4I04A

Structure of zymogen of cathepsin b1 from schistosoma mansoni
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
304
Chain Sequence
FEPLSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQMGARREEPDLRRTRRPTVDHNDWNVEIPSSFDSRKKWPRCKSIATIRDQSRCGSSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 105
structure length 304
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i04A00
1MEGA 3WXGA 1GECE 2Y6EA 4MZSA 3TNXA 1CVZA 2AUZA 2NQDB 1TU6A 2ATOA 1CJLA 2DZZA 4BQVA 3C9EA 3CH3X 2DCDA 2HHNA 3N4CA 3IOQA 2GFOA 6PADA 4Q8GA 1CTEA 1NB3A 1TLOA 2XU3A 1VJVA 2C0YA 1S4VA 1AU2A 5JH3A 3I06A 4QBBA 1NLJA 3IEJA 5F02A 1ME4A 1U9VA 3AI8A 2FTDA 1U9WA 3HWNA 4CDDB 1PBHA 1A6RA 1VSNA 3HD3A 1JQPA 3S3QA 4PADA 3WXEA 3I3TA 4OELA 1ZIVA 2PBHA 2R9FA 3F75A 1AYWA 3MORA 2JQFR 1EWLA 1M6DA 4AXLA 1BQIA 1TL9A 2AS8A 3QT4A 4X6IA 1PIPA 2NQIA 3KSEA 1EF7A 2FUDA 2FT2A 3D6SA 4BS6A 3IMAA 3ZUAA 1PPOA 3RVXA 3H89A 1YK8A 2PNSA 4YYSA 3ERVA 2G7YA 3P5WA 5EF4A 4XR7A 4PI3A 2XU5A 1PCIA 2AIMA 2VHSA 3DF0A 2PREA 2O6XA 3USVA 4YVAA 4YYUA 3CH2X 2F1GA 4BSQA 1F2BA 2R9MA 4QRGA 5FPWA 3PDFA 4MZOA 4WA6A 2P0RA 3BC3A 5JA7A 2BDLA 2WBFX 3WXFA 4YYVA 3MHHA 4YV8A 2FRAA 3KWZA 1GMYA 1MIRA 2R9CA 2E03A 2R6NA 3N3KA 4K7CA 4FK5A 5CVOB 2DC7A 2DCBA 2DC6A 4N79A 4BS5A 1ME3A 3K9MA 1HUCB 3BCNA 3K24A 4BPVA 1FH0A 3OVXA 2IPPB 3N3GA 1Y08A 3B79A 2G8JA 2NQGA 4CDCB 1QXPA 2B1MA 4YYQA 3H7DA 1THEA 3K8UA 5A24A 1ZCMA 1F2AA 3F5VA 2YJ2A 2DJGB 2P7UA 2OZ2A 3BOWA 4PP2E 1PPNA 1ITOA 4X6JA 3H8CA 2H7JA 4Q8HA 3OF8A 1AYUA 3QJ3A 3PBHA 1U9XA 1Q6KA 7PCKA 4FJCA 2YJCA 5J94A 1MHWA 1AECA 3O0UA 4N4ZA 3IV2A 1NPZA 2CB5A 1PPDA 1AU0A 1CSBB 2DCAA 4QH6A 1DF0A 1BY8A 1AIMA 5CHVA 4AXMA 3NHEA 4I05A 4YYWA 4G54A 2FRQA 1KFUL 4QRXA 2GHUA 1GLOA 4I04A 4HWYA 3IHPA 3H6SA 1YVBA 2DC8A 2G6DA 3IUTA 1NL6A 1KHQA 2P86A 2E00A 1BGOA 2XU1A 2FQ9A 4W5BA 4DMXA 2JQGR 2FYEA 3LXSA 3CBKA 2BDZA 2B1NA 2IBIA 1CPJA 4RY2A 1F29A 1K3BB 1F2CA 2AYNA 2HD5A 4CDEB 4W4UA 2E01A 3MTNA 2YJBA 1SP4B 3V6CA 2F7DA 5CVNB 2CIOA 4N8WA 3HHIA 2NQAA 2PADA 3QSDA 3V6EA 1KFXL 1YT7A 1CQDA 1PE6A 5PADA 1PADA 3E1ZB 4X6HA 3OVZA 5K16A 4MSXA 3KW9A 1AU3A 1PXVA 5CHTA 3S3RA 4PP1A 1CS8A 1QMYA 8PCHA 1ICFA 1MDWA 4I07A 4YYRA 2OULA 1O0EA 2DJFB 3RVVA 3BWKA 1IWDA 2OP3A 2ACTA 3KKUA 2Y5BA 2AVWA 3BPMA 2DCCA 3GCBA 4P6EA 2R9NA 1MS6A 1STFE 1KHPA 1AU4A 3BPFA 2YJ8A 3P5XA 2XU4A 3LFYA 5CVMA 1AYVA 4KLBA 2VHFA 4OEMA 1CV8A 1EWMA 3RVWA 3HHAA 3U8EA 3P5VA 1Y4HA 3OF9A 1XKGA 3M99A 3PW3A 1NB5A 2HXZA 2DC9A 4CDFB 2DZYA 1POPA 3MHSA 1QDQA 1CB5A 3KFQA 3OISA 1SNKA 4ZUXU 1MEMA 3KWBX 2R9OA 2YJ9A 3KX1A 2G8EA 2HH5A 1U5IA 4W5CA 1GCBA 2AU1A 3O1GA 1U9QX 2ARYA 1X9YA 1NQCA 3PNRA 1PPPA 2FO5A 1QOLA 4CZWA 1BP4A 1YK7A 4XUIA 4QRVA 1KXRA 1DEUA 2AUXA 5EGWA 3CBJA 3P5UA 2AYOA 2E02A 1EWOA 4DMYA 1ATKA 3H8BA 4FIPA 1YALA 9PAPA 1EWPA 4P6GA
