUA 3TMPA 5JZEA 3C0RA 3PHXA 3PSEA 4HXDB 4BOSA 3ZNHA 3PRPA 4BOQA 3PHWA
chains in the Genus database with same CATH superfamily
2JTCA 1NLJA 3BB7A 3C0RA 4QBBA 5EGWA 3H89A 5A24A 3HD3A 4BPVA 1PPOA 1BP4A 2YJ8A 3PHXA 1TU6A 5JH3A 3O0UA 4FIPA 2FYEA 2R9MA 1SP4B 3M99A 1AU4A 2PBHA 1THEA 4WA6A 1ME4A 2C0YA 1F2CA 1TL9A 1BY8A 4Q8GA 3PRMA 2AU1A 1MDWA 2DJGB 1F29A 4G54A 3S3QA 3WXEA 2PNSA 3QJ3A 2FRAA 4OELA 1AECA 1TLOA 1PIPA 4ZTBA 2UZJA 4A5UA 1PPNA 2J7QA 4D8EA 4M0WA 2ACTA 1Q6KA 2E00A 1VJVA 2OP3A 4PT5A 5CVMA 2AS8A 4XUIA 2GFOA 1GMYA 1FH0A 3TMPA 3O1GA 4MI7A 1F2AA 3KWZA 3LXSA 1PXVA 2FO5A 1JQPA 5CVOB 1MEMA 3N4CA 4FJCA 5PADA 4W5CA 1M6DA 1YT7A 1GECE 2XU4A 3PW3A 1CSBB 5E6JA 1A6RA 4PP1A 3NHEA 4PADA 2E02A 3RVVA 2AUZA 1EWPA 1CTEA 1HUCB 4PP2E 2AIMA 3PDFA 2B1NA 3W31A 4BOQA 1QXPA 1U5IA 4X6IA 1IWDA 4CDCB 4DMXA 2DC7A 1EWOA 3I06A 2IPPB 2YJ2A 3BPFA 1GCBA 3QT4A 4RF0A 1YK7A 1PCIA 3F75A 1YK8A 3MHSA 2NQAA 4W5BA 5K16A 3V6CA 4DMYA 4AXLA 4BS5A 1KFXL 4RF1A 4XR7A 1U9WA 3H8CA 1MS6A 2R9CA 4RNAA 4QRVA 2F1GA 3QSDA 3ZUAA 3TRKA 3D6SA 2XU3A 3I3TA 3MTVA 1CPJA 4P6GA 4QRXA 4I05A 2FTDA 4MM3B 3PNRA 2R9FA 2IBIA 3USVA 3MJ5A 1CJLA 2P86A 3WXGA 3HWNA 1U9VA 1EWMA 3E1ZB 2DCAA 1QDQA 3P5VA 1ZIVA 3MP2A 2G7YA 6PADA 2BTWA 2DCDA 3KSEA 3P5UA 3E9SA 4RKXA 3OF8A 3N3GA 2XU1A 1EWLA 3MHHA 1DEUA 1XKGA 5JZEA 4BS6A 1QOLA 2AVWA 4MZOA 2AYNA 3KW9A 3HHIA 2CIOA 2DZZA 2NQDB 3MORA 4YVAA 3IV2A 4MSXA 3KKUA 2HH5A 5JA7A 4N79A 3V6EA 4BSQA 3BBAA 1ATKA 4K7CA 1UKFA 2J7QC 2HD5A 1CB5A 1PVJA 2E03A 3B79A 4BOSA 4CDFB 1NL6A 3HHAA 1YZBA 3K24A 1AIMA 3CH2X 5KO3A 1PBHA 1EF7A 3BCNA 4OVZB 4YV8A 2P0RA 4KLBA 3IUTA 2PADA 4YYUA 1X9YA 2ARYA 4IP3A 3H8BA 4OVZA 3W30A 3OVZA 3PSEA 4HXDB 4YYQA 4CZWA 3DF0A 2DZYA 2AYOA 3K8UA 2OULA 2YJCA 2OZ2A 3RVXA 5EZQA 1AU0A 3P5WA 2P7UA 1PE6A 3H6SA 1F2BA 2FT2A 2HXZA 9PAPA 1PPPA 3P5XA 2AUXA 2NQGA 3OQCA 3PHUA 2PREA 2YJBA 2JQGR 1KXRA 3PHWA 1VSNA 2FE8A 4BQVA 1U9XA 2BDLA 3CBKA 1CV8A 2HWKA 8PCHA 1AYUA 4I07A 2DC8A 3KFQA 1QMYA 1KFUL 4D8BA 1AU3A 4WURA 4QH6A 2FQ9A 3U8EA 4ZUXU 2DCCA 1MEGA 5CVNB 4P6EA 3O65A 1DKIA 3PT2A 1S4VA 2NQIA 4OW0A 3KX1A 2ATOA 3IMAA 4N4ZA 3C9EA 1KHPA 1U9QX 3BOWA 4HWYA 3TNXA 2BDZA 2AGAA 2Z84A 4CDDB 3CH3X 2WBFX 1KHQA 2DOSA 4RY2A 3S3RA 3AI8A 3BPMA 1Y4HA 5FPWA 4I04A 