4I04A

Structure of zymogen of cathepsin b1 from schistosoma mansoni
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
304
Chain Sequence
FEPLSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQMGARREEPDLRRTRRPTVDHNDWNVEIPSSFDSRKKWPRCKSIATIRDQSRCGSSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
molecule keywords Cathepsin B-like peptidase (C01 family)
total genus 105
structure length 304
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i04A00
1AIMA 2E02A 2R9OA 3PNRA 3H8CA 1EF7A 3IHPA 4YYVA 4I04A 1CQDA 3P5XA 3BCNA 1STFE 2FT2A 1S4VA 3P5WA 4CDDB 2YJBA 3CBJA 4X6IA 4MZSA 1CTEA 3QT4A 4YVAA 1CVZA 3DF0A 3E1ZB 1ME4A 2P86A 2ATOA 4CDEB 1PXVA 5CHVA 4QRXA 2PADA 2C0YA 1POPA 4G54A 2YJCA 2R9FA 4CZWA 2B1MA 4PADA 3QSDA 1CSBB 3BPMA 1YK8A 5EF4A 1GECE 1DF0A 2FRQA 4AXMA 1U9VA 1VJVA 3HWNA 1EWPA 4YYQA 1YK7A 2DCCA 3N4CA 2PREA 4YYSA 4CDCB 3AI8A 2NQAA 3KX1A 3H7DA 1QXPA 3OF9A 6PADA 2GFOA 4YV8A 3RVVA 5EGWA 5CVMA 1X9YA 1EWOA 4BS6A 3S3QA 3HHAA 1PADA 2NQDB 1NQCA 3P5VA 1QOLA 3BOWA 2HXZA 1F29A 2DC7A 3RVXA 2G6DA 4OELA 3WXEA 1NLJA 1DEUA 3V6CA 1YALA 4PP1A 3KWBX 2DCBA 2P7UA 3CH2X 5JH3A 3IMAA 3WXGA 4ZUXU 1U9XA 2FQ9A 3IV2A 3KW9A 1GMYA 2R9MA 2F1GA 1PCIA 4RY2A 1CJLA 3KSEA 2H7JA 3PW3A 4DMYA 5K16A 9PAPA 1ZIVA 2DC8A 1ATKA 2XU1A 5PADA 4QH6A 4QRVA 4YYWA 1AU4A 4PI3A 1JQPA 1MEGA 3P5UA 1KFXL 4QRGA 2NQIA 1AU0A 2IPPB 2G7YA 2AS8A 5J94A 3IEJA 1MDWA 1AECA 3MTNA 2E00A 2AVWA 1PBHA 3BPFA 4WA6A 2OZ2A 8PCHA 2JQGR 2E01A 2YJ9A 3QJ3A 2DJGB 3F5VA 1F2BA 1A6RA 3KFQA 1AYUA 2PBHA 1CPJA 2HHNA 4X6HA 2JQFR 4MZOA 2Y5BA 3CH3X 5FPWA 4I05A 2F7DA 2XU3A 1MHWA 1BP4A 3KKUA 1KFUL 1ZCMA 2YJ2A 1Q6KA 1PIPA 2IBIA 4CDFB 2VHSA 4BQVA 4X6JA 4BSQA 2FUDA 1YVBA 3B79A 1TU6A 4P6EA 2AU1A 2G8JA 2WBFX 1ITOA 1U9QX 3LFYA 1SNKA 4DMXA 3D6SA 3USVA 3I3TA 1KHQA 4YYRA 1BY8A 3HHIA 1Y4HA 3OVZA 3LXSA 3CBKA 1Y08A 1F2CA 2HH5A 1ME3A 4N4ZA 3KWZA 1FH0A 4P6GA 3H89A 4HWYA 3MHSA 4N8WA 3C9EA 1IWDA 1EWMA 3OF8A 4K7CA 3H6SA 2B1NA 2OP3A 1AYWA 3N3GA 4XR7A 3K24A 3K9MA 2PNSA 5CVOB 1XKGA 1PPDA 1QDQA 2G8EA 3BC3A 3S3RA 3TNXA 3M99A 3O0UA 3OVXA 1BGOA 4Q8HA 2DC6A 2AYOA 3U8EA 2FO5A 1MEMA 3MORA 3NHEA 2OULA 3O1GA 4MSXA 4FIPA 1YT7A 5A24A 4AXLA 