chains in the Genus database with same CATH superfamily
1MEGA 3WXGA 1GECE 2Y6EA 4MZSA 3TNXA 1CVZA 2AUZA 2NQDB 2AGAA 1TU6A 2ATOA 1CJLA 2DZZA 5JZEA 4PT5A 4BQVA 3C9EA 3CH3X 2DCDA 2HHNA 3N4CA 4BOSA 3IOQA 2GFOA 6PADA 4Q8GA 4XZXA 1CTEA 4BOPA 1NB3A 1TLOA 2HWKA 1VJVA 2C0YA 2XU3A 3BBAA 1S4VA 5EZQA 1AU2A 3OQCA 5JH3A 3I06A 4QBBA 1NLJA 4OVZA 2JRIA 3IEJA 5F02A 1ME4A 1U9VA 3AI8A 4MM3B 2FTDA 1U9WA 3HWNA 4RKXA 4CDDB 1PBHA 1A6RA 1DKIA 1VSNA 3HD3A 1JQPA 3S3QA 4PADA 4BOUA 2BTWB 3WXEA 3I3TA 5KO3A 4OELA 1ZIVA 2PBHA 2R9FA 3F75A 1AYWA 3MORA 2JQFR 1EWLA 1M6DA 4AXLA 1BQIA 1TL9A 2AS8A 3QT4A 4X6IA 4OVZB 1PIPA 2NQIA 3KSEA 1EF7A 4WURA 2FUDA 2FT2A 3D6SA 5E6JA 4BS6A 4A5UA 4IUMA 3IMAA 4BOQA 3ZUAA 1PPOA 3RVXA 3H89A 1YK8A 2PNSA 4YYSA 3ERVA 2G7YA 4BOZA 3P5WA 5EF4A 4XR7A 4OW0A 4PI3A 2XU5A 1PCIA 2AIMA 2VHSA 3DF0A 2PREA 2O6XA 3USVA 4YVAA 4YYUA 1YZBA 3CH2X 2F1GA 4BSQA 2J7QA 1F2BA 2R9MA 4QRGA 5FPWA 3PDFA 4MZOA 4RF1A 4WA6A 2P0RA 3BC3A 5JA7A 2BDLA 2WBFX 3WXFA 4YYVA 3MHHA 4YV8A 2FRAA 3KWZA 1GMYA 1MIRA 2R9CA 3BY4A 2E03A 2R6NA 3N3KA 4K7CA 4FK5A 5CVOB 2DC7A 2DCBA 2DC6A 4N79A 4BS5A 1ME3A 3K9MA 1HUCB 4IP3A 3BCNA 3K24A 4BPVA 1FH0A 3OVXA 2IPPB 3N3GA 1Y08A 4HXDB 3B79A 2G8JA 2NQGA 4CDCB 1QXPA 3PT2A 2B1MA 4YYQA 3H7DA 1THEA 3K8UA 5A24A 1ZCMA 1F2AA 3F5VA 2YJ2A 2DJGB 2P7UA 2OZ2A 3BOWA 4PP2E 1PPNA 1ITOA 3C0RA 4X6JA 3H8CA 2H7JA 4Q8HA 3OF8A 1AYUA 3QJ3A 3PBHA 1U9XA 1Q6KA 3TMPA 7PCKA 4FJCA 2YJCA 5J94A 3MP2A 1MHWA 1AECA 3O0UA 4N4ZA 2DOSA 3IV2A 3TRKA 1NPZA 2CB5A 2FE8A 1PPDA 1AU0A 1CSBB 2DCAA 4QH6A 1DF0A 1BY8A 1AIMA 5CHVA 4AXMA 3NHEA 4I05A 4YYWA 4G54A 2FRQA 3B21A 4RNAA 1KFUL 4QRXA 2GHUA 1GLOA 4I04A 4HWYA 3IHPA 3H6SA 4D8BA 1YVBA 2DC8A 2BU3A 2G6DA 3IUTA 1NL6A 1KHQA 2P86A 2E00A 1BGOA 2XU1A 2FQ9A 4W5BA 4DMXA 2JQGR 2BTWA 2FYEA 1PVJA 3LXSA 3CBKA 2BDZA 2B1NA 2IBIA 1CPJA 4RY2A 1F29A 1K3BB 1F2CA 2AYNA 2HD5A 4D8EA 4CDEB 4W4UA 3O65A 2E01A 3MTNA 2YJBA 3E9SA 1SP4B 4GUAA 3V6CA 3BB7A 2F7DA 5CVNB 2CIOA 4N8WA 3W31A 3HHIA 2NQAA 2PADA 3QSDA 3V6EA 1KFXL 1YT7A 3PHUA 1CQDA 1PE6A 5PADA 1PADA 3E1ZB 4X6HA 3OVZA 5K16A 4MSXA 3KW9A 4MI7A 1AU3A 1PXVA 5CHTA 3S3RA 2UZJA 4PP1A 1CS8A 3PHWA 1QMYA 8PCHA 1ICFA 4REZA 1MDWA 4M0WA 4I07A 4YYRA 2OULA 3PHXA 1O0EA 2DJFB 3RVVA 