1AYVA 4R3DA 1NQCA 2Y6EA 1PADA 3KWBX 4X6JA 3IFUA 2BTWB 4XZXA 3PBHA 2O6XA 4QRGA 1NPZA 5EZSA 4Q8HA 3K9MA 5F02A 2HHNA 2JRIA 3OVXA 2VHFA 4D8IA 2XU5A 1MHWA 3LFYA 4BOZA 3RNVA 1PPDA 3CBJA 4IUMA 2BU3A 1DF0A 4YYRA 4BOPA 1ME3A 1Y08A 4MZSA 2DC9A 3BWKA 4PI3A 3IHPA 2R6NA 4P16A 2VHSA 4OEMA 1BQIA 1ITOA 3WXFA 3BY4A 4BOUA 3RVWA 3MTNA 4CDEB 2H7JA 1BGOA 2G8EA 2R9OA 3ERVA 1ZCMA 4YYSA 1NB3A 1AYWA 3ZNHA 3B21A 4YYWA 5J94A 2DJFB 2FRQA 5EF4A 2F7DA 1YVBA 1MIRA 1YALA 4REZA 2JQFR 3GCBA 3OISA 2FUDA 2CB5A 4GUAA 5CHVA 2GHUA 1AU2A 1CVZA 2B1MA 2DCBA 4N8WA 3N3KA 3IOQA 3BC3A 4FK5A 1SNKA 4W4UA 1CS8A 2Y5BA 1POPA 1CQDA 7PCKA 3OF9A 1GLOA 3PRPA 1STFE 1K3BB 4YYVA 1NB5A 2R9NA 2G8JA 3IEJA 1ICFA 1O0EA 2G6DA 5CHTA 4X6HA 2DC6A 3H7DA 3F5VA 2E01A 2YJ9A 4AXMA
chains in the Genus database with same CATH topology
2BTWB 3B21A 3PRMA 3PT2A 3MTVA 2JTCA 4XZXA 4OW0A 1YZBA 3BB7A 3C0RA 5E6JA 2BTWA 4PT5A 5EZQA 2FE8A 3PRPA 5EZSA 4RF0A 3E9SA 4P16A 2JRIA 4RKXA 4MM3B 3TMPA 4MI7A 3PHXA 2AGAA 2Z84A 3BBAA 4REZA 3MJ5A 2HWKA 4D8IA 5KO3A 1UKFA 4OVZB 4BOZA 4GUAA 4D8BA 3BY4A 4BOUA 4WURA 2J7QC 3RNVA 5JZEA 4IUMA 2BU3A 2DOSA 2UZJA 4ZTBA 3W31A 4BOQA 4IP3A 4RF1A 4A5UA 1PVJA 3PHWA 2J7QA 3OQCA 4BOPA 3PHUA 4OVZA 4R3DA 4RNAA 3W30A 3TRKA 3O65A 3PSEA 4HXDB 4BOSA 4D8EA 3ZNHA 1DKIA 3MP2A 4M0WA 3IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT2 A;  3PRM A;  4BOZ A;  4BOP A;  3BY4 A;  4BOU A;  3PHU A;  3TMP A;  5JZE A;  3C0R A;  3PHX A;  3PSE A;  4HXD B;  4BOS A;  3ZNH A;  3PRP A;  4BOQ A;  3PHW A; 
#chains in the Genus database with same CATH topology
 2JTC A;  1NLJ A;  3BB7 A;  3C0R A;  4QBB A;  5EGW A;  3H89 A;  5A24 A;  3HD3 A;  4BPV A;  1PPO A;  1BP4 A;  2YJ8 A;  3PHX A;  1TU6 A;  5JH3 A;  3O0U A;  4FIP A;  2FYE A;  2R9M A;  1SP4 B;  3M99 A;  1AU4 A;  2PBH A;  1THE A;  4WA6 A;  1ME4 A;  2C0Y A;  1F2C A;  1TL9 A;  1BY8 A;  4Q8G A;  3PRM A;  2AU1 A;  1MDW A;  2DJG B;  1F29 A;  4G54 A;  3S3Q A;  3WXE A;  2PNS A;  3QJ3 A;  2FRA A;  4OEL A;  1AEC A;  1TLO A;  1PIP A;  4ZTB A;  2UZJ A;  4A5U A;  1PPN A;  2J7Q A;  4D8E A;  4M0W A;  2ACT A;  1Q6K A;  2E00 A;  1VJV A;  2OP3 A;  4PT5 A;  5CVM A;  2AS8 A;  4XUI A;  2GFO A;  1GMY A;  1FH0 A;  3TMP A;  3O1G A;  4MI7 A;  1F2A