3V6EA 3K8UA 2XU4A 4OEMA 2DZYA 2DCDA 2DJFB 3HD3A 3OISA 3GCBA 1CS8A 3MHHA 4Q8GA 5CVNB 1AU2A 3RVWA 1GLOA 1GCBA 1BQIA 1AU3A 1PPNA 1MIRA 2R6NA 1AYVA 5F02A 1NB5A 2BDLA 4FK5A 3ZUAA 1THEA 1O0EA 2Y6EA 2E03A 2DCAA 3ERVA 1K3BB 2CIOA 3H8BA 2AYNA 1M6DA 4PP2E 2O6XA 4FJCA 7PCKA 1KXRA 1PPOA 4BPVA 4W5BA 5JA7A 1NPZA 3IUTA 2FYEA 2ARYA 2P0RA 2AIMA 3F75A 2FTDA 3N3KA 1CB5A 2R9NA 2GHUA 3PDFA 1PE6A 2XU5A 3BWKA 1VSNA 1NB3A 4XUIA 2CB5A 3IOQA 3I06A 1TLOA 2YJ8A 2VHFA 2AUZA 4W5CA 4KLBA 1SP4B 1PPPA 2HD5A 1U5IA 2R9CA 1QMYA 4QBBA 1EWLA 1KHPA 1MS6A 1ICFA 4W4UA 1NL6A 1U9WA 2BDZA 1F2AA 2DZZA 3WXFA 4N79A 1TL9A 4BS5A 4I07A 2FRAA 1HUCB 2DC9A 2ACTA 3PBHA 2AUXA 1CV8A 5CHTA 4YYUA 2NQGA
chains in the Genus database with same CATH superfamily
2Z84A 1AIMA 2E02A 2R9OA 3PNRA 3H8CA 1EF7A 3IHPA 4YYVA 4I04A 1CQDA 3P5XA 3BCNA 1STFE 2FT2A 1S4VA 3P5WA 4CDDB 2YJBA 4IUMA 3CBJA 4X6IA 4MZSA 1CTEA 3QT4A 4YVAA 1CVZA 3DF0A 3E1ZB 3RNVA 1ME4A 2P86A 2ATOA 3MP2A 1PXVA 4CDEB 5CHVA 4QRXA 2PADA 2C0YA 1POPA 4G54A 2YJCA 3W30A 4IP3A 2R9FA 4CZWA 2B1MA 4PADA 3QSDA 1CSBB 4REZA 3BPMA 1YK8A 4BOUA 5EF4A 1GECE 4XZXA 5E6JA 1DF0A 2FRQA 4AXMA 1U9VA 5JZEA 1VJVA 3HWNA 2BU3A 3MJ5A 1EWPA 3PHUA 3ZNHA 4YYQA 1YK7A 2DCCA 3N4CA 2PREA 4YYSA 4CDCB 3AI8A 2NQAA 3KX1A 3H7DA 4D8BA 1QXPA 3OF9A 6PADA 2HWKA 2GFOA 4YV8A 3RVVA 5EGWA 4MI7A 5CVMA 1X9YA 1EWOA 4BS6A 3S3QA 2DOSA 3HHAA 1PADA 2NQDB 4RF1A 1NQCA 3PT2A 3P5VA 1QOLA 3BOWA 2HXZA 1F29A 2DC7A 3RVXA 2G6DA 4OELA 3WXEA 1NLJA 1DEUA 3V6CA 1YALA 4PP1A 1YZBA 3KWBX 2DCBA 2JRIA 2P7UA 3CH2X 5JH3A 4PT5A 3IMAA 3WXGA 4ZUXU 1U9XA 2FQ9A 3IV2A 3KW9A 1GMYA 1UKFA 3IFUA 2R9MA 2F1GA 1PCIA 4RY2A 1CJLA 3KSEA 2H7JA 3PW3A 4DMYA 4D8EA 5K16A 9PAPA 3BB7A 1ZIVA 2DC8A 1ATKA 2XU1A 5PADA 4QH6A 3PHWA 3PSEA 4QRVA 4YYWA 1AU4A 4PI3A 1JQPA 1MEGA 3P5UA 1KFXL 4QRGA 4M0WA 2NQIA 1AU0A 2IPPB 2G7YA 1PVJA 2AS8A 5J94A 3IEJA 1MDWA 1AECA 3MTNA 4BOQA 2E00A 2AVWA 1PBHA 3BPFA 4WA6A 2OZ2A 8PCHA 2JQGR 2E01A 2YJ9A 3QJ3A 2DJGB 3F5VA 1F2BA 1A6RA 3PRMA 3KFQA 1AYUA 2PBHA 1CPJA 4HXDB 2HHNA 4BOSA 4X6HA 2JQFR 4WURA 2J7QC 4MZOA 3OQCA 2Y5BA 3CH3X 5FPWA 4I05A 2F7DA 2XU3A 1MHWA 1BP4A 3C0RA 3KKUA 1KFUL 1ZCMA 2YJ2A 1Q6KA 4ZTBA 1PIPA 2IBIA 