3BWKA 1UKFA 1IWDA 4R3DA 2OP3A 2ACTA 3KKUA 3PSEA 2Y5BA 2AVWA 3BPMA 2DCCA 3GCBA 4P6EA 2R9NA 1MS6A 1STFE 1KHPA 1AU4A 3BPFA 2YJ8A 3P5XA 2XU4A 3LFYA 3IFUA 5CVMA 1AYVA 4KLBA 2VHFA 4OEMA 1CV8A 1EWMA 3RVWA 3HHAA 3U8EA 3P5VA 3W30A 3RNVA 1Y4HA 3OF9A 1XKGA 3M99A 3PW3A 1NB5A 2HXZA 2DC9A 4CDFB 2DZYA 1POPA 2J7QC 3MHSA 1QDQA 1CB5A 3KFQA 3OISA 3MTVA 1SNKA 4ZUXU 3MJ5A 1MEMA 3KWBX 2R9OA 2YJ9A 3KX1A 2G8EA 2HH5A 1U5IA 2JTCA 4W5CA 1GCBA 2AU1A 3O1GA 1U9QX 2ARYA 1X9YA 1NQCA 3PNRA 1PPPA 4P16A 2FO5A 4RF0A 1QOLA 4CZWA 1BP4A 2Z84A 1YK7A 4XUIA 3PRPA 4ZTBA 3PRMA 4QRVA 1KXRA 1DEUA 2AUXA 3CBJA 5EGWA 3ZNHA 3P5UA 2AYOA 2E02A 1EWOA 4DMYA 1ATKA 5EZSA 3H8BA 4FIPA 4D8IA 1YALA 9PAPA 1EWPA 4P6GA
chains in the Genus database with same CATH topology
1MEGA 3WXGA 1GECE 2Y6EA 4MZSA 3TNXA 1CVZA 2AUZA 2NQDB 1E2TA 1TU6A 2ATOA 1CJLA 2DZZA 4BQVA 3C9EA 3CH3X 2DCDA 2HHNA 3N4CA 4B55A 3IOQA 2GFOA 6PADA 4Q8GA 1CTEA 1NB3A 1TLOA 2XU3A 1VJVA 2C0YA 1S4VA 1AU2A 5JH3A 3I06A 4QBBA 1NLJA 3IEJA 5F02A 1ME4A 1U9VA 3AI8A 2FTDA 1U9WA 3HWNA 4CDDB 1PBHA 1A6RA 1VSNA 3HD3A 1JQPA 3S3QA 4PADA 3WXEA 3I3TA 4OELA 1ZIVA 2VFBA 2PBHA 2R9FA 3F75A 4BGFA 2VFCA 1AYWA 3MORA 2JQFR 1EWLA 1M6DA 4AXLA 1BQIA 1TL9A 2AS8A 3QT4A 4X6IA 1PIPA 2NQIA 3KSEA 1EF7A 2FUDA 2FT2A 3D6SA 4BS6A 3IMAA 3ZUAA 1PPOA 3RVXA 3H89A 1YK8A 2PNSA 4YYSA 3ERVA 2G7YA 3P5WA 5EF4A 1W5RA 4XR7A 1W4TA 4PI3A 2XU5A 1PCIA 2AIMA 2VHSA 3DF0A 2PREA 2O6XA 3USVA 4YVAA 4YYUA 3CH2X 2F1GA 4BSQA 1F2BA 2R9MA 4QRGA 5FPWA 3PDFA 4MZOA 4WA6A 2P0RA 3BC3A 5JA7A 2BDLA 2WBFX 3WXFA 4YYVA 3MHHA 4YV8A 2FRAA 3KWZA 1GMYA 1MIRA 2R9CA 2E03A 2R6NA 3N3KA 4K7CA 4FK5A 5CVOB 4C5PA 2DC7A 2DCBA 2DC6A 4N79A 4BS5A 1ME3A 3K9MA 1HUCB 3BCNA 3K24A 4BPVA 1FH0A 3OVXA 2IPPB 3N3GA 1Y08A 3B79A 2G8JA 2NQGA 4CDCB 1QXPA 2B1MA 4YYQA 3H7DA 1THEA 3K8UA 5A24A 1ZCMA 1F2AA 3F5VA 2YJ2A 2DJGB 2P7UA 2OZ2A 3BOWA 4PP2E 1PPNA 1ITOA 4X6JA 3H8CA 2H7JA 4Q8HA 3OF8A 1AYUA 3QJ3A 3PBHA 1U9XA 1Q6KA 7PCKA 4FJCA 2YJCA 5J94A 1MHWA 1AECA 3O0UA 4N4ZA 4NV8A 3IV2A 1NPZA 2CB5A 1PPDA 1AU0A 1CSBB 2DCAA 4QH6A 1DF0A 1BY8A 1AIMA 5CHVA 4AXMA 3NHEA 4I05A 4YYWA 4G54A 2FRQA 1KFUL 4QRXA 2GHUA 1GLOA 4I04A 4HWYA 3IHPA 3H6SA 1YVBA 2DC8A 2G6DA 3IUTA 1NL6A 1KHQA 2P86A 2E00A 1BGOA 4NV7A 2XU1A 2FQ9A 4W5BA 4DMXA 2JQGR 2FYEA 3LXSA 3CBKA 4GUZA 2BDZA 2B1NA 2IBIA 1CPJA 4RY2A 1F29A 1K3BB 1F2CA 2AYNA 2HD5A 4CDEB 4W4UA 2E01A 3MTNA 2YJBA 1SP4B 3V6CA 2F7DA 5CVNB 2CIOA 4N8WA 2BSZA 3HHIA 2NQAA 2PADA 3QSDA 3V6EA 1KFXL 1YT7A 1CQDA 1PE6A 5PADA 1PADA 3E1ZB 4X6HA 