A;  3KWZ A;  3LXS A;  1PXV A;  2FO5 A;  1JQP A;  5CVO B;  1MEM A;  3N4C A;  4FJC A;  5PAD A;  4W5C A;  1M6D A;  1YT7 A;  1GEC E;  2XU4 A;  3PW3 A;  1CSB B;  5E6J A;  1A6R A;  4PP1 A;  3NHE A;  4PAD A;  2E02 A;  3RVV A;  2AUZ A;  1EWP A;  1CTE A;  1HUC B;  4PP2 E;  2AIM A;  3PDF A;  2B1N A;  3W31 A;  4BOQ A;  1QXP A;  1U5I A;  4X6I A;  1IWD A;  4CDC B;  4DMX A;  2DC7 A;  1EWO A;  3I06 A;  2IPP B;  2YJ2 A;  3BPF A;  1GCB A;  3QT4 A;  4RF0 A;  1YK7 A;  1PCI A;  3F75 A;  1YK8 A;  3MHS A;  2NQA A;  4W5B A;  5K16 A;  3V6C A;  4DMY A;  4AXL A;  4BS5 A;  1KFX L;  4RF1 A;  4XR7 A;  1U9W A;  3H8C A;  1MS6 A;  2R9C A;  4RNA A;  4QRV A;  2F1G A;  3QSD A;  3ZUA A;  3TRK A;  3D6S A;  2XU3 A;  3I3T A;  3MTV A;  1CPJ A;  4P6G A;  4QRX A;  4I05 A;  2FTD A;  4MM3 B;  3PNR A;  2R9F A;  2IBI A;  3USV A;  3MJ5 A;  1CJL A;  2P86 A;  3WXG A;  3HWN A;  1U9V A;  1EWM A;  3E1Z B;  2DCA A;  1QDQ A;  3P5V A;  1ZIV A;  3MP2 A;  2G7Y A;  6PAD A;  2BTW A;  2DCD A;  3KSE A;  3P5U A;  3E9S A;  4RKX A;  3OF8 A;  3N3G A;  2XU1 A;  1EWL A;  3MHH A;  1DEU A;  1XKG A;  5JZE A;  4BS6 A;  1QOL A;  2AVW A;  4MZO A;  2AYN A;  3KW9 A;  3HHI A;  2CIO A;  2DZZ A;  2NQD B;  3MOR A;  4YVA A;  3IV2 A;  4MSX A;  3KKU A;  2HH5 A;  5JA7 A;  4N79 A;  3V6E A;  4BSQ A;  3BBA A;  1ATK A;  4K7C A;  1UKF A;  2J7Q C;  2HD5 A;  1CB5 A;  1PVJ A;  2E03 A;  3B79 A;  4BOS A;  4CDF B;  1NL6 A;  3HHA A;  1YZB A;  3K24 A;  1AIM A;  3CH2 X;  5KO3 A;  1PBH A;  1EF7 A;  3BCN A;  4OVZ B;  4YV8 A;  2P0R A;  4KLB A;  3IUT A;  2PAD A;  4YYU A;  1X9Y A;  2ARY A;  4IP3 A;  3H8B A;  4OVZ A;  3W30 A;  3OVZ A;  3PSE A;  4HXD B;  4YYQ A;  4CZW A;  3DF0 A;  2DZY A;  2AYO A;  3K8U A;  2OUL A;  2YJC A;  2OZ2 A;  3RVX A;  5EZQ A;  1AU0 A;  3P5W A;  2P7U A;  1PE6 A;  3H6S A;  1F2B A;  2FT2 A;  2HXZ A;  9PAP A;  1PPP A;  3P5X A;  2AUX A;  2NQG A;  3OQC A;  3PHU A;  2PRE A;  2YJB A;  2JQG R;  1KXR A;  3PHW A;  1VSN A;  2FE8 A;  4BQV A;  1U9X A;  2BDL A;  3CBK A;  1CV8 A;  2HWK A;  8PCH A;  1AYU A;  4I07 A;  2DC8 A;  3KFQ A;  1QMY A;  1KFU L;  4D8B A;  1AU3 A;  4WUR A;  4QH6 A;  2FQ9 A;  3U8E A;  4ZUX U;  2DCC A;  1MEG A;  5CVN B;  4P6E A;  3O65 A;  1DKI A;  3PT2 A;  1S4V