4CDFB 2VHSA 4BQVA 4X6JA 4BSQA 2FUDA 2JTCA 1YVBA 3B79A 1TU6A 1DKIA 4P6EA 2AU1A 2G8JA 2WBFX 1ITOA 1U9QX 4BOPA 3LFYA 1SNKA 4RF0A 4DMXA 4GUAA 3D6SA 3TMPA 3USVA 2UZJA 3I3TA 1KHQA 4YYRA 1BY8A 3HHIA 1Y4HA 3OVZA 3LXSA 3CBKA 1Y08A 1F2CA 2HH5A 1ME3A 3PRPA 4N4ZA 3KWZA 1FH0A 4P6GA 3H89A 4HWYA 3W31A 4D8IA 4OW0A 3MHSA 4N8WA 3C9EA 3TRKA 1IWDA 1EWMA 3OF8A 4K7CA 3H6SA 2B1NA 2OP3A 1AYWA 3N3GA 4XR7A 3K24A 5KO3A 3K9MA 2PNSA 3BBAA 5CVOB 1XKGA 1PPDA 1QDQA 2G8EA 4OVZB 3BC3A 3S3RA 3M99A 3O0UA 2FE8A 3OVXA 3TNXA 1BGOA 4Q8HA 2DC6A 2AYOA 3U8EA 2FO5A 1MEMA 3MORA 3NHEA 2OULA 3O1GA 4MSXA 4FIPA 1YT7A 5A24A 4AXLA 3V6EA 3K8UA 2XU4A 4OEMA 5EZQA 2DZYA 2BTWA 2DCDA 4RNAA 2DJFB 3HD3A 3OISA 3GCBA 1CS8A 3MHHA 4Q8GA 5CVNB 1AU2A 3MTVA 3RVWA 1GLOA 1GCBA 1BQIA 1AU3A 1PPNA 3E9SA 1MIRA 2R6NA 5EZSA 1AYVA 5F02A 1NB5A 2BDLA 4FK5A 3ZUAA 1THEA 1O0EA 2Y6EA 2E03A 4OVZA 2DCAA 3ERVA 1K3BB 2CIOA 3H8BA 2AYNA 1M6DA 4PP2E 2O6XA 4FJCA 7PCKA 1KXRA 1PPOA 3O65A 4BPVA 4W5BA 5JA7A 1NPZA 3IUTA 2FYEA 2ARYA 2P0RA 2AIMA 4RKXA 3F75A 2FTDA 3PHXA 3BY4A 3N3KA 1CB5A 3B21A 2R9NA 2GHUA 3PDFA 1PE6A 2XU5A 3BWKA 1VSNA 1NB3A 4XUIA 2CB5A 3IOQA 4MM3B 3I06A 1TLOA 2YJ8A 4BOZA 2VHFA 2AUZA 4W5CA 4KLBA 1SP4B 1PPPA 2HD5A 4R3DA 1U5IA 2R9CA 1QMYA 2AGAA 4QBBA 1EWLA 1KHPA 1MS6A 1ICFA 2J7QA 4W4UA 1NL6A 1U9WA 2BDZA 1F2AA 2DZZA 3WXFA 4N79A 1TL9A 4BS5A 4I07A 2FRAA 1HUCB 4A5UA 2DC9A 2ACTA 3PBHA 2BTWB 2AUXA 1CV8A 4P16A 5CHTA 4YYUA 2NQGA
chains in the Genus database with same CATH topology
1AIMA 2E02A 4BGFA 2R9OA 3PNRA 3H8CA 1EF7A 3IHPA 4YYVA 4I04A 1CQDA 3P5XA 3BCNA 1STFE 2FT2A 1S4VA 3P5WA 4CDDB 2YJBA 3CBJA 4X6IA 4MZSA 1CTEA 3QT4A 4YVAA 1CVZA 3DF0A 3E1ZB 1ME4A 2P86A 2ATOA 4CDEB 1PXVA 5CHVA 4QRXA 2PADA 2C0YA 1POPA 4G54A 2YJCA 2R9FA 4CZWA 2B1MA 4PADA 3QSDA 1CSBB 3BPMA 1YK8A 5EF4A 1GECE 1DF0A 2FRQA 4AXMA 1U9VA 1VJVA 3HWNA 1EWPA 4YYQA 1YK7A 2DCCA 3N4CA 2PREA 4YYSA 4CDCB 3AI8A 2NQAA 3KX1A 3H7DA 1QXPA 3OF9A 6PADA 2GFOA 4YV8A 3RVVA 5EGWA 5CVMA 1X9YA 1EWOA 4BS6A 3S3QA 3HHAA 1PADA 2NQDB 1NQCA 3P5VA 1QOLA 3BOWA 2HXZA 1F29A 2DC7A 4B55A 3RVXA 2G6DA 4OELA 3WXEA 1NLJA 4GUZA 1DEUA 3V6CA 1YALA 4PP1A 3KWBX 2DCBA 2P7UA 3CH2X 5JH3A 3IMAA 3WXGA 4ZUXU 