3OVZA 5K16A 4MSXA 3KW9A 1AU3A 1PXVA 5CHTA 3S3RA 4PP1A 1CS8A 1QMYA 8PCHA 1ICFA 1MDWA 4I07A 4YYRA 3D9WA 2OULA 1O0EA 2DJFB 3RVVA 3BWKA 1IWDA 2OP3A 2ACTA 3KKUA 2Y5BA 2AVWA 3BPMA 2DCCA 3GCBA 4P6EA 2R9NA 1MS6A 1STFE 1KHPA 1AU4A 3BPFA 2YJ8A 3P5XA 2XU4A 3LFYA 5CVMA 1AYVA 4KLBA 2VHFA 4OEMA 1CV8A 1EWMA 3RVWA 3HHAA 3U8EA 3P5VA 1Y4HA 3OF9A 1XKGA 3M99A 3PW3A 1NB5A 2HXZA 2DC9A 4CDFB 2DZYA 1POPA 3MHSA 1QDQA 1CB5A 3KFQA 3OISA 1SNKA 4ZUXU 1MEMA 3KWBX 2R9OA 2YJ9A 3KX1A 2G8EA 2HH5A 1U5IA 4W5CA 1GCBA 2AU1A 3O1GA 1U9QX 2ARYA 1X9YA 1NQCA 3PNRA 1PPPA 2FO5A 1QOLA 4CZWA 1BP4A 1YK7A 4XUIA 3LTWA 4QRVA 1KXRA 3CBJA 1DEUA 5EGWA 1GX3A 2AUXA 3P5UA 2AYOA 2E02A 1W6FA 1EWOA 4DMYA 1ATKA 3H8BA 4FIPA 1YALA 9PAPA 1EWPA 4P6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEG A;  3WXG A;  1GEC E;  2Y6E A;  4MZS A;  3TNX A;  1CVZ A;  2AUZ A;  2NQD B;  1TU6 A;  2ATO A;  1CJL A;  2DZZ A;  4BQV A;  3C9E A;  3CH3 X;  2DCD A;  2HHN A;  3N4C A;  3IOQ A;  2GFO A;  6PAD A;  4Q8G A;  1CTE A;  1NB3 A;  1TLO A;  2XU3 A;  1VJV A;  2C0Y A;  1S4V A;  1AU2 A;  5JH3 A;  3I06 A;  4QBB A;  1NLJ A;  3IEJ A;  5F02 A;  1ME4 A;  1U9V A;  3AI8 A;  2FTD A;  1U9W A;  3HWN A;  4CDD B;  1PBH A;  1A6R A;  1VSN A;  3HD3 A;  1JQP A;  3S3Q A;  4PAD A;  3WXE A;  3I3T A;  4OEL A;  1ZIV A;  2PBH A;  2R9F A;  3F75 A;  1AYW A;  3MOR A;  2JQF R;  1EWL A;  1M6D A;  4AXL A;  1BQI A;  1TL9 A;  2AS8 A;  3QT4 A;  4X6I A;  1PIP A;  2NQI A;  3KSE A;  1EF7 A;  2FUD A;  2FT2 A;  3D6S A;  4BS6 A;  3IMA A;  3ZUA A;  1PPO A;  3RVX A;  3H89 A;  1YK8 A;  2PNS A;  4YYS A;  3ERV A;  2G7Y A;  3P5W A;  5EF4 A;  4XR7 A;  4PI3 A;  2XU5 A;  1PCI A;  2AIM A;  2VHS A;  3DF0 A;  2PRE A;  2O6X A;  3USV A;  4YVA A;  4YYU A;  3CH2 X;  2F1G A;  4BSQ A;  1F2B A;  2R9M A;  4QRG A;  5FPW A;  3PDF A;  4MZO A;  4WA6 A;  2P0R A;  3BC3 A;  5JA7 A;  2BDL A;  2WBF X;  3WXF A;  4YYV A;  3MHH A;  4YV8 A;  2FRA A;  3KWZ A;  1GMY A;  1MIR A;  2R9C A;  2E03 A;  2R6N A;  3N3K A;  4K7C A;  4FK5 A;  5CVO B;  2DC7 A;  2DCB A;  2DC6 A;  4N79 A;  4BS5 A;  1ME3 A;  3K9M A;  1HUC B;  3BCN A;  3K24 A;  4BPV A;  1FH0 A;  3OVX A;  2IPP B;  3N3G A;  1Y08 A;  3B79 A;  2G8J A;  2NQG A;  4CDC B;  1QXP A;  2B1M A;  4YYQ A;  3H7D A;  1THE A;  3K8U A;  5A24 A;  1ZCM A;  1F2A A;  3F5V A;  2YJ2 A;  2DJG B;  2P7U A;  2OZ2 A;  3BOW A;  4PP2 E;  1PPN A;  1ITO A;  4X6J A;  3H8C A;  2H7J A;  4Q8H A;  3OF8 A;  1AYU A;  3QJ3 A;  3PBH A;  1U9X A;  1Q6K A;  7PCK A;  4FJC A;  2YJC