A;  2NQI A;  4OW0 A;  3KX1 A;  2ATO A;  3IMA A;  4N4Z A;  3C9E A;  1KHP A;  1U9Q X;  3BOW A;  4HWY A;  3TNX A;  2BDZ A;  2AGA A;  2Z84 A;  4CDD B;  3CH3 X;  2WBF X;  1KHQ A;  2DOS A;  4RY2 A;  3S3R A;  3AI8 A;  3BPM A;  1Y4H A;  5FPW A;  4I04 A;  1AYV A;  4R3D A;  1NQC A;  2Y6E A;  1PAD A;  3KWB X;  4X6J A;  3IFU A;  2BTW B;  4XZX A;  3PBH A;  2O6X A;  4QRG A;  1NPZ A;  5EZS A;  4Q8H A;  3K9M A;  5F02 A;  2HHN A;  2JRI A;  3OVX A;  2VHF A;  4D8I A;  2XU5 A;  1MHW A;  3LFY A;  4BOZ A;  3RNV A;  1PPD A;  3CBJ A;  4IUM A;  2BU3 A;  1DF0 A;  4YYR A;  4BOP A;  1ME3 A;  1Y08 A;  4MZS A;  2DC9 A;  3BWK A;  4PI3 A;  3IHP A;  2R6N A;  4P16 A;  2VHS A;  4OEM A;  1BQI A;  1ITO A;  3WXF A;  3BY4 A;  4BOU A;  3RVW A;  3MTN A;  4CDE B;  2H7J A;  1BGO A;  2G8E A;  2R9O A;  3ERV A;  1ZCM A;  4YYS A;  1NB3 A;  1AYW A;  3ZNH A;  3B21 A;  4YYW A;  5J94 A;  2DJF B;  2FRQ A;  5EF4 A;  2F7D A;  1YVB A;  1MIR A;  1YAL A;  4REZ A;  2JQF R;  3GCB A;  3OIS A;  2FUD A;  2CB5 A;  4GUA A;  5CHV A;  2GHU A;  1AU2 A;  1CVZ A;  2B1M A;  2DCB A;  4N8W A;  3N3K A;  3IOQ A;  3BC3 A;  4FK5 A;  1SNK A;  4W4U A;  1CS8 A;  2Y5B A;  1POP A;  1CQD A;  7PCK A;  3OF9 A;  1GLO A;  3PRP A;  1STF E;  1K3B B;  4YYV A;  1NB5 A;  2R9N A;  2G8J A;  3IEJ A;  1ICF A;  1O0E A;  2G6D A;  5CHT A;  4X6H A;  2DC6 A;  3H7D A;  3F5V A;  2E01 A;  2YJ9 A;  4AXM A; 
#chains in the Genus database with same CATH homology
 2BTW B;  3B21 A;  3PRM A;  3PT2 A;  3MTV A;  2JTC A;  4XZX A;  4OW0 A;  1YZB A;  3BB7 A;  3C0R A;  5E6J A;  2BTW A;  4PT5 A;  5EZQ A;  2FE8 A;  3PRP A;  5EZS A;  4RF0 A;  3E9S A;  4P16 A;  2JRI A;  4RKX A;  4MM3 B;  3TMP A;  4MI7 A;  3PHX A;  2AGA A;  2Z84 A;  3BBA A;  4REZ A;  3MJ5 A;  2HWK A;  4D8I A;  5KO3 A;  1UKF A;  4OVZ B;  4BOZ A;  4GUA A;  4D8B A;  3BY4 A;  4BOU A;  4WUR A;  2J7Q C;  3RNV A;  5JZE A;  4IUM A;  2BU3 A;  2DOS A;  2UZJ A;  4ZTB A;  3W31 A;  4BOQ A;  4IP3 A;  4RF1 A;  4A5U A;  1PVJ A;  3PHW A;  2J7Q A;  3OQC A;  4BOP A;  3PHU A;  4OVZ A;  4R3D A;  4RNA A;  3W30 A;  3TRK A;  3O65 A;  3PSE A;  4HXD B;  4BOS A;  4D8E A;  3ZNH A;  1DKI A;  3MP2 A;  4M0W A;  3IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...