1U9XA 2FQ9A 3IV2A 3KW9A 1GMYA 1E2TA 2R9MA 2F1GA 1PCIA 4RY2A 1CJLA 3KSEA 2H7JA 3PW3A 4DMYA 5K16A 9PAPA 1ZIVA 2DC8A 1ATKA 2XU1A 5PADA 4QH6A 4C5PA 4QRVA 4YYWA 1AU4A 4PI3A 1JQPA 1MEGA 1GX3A 3P5UA 1KFXL 4QRGA 2NQIA 1AU0A 2IPPB 2G7YA 2AS8A 5J94A 3IEJA 1MDWA 1AECA 3MTNA 2E00A 2AVWA 1PBHA 3BPFA 4WA6A 2OZ2A 8PCHA 2JQGR 2E01A 2YJ9A 3QJ3A 2DJGB 3F5VA 1F2BA 1A6RA 3KFQA 1AYUA 2PBHA 1CPJA 2HHNA 4X6HA 2JQFR 4MZOA 2Y5BA 3CH3X 5FPWA 1W4TA 4I05A 2F7DA 2XU3A 1MHWA 1BP4A 3KKUA 1KFUL 1ZCMA 2YJ2A 1Q6KA 1PIPA 2IBIA 4CDFB 2VHSA 4BQVA 4X6JA 4BSQA 2FUDA 1YVBA 3B79A 1TU6A 4P6EA 2AU1A 2G8JA 2WBFX 1ITOA 1U9QX 3LFYA 1SNKA 4DMXA 3D6SA 2VFCA 3LTWA 3USVA 1W5RA 3I3TA 1KHQA 4YYRA 1BY8A 3HHIA 1Y4HA 3OVZA 3LXSA 3CBKA 1Y08A 1F2CA 2HH5A 1ME3A 4N4ZA 3KWZA 1FH0A 4P6GA 3H89A 4HWYA 1W6FA 3MHSA 4N8WA 3C9EA 1IWDA 1EWMA 3OF8A 4K7CA 3H6SA 2B1NA 2OP3A 1AYWA 3N3GA 4XR7A 3K24A 3K9MA 2PNSA 5CVOB 1XKGA 1PPDA 1QDQA 2G8EA 3BC3A 3S3RA 3M99A 3O0UA 3TNXA 3OVXA 1BGOA 4Q8HA 2DC6A 2AYOA 3U8EA 2FO5A 1MEMA 3MORA 3NHEA 2OULA 3O1GA 4MSXA 4FIPA 1YT7A 5A24A 4AXLA 3V6EA 3K8UA 2XU4A 4OEMA 2DZYA 2DCDA 2DJFB 3HD3A 3OISA 2BSZA 3GCBA 1CS8A 3MHHA 4Q8GA 5CVNB 1AU2A 3RVWA 4NV7A 1GLOA 1GCBA 1BQIA 1AU3A 1PPNA 1MIRA 2R6NA 1AYVA 5F02A 1NB5A 2BDLA 4NV8A 4FK5A 3ZUAA 1THEA 1O0EA 2Y6EA 2E03A 2DCAA 3ERVA 1K3BB 2CIOA 3H8BA 2AYNA 1M6DA 4PP2E 2O6XA 4FJCA 7PCKA 1KXRA 1PPOA 4BPVA 4W5BA 5JA7A 1NPZA 3IUTA 2FYEA 2ARYA 2P0RA 2AIMA 3F75A 2FTDA 3N3KA 1CB5A 2R9NA 2GHUA 3PDFA 1PE6A 2XU5A 3BWKA 1VSNA 1NB3A 4XUIA 2CB5A 3IOQA 3I06A 2VFBA 1TLOA 2YJ8A 2VHFA 2AUZA 4W5CA 4KLBA 1SP4B 1PPPA 2HD5A 1U5IA 2R9CA 1QMYA 4QBBA 1EWLA 1KHPA 1MS6A 1ICFA 4W4UA 1NL6A 1U9WA 2BDZA 1F2AA 2DZZA 3WXFA 4N79A 1TL9A 4BS5A 4I07A 2FRAA 1HUCB 3D9WA 2DC9A 2ACTA 3PBHA 2AUXA 1CV8A 5CHTA 4YYUA 2NQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIM A;  2E02 A;  2R9O A;  3PNR A;  3H8C A;  1EF7 A;  3IHP A;  4YYV A;  4I04 A;  1CQD A;  3P5X A;  3BCN A;  1STF E;  2FT2 A;  1S4V A;  3P5W A;  4CDD B;  2YJB A;  3CBJ A;  4X6I A;  4MZS A;  1CTE A;  3QT4 A;  4YVA A;  1CVZ A;  3DF0 A;  3E1Z B;  1ME4 A;  2P86 A;  2ATO A;  4CDE B;  1PXV A;  5CHV A;  4QRX A;  2PAD A;  2C0Y