A;  5J94 A;  1MHW A;  1AEC A;  3O0U A;  4N4Z A;  3IV2 A;  1NPZ A;  2CB5 A;  1PPD A;  1AU0 A;  1CSB B;  2DCA A;  4QH6 A;  1DF0 A;  1BY8 A;  1AIM A;  5CHV A;  4AXM A;  3NHE A;  4I05 A;  4YYW A;  4G54 A;  2FRQ A;  1KFU L;  4QRX A;  2GHU A;  1GLO A;  4I04 A;  4HWY A;  3IHP A;  3H6S A;  1YVB A;  2DC8 A;  2G6D A;  3IUT A;  1NL6 A;  1KHQ A;  2P86 A;  2E00 A;  1BGO A;  2XU1 A;  2FQ9 A;  4W5B A;  4DMX A;  2JQG R;  2FYE A;  3LXS A;  3CBK A;  2BDZ A;  2B1N A;  2IBI A;  1CPJ A;  4RY2 A;  1F29 A;  1K3B B;  1F2C A;  2AYN A;  2HD5 A;  4CDE B;  4W4U A;  2E01 A;  3MTN A;  2YJB A;  1SP4 B;  3V6C A;  2F7D A;  5CVN B;  2CIO A;  4N8W A;  3HHI A;  2NQA A;  2PAD A;  3QSD A;  3V6E A;  1KFX L;  1YT7 A;  1CQD A;  1PE6 A;  5PAD A;  1PAD A;  3E1Z B;  4X6H A;  3OVZ A;  5K16 A;  4MSX A;  3KW9 A;  1AU3 A;  1PXV A;  5CHT A;  3S3R A;  4PP1 A;  1CS8 A;  1QMY A;  8PCH A;  1ICF A;  1MDW A;  4I07 A;  4YYR A;  2OUL A;  1O0E A;  2DJF B;  3RVV A;  3BWK A;  1IWD A;  2OP3 A;  2ACT A;  3KKU A;  2Y5B A;  2AVW A;  3BPM A;  2DCC A;  3GCB A;  4P6E A;  2R9N A;  1MS6 A;  1STF E;  1KHP A;  1AU4 A;  3BPF A;  2YJ8 A;  3P5X A;  2XU4 A;  3LFY A;  5CVM A;  1AYV A;  4KLB A;  2VHF A;  4OEM A;  1CV8 A;  1EWM A;  3RVW A;  3HHA A;  3U8E A;  3P5V A;  1Y4H A;  3OF9 A;  1XKG A;  3M99 A;  3PW3 A;  1NB5 A;  2HXZ A;  2DC9 A;  4CDF B;  2DZY A;  1POP A;  3MHS A;  1QDQ A;  1CB5 A;  3KFQ A;  3OIS A;  1SNK A;  4ZUX U;  1MEM A;  3KWB X;  2R9O A;  2YJ9 A;  3KX1 A;  2G8E A;  2HH5 A;  1U5I A;  4W5C A;  1GCB A;  2AU1 A;  3O1G A;  1U9Q X;  2ARY A;  1X9Y A;  1NQC A;  3PNR A;  1PPP A;  2FO5 A;  1QOL A;  4CZW A;  1BP4 A;  1YK7 A;  4XUI A;  4QRV A;  1KXR A;  1DEU A;  2AUX A;  5EGW A;  3CBJ A;  3P5U A;  2AYO A;  2E02 A;  1EWO A;  4DMY A;  1ATK A;  3H8B A;  4FIP A;  1YAL A;  9PAP A;  1EWP A;  4P6G A; 
#chains in the Genus database with same CATH topology
 1MEG A;  3WXG A;  1GEC E;  2Y6E A;  4MZS A;  3TNX A;  1CVZ A;  2AUZ A;  2NQD B;  2AGA A;  1TU6 A;  2ATO A;  1CJL A;  2DZZ A;  5JZE A;  4PT5 A;  4BQV A;  3C9E A;  3CH3 X;  2DCD A;  2HHN A;  3N4C A;  4BOS A;  3IOQ A;  2GFO A;  6PAD A;  4Q8G A;  4XZX A;  1CTE A;  4BOP A;  1NB3 A;  1TLO A;  2HWK A;  1VJV A;  2C0Y A;  2XU3 A;  3BBA A;  1S4V A;  5EZQ A;  1AU2 A;  3OQC A;  5JH3 A;  3I06 A;  4QBB A;  1NLJ A;  4OVZ A;  2JRI A;  3IEJ A;  5F02 A;  1ME4 A;  1U9V A;  3AI8 A;  4MM3 B;  2FTD A;  1U9W A;  3HWN A;  4RKX A;  4CDD B;  1PBH A;  1A6R A;  1DKI A;  1VSN A;  3HD3 A;  1JQP A;  