A;  1POP A;  4G54 A;  2YJC A;  2R9F A;  4CZW A;  2B1M A;  4PAD A;  3QSD A;  1CSB B;  3BPM A;  1YK8 A;  5EF4 A;  1GEC E;  1DF0 A;  2FRQ A;  4AXM A;  1U9V A;  1VJV A;  3HWN A;  1EWP A;  4YYQ A;  1YK7 A;  2DCC A;  3N4C A;  2PRE A;  4YYS A;  4CDC B;  3AI8 A;  2NQA A;  3KX1 A;  3H7D A;  1QXP A;  3OF9 A;  6PAD A;  2GFO A;  4YV8 A;  3RVV A;  5EGW A;  5CVM A;  1X9Y A;  1EWO A;  4BS6 A;  3S3Q A;  3HHA A;  1PAD A;  2NQD B;  1NQC A;  3P5V A;  1QOL A;  3BOW A;  2HXZ A;  1F29 A;  2DC7 A;  3RVX A;  2G6D A;  4OEL A;  3WXE A;  1NLJ A;  1DEU A;  3V6C A;  1YAL A;  4PP1 A;  3KWB X;  2DCB A;  2P7U A;  3CH2 X;  5JH3 A;  3IMA A;  3WXG A;  4ZUX U;  1U9X A;  2FQ9 A;  3IV2 A;  3KW9 A;  1GMY A;  2R9M A;  2F1G A;  1PCI A;  4RY2 A;  1CJL A;  3KSE A;  2H7J A;  3PW3 A;  4DMY A;  5K16 A;  9PAP A;  1ZIV A;  2DC8 A;  1ATK A;  2XU1 A;  5PAD A;  4QH6 A;  4QRV A;  4YYW A;  1AU4 A;  4PI3 A;  1JQP A;  1MEG A;  3P5U A;  1KFX L;  4QRG A;  2NQI A;  1AU0 A;  2IPP B;  2G7Y A;  2AS8 A;  5J94 A;  3IEJ A;  1MDW A;  1AEC A;  3MTN A;  2E00 A;  2AVW A;  1PBH A;  3BPF A;  4WA6 A;  2OZ2 A;  8PCH A;  2JQG R;  2E01 A;  2YJ9 A;  3QJ3 A;  2DJG B;  3F5V A;  1F2B A;  1A6R A;  3KFQ A;  1AYU A;  2PBH A;  1CPJ A;  2HHN A;  4X6H A;  2JQF R;  4MZO A;  2Y5B A;  3CH3 X;  5FPW A;  4I05 A;  2F7D A;  2XU3 A;  1MHW A;  1BP4 A;  3KKU A;  1KFU L;  1ZCM A;  2YJ2 A;  1Q6K A;  1PIP A;  2IBI A;  4CDF B;  2VHS A;  4BQV A;  4X6J A;  4BSQ A;  2FUD A;  1YVB A;  3B79 A;  1TU6 A;  4P6E A;  2AU1 A;  2G8J A;  2WBF X;  1ITO A;  1U9Q X;  3LFY A;  1SNK A;  4DMX A;  3D6S A;  3USV A;  3I3T A;  1KHQ A;  4YYR A;  1BY8 A;  3HHI A;  1Y4H A;  3OVZ A;  3LXS A;  3CBK A;  1Y08 A;  1F2C A;  2HH5 A;  1ME3 A;  4N4Z A;  3KWZ A;  1FH0 A;  4P6G A;  3H89 A;  4HWY A;  3MHS A;  4N8W A;  3C9E A;  1IWD A;  1EWM A;  3OF8 A;  4K7C A;  3H6S A;  2B1N A;  2OP3 A;  1AYW A;  3N3G A;  4XR7 A;  3K24 A;  3K9M A;  2PNS A;  5CVO B;  1XKG A;  1PPD A;  1QDQ A;  2G8E A;  3BC3 A;  3S3R A;  3TNX A;  3M99 A;  3O0U A;  3OVX A;  1BGO A;  4Q8H A;  2DC6 A;  2AYO A;  3U8E A;  2FO5 A;  1MEM A;  3MOR A;  3NHE A;  2OUL A;  3O1G A;  4MSX A;  4FIP A;  1YT7 A;  5A24 