3S3Q A;  4PAD A;  4BOU A;  2BTW B;  3WXE A;  3I3T A;  5KO3 A;  4OEL A;  1ZIV A;  2PBH A;  2R9F A;  3F75 A;  1AYW A;  3MOR A;  2JQF R;  1EWL A;  1M6D A;  4AXL A;  1BQI A;  1TL9 A;  2AS8 A;  3QT4 A;  4X6I A;  4OVZ B;  1PIP A;  2NQI A;  3KSE A;  1EF7 A;  4WUR A;  2FUD A;  2FT2 A;  3D6S A;  5E6J A;  4BS6 A;  4A5U A;  4IUM A;  3IMA A;  4BOQ A;  3ZUA A;  1PPO A;  3RVX A;  3H89 A;  1YK8 A;  2PNS A;  4YYS A;  3ERV A;  2G7Y A;  4BOZ A;  3P5W A;  5EF4 A;  4XR7 A;  4OW0 A;  4PI3 A;  2XU5 A;  1PCI A;  2AIM A;  2VHS A;  3DF0 A;  2PRE A;  2O6X A;  3USV A;  4YVA A;  4YYU A;  1YZB A;  3CH2 X;  2F1G A;  4BSQ A;  2J7Q A;  1F2B A;  2R9M A;  4QRG A;  5FPW A;  3PDF A;  4MZO A;  4RF1 A;  4WA6 A;  2P0R A;  3BC3 A;  5JA7 A;  2BDL A;  2WBF X;  3WXF A;  4YYV A;  3MHH A;  4YV8 A;  2FRA A;  3KWZ A;  1GMY A;  1MIR A;  2R9C A;  3BY4 A;  2E03 A;  2R6N A;  3N3K A;  4K7C A;  4FK5 A;  5CVO B;  2DC7 A;  2DCB A;  2DC6 A;  4N79 A;  4BS5 A;  1ME3 A;  3K9M A;  1HUC B;  4IP3 A;  3BCN A;  3K24 A;  4BPV A;  1FH0 A;  3OVX A;  2IPP B;  3N3G A;  1Y08 A;  4HXD B;  3B79 A;  2G8J A;  2NQG A;  4CDC B;  1QXP A;  3PT2 A;  2B1M A;  4YYQ A;  3H7D A;  1THE A;  3K8U A;  5A24 A;  1ZCM A;  1F2A A;  3F5V A;  2YJ2 A;  2DJG B;  2P7U A;  2OZ2 A;  3BOW A;  4PP2 E;  1PPN A;  1ITO A;  3C0R A;  4X6J A;  3H8C A;  2H7J A;  4Q8H A;  3OF8 A;  1AYU A;  3QJ3 A;  3PBH A;  1U9X A;  1Q6K A;  3TMP A;  7PCK A;  4FJC A;  2YJC A;  5J94 A;  3MP2 A;  1MHW A;  1AEC A;  3O0U A;  4N4Z A;  2DOS A;  3IV2 A;  3TRK A;  1NPZ A;  2CB5 A;  2FE8 A;  1PPD A;  1AU0 A;  1CSB B;  2DCA A;  4QH6 A;  1DF0 A;  1BY8 A;  1AIM A;  5CHV A;  4AXM A;  3NHE A;  4I05 A;  4YYW A;  4G54 A;  2FRQ A;  3B21 A;  4RNA A;  1KFU L;  4QRX A;  2GHU A;  1GLO A;  4I04 A;  4HWY A;  3IHP A;  3H6S A;  4D8B A;  1YVB A;  2DC8 A;  2BU3 A;  2G6D A;  3IUT A;  1NL6 A;  1KHQ A;  2P86 A;  2E00 A;  1BGO A;  2XU1 A;  2FQ9 A;  4W5B A;  4DMX A;  2JQG R;  2BTW A;  2FYE A;  1PVJ A;  3LXS A;  3CBK A;  2BDZ A;  2B1N A;  2IBI A;  1CPJ A;  4RY2 A;  1F29 A;  1K3B B;  1F2C A;  2AYN A;  2HD5 A;  4D8E A;  4CDE B;  4W4U A;  3O65 A;  2E01 A;  3MTN A;  2YJB A;  3E9S A;  1SP4 B;  4GUA A;  3V6C A;  3BB7 A;  2F7D A;  5CVN B;  2CIO A;  4N8W A;  3W31 A;  3HHI A;  2NQA A;  2PAD A;  3QSD A;  3V6E A;  1KFX L;  1YT7 A;  3PHU A;  1CQD A;  1PE6 A;  5PAD A;  1PAD A;  3E1Z B;  4X6H A;  3OVZ A;  5K16 A;  4MSX A;  3KW9 A;  4MI7 A;  1AU3 A;  1PXV A;  5CHT A;  3S3R A;  2UZJ A;  4PP1 A;  1CS8 A;  