A;  4AXL A;  3V6E A;  3K8U A;  2XU4 A;  4OEM A;  2DZY A;  2DCD A;  2DJF B;  3HD3 A;  3OIS A;  3GCB A;  1CS8 A;  3MHH A;  4Q8G A;  5CVN B;  1AU2 A;  3RVW A;  1GLO A;  1GCB A;  1BQI A;  1AU3 A;  1PPN A;  1MIR A;  2R6N A;  1AYV A;  5F02 A;  1NB5 A;  2BDL A;  4FK5 A;  3ZUA A;  1THE A;  1O0E A;  2Y6E A;  2E03 A;  2DCA A;  3ERV A;  1K3B B;  2CIO A;  3H8B A;  2AYN A;  1M6D A;  4PP2 E;  2O6X A;  4FJC A;  7PCK A;  1KXR A;  1PPO A;  4BPV A;  4W5B A;  5JA7 A;  1NPZ A;  3IUT A;  2FYE A;  2ARY A;  2P0R A;  2AIM A;  3F75 A;  2FTD A;  3N3K A;  1CB5 A;  2R9N A;  2GHU A;  3PDF A;  1PE6 A;  2XU5 A;  3BWK A;  1VSN A;  1NB3 A;  4XUI A;  2CB5 A;  3IOQ A;  3I06 A;  1TLO A;  2YJ8 A;  2VHF A;  2AUZ A;  4W5C A;  4KLB A;  1SP4 B;  1PPP A;  2HD5 A;  1U5I A;  2R9C A;  1QMY A;  4QBB A;  1EWL A;  1KHP A;  1MS6 A;  1ICF A;  4W4U A;  1NL6 A;  1U9W A;  2BDZ A;  1F2A A;  2DZZ A;  3WXF A;  4N79 A;  1TL9 A;  4BS5 A;  4I07 A;  2FRA A;  1HUC B;  2DC9 A;  2ACT A;  3PBH A;  2AUX A;  1CV8 A;  5CHT A;  4YYU A;  2NQG A; 
#chains in the Genus database with same CATH topology
 2Z84 A;  1AIM A;  2E02 A;  2R9O A;  3PNR A;  3H8C A;  1EF7 A;  3IHP A;  4YYV A;  4I04 A;  1CQD A;  3P5X A;  3BCN A;  1STF E;  2FT2 A;  1S4V A;  3P5W A;  4CDD B;  2YJB A;  4IUM A;  3CBJ A;  4X6I A;  4MZS A;  1CTE A;  3QT4 A;  4YVA A;  1CVZ A;  3DF0 A;  3E1Z B;  3RNV A;  1ME4 A;  2P86 A;  2ATO A;  3MP2 A;  1PXV A;  4CDE B;  5CHV A;  4QRX A;  2PAD A;  2C0Y A;  1POP A;  4G54 A;  2YJC A;  3W30 A;  4IP3 A;  2R9F A;  4CZW A;  2B1M A;  4PAD A;  3QSD A;  1CSB B;  4REZ A;  3BPM A;  1YK8 A;  4BOU A;  5EF4 A;  1GEC E;  4XZX A;  5E6J A;  1DF0 A;  2FRQ A;  4AXM A;  1U9V A;  5JZE A;  1VJV A;  3HWN A;  2BU3 A;  3MJ5 A;  1EWP A;  3PHU A;  3ZNH A;  4YYQ A;  1YK7 A;  2DCC A;  3N4C A;  2PRE A;  4YYS A;  4CDC B;  3AI8 A;  2NQA A;  3KX1 A;  3H7D A;  4D8B A;  1QXP A;  3OF9 A;  6PAD A;  2HWK A;  2GFO A;  4YV8 A;  3RVV A;  5EGW A;  4MI7 A;  5CVM A;  1X9Y A;  1EWO A;  4BS6 A;  3S3Q A;  2DOS A;  3HHA A;  1PAD A;  2NQD B;  4RF1 A;  1NQC A;  3PT2 A;  3P5V A;  1QOL A;  3BOW A;  2HXZ A;  1F29 A;  2DC7 A;  3RVX A;  2G6D A;  4OEL A;  