3PHW A;  1QMY A;  8PCH A;  1ICF A;  4REZ A;  1MDW A;  4M0W A;  4I07 A;  4YYR A;  2OUL A;  3PHX A;  1O0E A;  2DJF B;  3RVV A;  3BWK A;  1UKF A;  1IWD A;  4R3D A;  2OP3 A;  2ACT A;  3KKU A;  3PSE A;  2Y5B A;  2AVW A;  3BPM A;  2DCC A;  3GCB A;  4P6E A;  2R9N A;  1MS6 A;  1STF E;  1KHP A;  1AU4 A;  3BPF A;  2YJ8 A;  3P5X A;  2XU4 A;  3LFY A;  3IFU A;  5CVM A;  1AYV A;  4KLB A;  2VHF A;  4OEM A;  1CV8 A;  1EWM A;  3RVW A;  3HHA A;  3U8E A;  3P5V A;  3W30 A;  3RNV A;  1Y4H A;  3OF9 A;  1XKG A;  3M99 A;  3PW3 A;  1NB5 A;  2HXZ A;  2DC9 A;  4CDF B;  2DZY A;  1POP A;  2J7Q C;  3MHS A;  1QDQ A;  1CB5 A;  3KFQ A;  3OIS A;  3MTV A;  1SNK A;  4ZUX U;  3MJ5 A;  1MEM A;  3KWB X;  2R9O A;  2YJ9 A;  3KX1 A;  2G8E A;  2HH5 A;  1U5I A;  2JTC A;  4W5C A;  1GCB A;  2AU1 A;  3O1G A;  1U9Q X;  2ARY A;  1X9Y A;  1NQC A;  3PNR A;  1PPP A;  4P16 A;  2FO5 A;  4RF0 A;  1QOL A;  4CZW A;  1BP4 A;  2Z84 A;  1YK7 A;  4XUI A;  3PRP A;  4ZTB A;  3PRM A;  4QRV A;  1KXR A;  1DEU A;  2AUX A;  3CBJ A;  5EGW A;  3ZNH A;  3P5U A;  2AYO A;  2E02 A;  1EWO A;  4DMY A;  1ATK A;  5EZS A;  3H8B A;  4FIP A;  4D8I A;  1YAL A;  9PAP A;  1EWP A;  4P6G A; 
#chains in the Genus database with same CATH homology
 1MEG A;  3WXG A;  1GEC E;  2Y6E A;  4MZS A;  3TNX A;  1CVZ A;  2AUZ A;  2NQD B;  1E2T A;  1TU6 A;  2ATO A;  1CJL A;  2DZZ A;  4BQV A;  3C9E A;  3CH3 X;  2DCD A;  2HHN A;  3N4C A;  4B55 A;  3IOQ A;  2GFO A;  6PAD A;  4Q8G A;  1CTE A;  1NB3 A;  1TLO A;  2XU3 A;  1VJV A;  2C0Y A;  1S4V A;  1AU2 A;  5JH3 A;  3I06 A;  4QBB A;  1NLJ A;  3IEJ A;  5F02 A;  1ME4 A;  1U9V A;  3AI8 A;  2FTD A;  1U9W A;  3HWN A;  4CDD B;  1PBH A;  1A6R A;  1VSN A;  3HD3 A;  1JQP A;  3S3Q A;  4PAD A;  3WXE A;  3I3T A;  4OEL A;  1ZIV A;  2VFB A;  2PBH A;  2R9F A;  3F75 A;  4BGF A;  2VFC A;  1AYW A;  3MOR A;  2JQF R;  1EWL A;  1M6D A;  4AXL A;  1BQI A;  1TL9 A;  2AS8 A;  3QT4 A;  4X6I A;  1PIP A;  2NQI A;  3KSE A;  1EF7 A;  2FUD A;  2FT2 A;  3D6S A;  4BS6 A;  3IMA A;  3ZUA A;  1PPO A;  3RVX A;  3H89 A;  1YK8 A;  2PNS A;  4YYS A;  3ERV A;  2G7Y A;  3P5W A;  5EF4 A;  1W5R A;  4XR7 A;  1W4T A;  4PI3 A;  2XU5 A;  1PCI A;  2AIM A;  2VHS A;  3DF0 A;  2PRE A;  2O6X A;  3USV A;  4YVA A;  4YYU A;  3CH2 X;  2F1G A;  4BSQ A;  1F2B A;  2R9M A;  4QRG A;  5FPW A;  3PDF A;  4MZO A;  4WA6 A;  2P0R A;  3BC3 A;  5JA7 A;  2BDL A;  2WBF X;  3WXF A;  4YYV A;  3MHH A;  4YV8 A;  2FRA A;  3KWZ A;  1GMY A;  1MIR A;  2R9C A;  2E03 A;  2R6N