3WXE A;  1NLJ A;  1DEU A;  3V6C A;  1YAL A;  4PP1 A;  1YZB A;  3KWB X;  2DCB A;  2JRI A;  2P7U A;  3CH2 X;  5JH3 A;  4PT5 A;  3IMA A;  3WXG A;  4ZUX U;  1U9X A;  2FQ9 A;  3IV2 A;  3KW9 A;  1GMY A;  1UKF A;  3IFU A;  2R9M A;  2F1G A;  1PCI A;  4RY2 A;  1CJL A;  3KSE A;  2H7J A;  3PW3 A;  4DMY A;  4D8E A;  5K16 A;  9PAP A;  3BB7 A;  1ZIV A;  2DC8 A;  1ATK A;  2XU1 A;  5PAD A;  4QH6 A;  3PHW A;  3PSE A;  4QRV A;  4YYW A;  1AU4 A;  4PI3 A;  1JQP A;  1MEG A;  3P5U A;  1KFX L;  4QRG A;  4M0W A;  2NQI A;  1AU0 A;  2IPP B;  2G7Y A;  1PVJ A;  2AS8 A;  5J94 A;  3IEJ A;  1MDW A;  1AEC A;  3MTN A;  4BOQ A;  2E00 A;  2AVW A;  1PBH A;  3BPF A;  4WA6 A;  2OZ2 A;  8PCH A;  2JQG R;  2E01 A;  2YJ9 A;  3QJ3 A;  2DJG B;  3F5V A;  1F2B A;  1A6R A;  3PRM A;  3KFQ A;  1AYU A;  2PBH A;  1CPJ A;  4HXD B;  2HHN A;  4BOS A;  4X6H A;  2JQF R;  4WUR A;  2J7Q C;  4MZO A;  3OQC A;  2Y5B A;  3CH3 X;  5FPW A;  4I05 A;  2F7D A;  2XU3 A;  1MHW A;  1BP4 A;  3C0R A;  3KKU A;  1KFU L;  1ZCM A;  2YJ2 A;  1Q6K A;  4ZTB A;  1PIP A;  2IBI A;  4CDF B;  2VHS A;  4BQV A;  4X6J A;  4BSQ A;  2FUD A;  2JTC A;  1YVB A;  3B79 A;  1TU6 A;  1DKI A;  4P6E A;  2AU1 A;  2G8J A;  2WBF X;  1ITO A;  1U9Q X;  4BOP A;  3LFY A;  1SNK A;  4RF0 A;  4DMX A;  4GUA A;  3D6S A;  3TMP A;  3USV A;  2UZJ A;  3I3T A;  1KHQ A;  4YYR A;  1BY8 A;  3HHI A;  1Y4H A;  3OVZ A;  3LXS A;  3CBK A;  1Y08 A;  1F2C A;  2HH5 A;  1ME3 A;  3PRP A;  4N4Z A;  3KWZ A;  1FH0 A;  4P6G A;  3H89 A;  4HWY A;  3W31 A;  4D8I A;  4OW0 A;  3MHS A;  4N8W A;  3C9E A;  3TRK A;  1IWD A;  1EWM A;  3OF8 A;  4K7C A;  3H6S A;  2B1N A;  2OP3 A;  1AYW A;  3N3G A;  4XR7 A;  3K24 A;  5KO3 A;  3K9M A;  2PNS A;  3BBA A;  5CVO B;  1XKG A;  1PPD A;  1QDQ A;  2G8E A;  4OVZ B;  3BC3 A;  3S3R A;  3M99 A;  3O0U A;  2FE8 A;  3OVX A;  3TNX A;  1BGO A;  4Q8H A;  2DC6 A;  2AYO A;  3U8E A;  2FO5 A;  1MEM A;  3MOR A;  3NHE A;  2OUL A;  3O1G A;  4MSX A;  4FIP A;  1YT7 A;  5A24 A;  4AXL A;  3V6E A;  3K8U A;  2XU4 A;  4OEM A;  5EZQ A;  2DZY A;  2BTW A;  2DCD A;  4RNA A;  2DJF B;  3HD3 A;  3OIS A;  3GCB A;  1CS8 A;  3MHH A;  4Q8G A;  5CVN B;  1AU2 A;  3MTV