A;  3N3K A;  4K7C A;  4FK5 A;  5CVO B;  4C5P A;  2DC7 A;  2DCB A;  2DC6 A;  4N79 A;  4BS5 A;  1ME3 A;  3K9M A;  1HUC B;  3BCN A;  3K24 A;  4BPV A;  1FH0 A;  3OVX A;  2IPP B;  3N3G A;  1Y08 A;  3B79 A;  2G8J A;  2NQG A;  4CDC B;  1QXP A;  2B1M A;  4YYQ A;  3H7D A;  1THE A;  3K8U A;  5A24 A;  1ZCM A;  1F2A A;  3F5V A;  2YJ2 A;  2DJG B;  2P7U A;  2OZ2 A;  3BOW A;  4PP2 E;  1PPN A;  1ITO A;  4X6J A;  3H8C A;  2H7J A;  4Q8H A;  3OF8 A;  1AYU A;  3QJ3 A;  3PBH A;  1U9X A;  1Q6K A;  7PCK A;  4FJC A;  2YJC A;  5J94 A;  1MHW A;  1AEC A;  3O0U A;  4N4Z A;  4NV8 A;  3IV2 A;  1NPZ A;  2CB5 A;  1PPD A;  1AU0 A;  1CSB B;  2DCA A;  4QH6 A;  1DF0 A;  1BY8 A;  1AIM A;  5CHV A;  4AXM A;  3NHE A;  4I05 A;  4YYW A;  4G54 A;  2FRQ A;  1KFU L;  4QRX A;  2GHU A;  1GLO A;  4I04 A;  4HWY A;  3IHP A;  3H6S A;  1YVB A;  2DC8 A;  2G6D A;  3IUT A;  1NL6 A;  1KHQ A;  2P86 A;  2E00 A;  1BGO A;  4NV7 A;  2XU1 A;  2FQ9 A;  4W5B A;  4DMX A;  2JQG R;  2FYE A;  3LXS A;  3CBK A;  4GUZ A;  2BDZ A;  2B1N A;  2IBI A;  1CPJ A;  4RY2 A;  1F29 A;  1K3B B;  1F2C A;  2AYN A;  2HD5 A;  4CDE B;  4W4U A;  2E01 A;  3MTN A;  2YJB A;  1SP4 B;  3V6C A;  2F7D A;  5CVN B;  2CIO A;  4N8W A;  2BSZ A;  3HHI A;  2NQA A;  2PAD A;  3QSD A;  3V6E A;  1KFX L;  1YT7 A;  1CQD A;  1PE6 A;  5PAD A;  1PAD A;  3E1Z B;  4X6H A;  3OVZ A;  5K16 A;  4MSX A;  3KW9 A;  1AU3 A;  1PXV A;  5CHT A;  3S3R A;  4PP1 A;  1CS8 A;  1QMY A;  8PCH A;  1ICF A;  1MDW A;  4I07 A;  4YYR A;  3D9W A;  2OUL A;  1O0E A;  2DJF B;  3RVV A;  3BWK A;  1IWD A;  2OP3 A;  2ACT A;  3KKU A;  2Y5B A;  2AVW A;  3BPM A;  2DCC A;  3GCB A;  4P6E A;  2R9N A;  1MS6 A;  1STF E;  1KHP A;  1AU4 A;  3BPF A;  2YJ8 A;  3P5X A;  2XU4 A;  3LFY A;  5CVM A;  1AYV A;  4KLB A;  2VHF A;  4OEM A;  1CV8 A;  1EWM A;  3RVW A;  3HHA A;  3U8E A;  3P5V A;  1Y4H A;  3OF9 A;  1XKG A;  3M99 A;  3PW3 A;  1NB5 A;  2HXZ A;  2DC9 A;  4CDF B;  2DZY A;  1POP A;  3MHS A;  1QDQ A;  1CB5 A;  3KFQ A;  3OIS A;  1SNK A;  4ZUX U;  1MEM A;  3KWB X;  2R9O A;  2YJ9 A;  3KX1 A;  2G8E A;  2HH5 A;  1U5I A;  4W5C A;  1GCB A;  2AU1 A;  3O1G A;  1U9Q X;  2ARY A;  1X9Y A;  1NQC A;  3PNR A;  1PPP A;  2FO5 A;  1QOL A;  4CZW A;  1BP4 A;  1YK7 A;  4XUI A;  3LTW A;  4QRV A;  1KXR A;  3CBJ A;  1DEU A;  5EGW A;  1GX3 A;  2AUX A;  3P5U A;  2AYO A;  2E02 A;  1W6F A;  1EWO A;  4DMY A;  1ATK A;  3H8B A;  4FIP A;  1YAL A;  9PAP A;  1EWP A;  4P6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...