A;  3RVW A;  1GLO A;  1GCB A;  1BQI A;  1AU3 A;  1PPN A;  3E9S A;  1MIR A;  2R6N A;  5EZS A;  1AYV A;  5F02 A;  1NB5 A;  2BDL A;  4FK5 A;  3ZUA A;  1THE A;  1O0E A;  2Y6E A;  2E03 A;  4OVZ A;  2DCA A;  3ERV A;  1K3B B;  2CIO A;  3H8B A;  2AYN A;  1M6D A;  4PP2 E;  2O6X A;  4FJC A;  7PCK A;  1KXR A;  1PPO A;  3O65 A;  4BPV A;  4W5B A;  5JA7 A;  1NPZ A;  3IUT A;  2FYE A;  2ARY A;  2P0R A;  2AIM A;  4RKX A;  3F75 A;  2FTD A;  3PHX A;  3BY4 A;  3N3K A;  1CB5 A;  3B21 A;  2R9N A;  2GHU A;  3PDF A;  1PE6 A;  2XU5 A;  3BWK A;  1VSN A;  1NB3 A;  4XUI A;  2CB5 A;  3IOQ A;  4MM3 B;  3I06 A;  1TLO A;  2YJ8 A;  4BOZ A;  2VHF A;  2AUZ A;  4W5C A;  4KLB A;  1SP4 B;  1PPP A;  2HD5 A;  4R3D A;  1U5I A;  2R9C A;  1QMY A;  2AGA A;  4QBB A;  1EWL A;  1KHP A;  1MS6 A;  1ICF A;  2J7Q A;  4W4U A;  1NL6 A;  1U9W A;  2BDZ A;  1F2A A;  2DZZ A;  3WXF A;  4N79 A;  1TL9 A;  4BS5 A;  4I07 A;  2FRA A;  1HUC B;  4A5U A;  2DC9 A;  2ACT A;  3PBH A;  2BTW B;  2AUX A;  1CV8 A;  4P16 A;  5CHT A;  4YYU A;  2NQG A; 
#chains in the Genus database with same CATH homology
 1AIM A;  2E02 A;  4BGF A;  2R9O A;  3PNR A;  3H8C A;  1EF7 A;  3IHP A;  4YYV A;  4I04 A;  1CQD A;  3P5X A;  3BCN A;  1STF E;  2FT2 A;  1S4V A;  3P5W A;  4CDD B;  2YJB A;  3CBJ A;  4X6I A;  4MZS A;  1CTE A;  3QT4 A;  4YVA A;  1CVZ A;  3DF0 A;  3E1Z B;  1ME4 A;  2P86 A;  2ATO A;  4CDE B;  1PXV A;  5CHV A;  4QRX A;  2PAD A;  2C0Y A;  1POP A;  4G54 A;  2YJC A;  2R9F A;  4CZW A;  2B1M A;  4PAD A;  3QSD A;  1CSB B;  3BPM A;  1YK8 A;  5EF4 A;  1GEC E;  1DF0 A;  2FRQ A;  4AXM A;  1U9V A;  1VJV A;  3HWN A;  1EWP A;  4YYQ A;  1YK7 A;  2DCC A;  3N4C A;  2PRE A;  4YYS A;  4CDC B;  3AI8 A;  2NQA A;  3KX1 A;  3H7D A;  1QXP A;  3OF9 A;  6PAD A;  2GFO A;  4YV8 A;  3RVV A;  5EGW A;  5CVM A;  1X9Y A;  1EWO A;  4BS6 A;  3S3Q A;  3HHA A;  1PAD A;  2NQD B;  1NQC A;  3P5V A;  1QOL A;  3BOW A;  2HXZ A;  1F29 A;  2DC7 A;  4B55 A;  3RVX A;  2G6D A;  4OEL A;  3WXE A;  1NLJ A;  4GUZ A;  1DEU A;  3V6C A;  1YAL A;  4PP1 A;  3KWB X;  2DCB A;  2P7U A;  3CH2 X;  5JH3 A;  3IMA A;  3WXG A;  4ZUX U;  1U9X A;  2FQ9 A;  3IV2 A;  3KW9 A;  1GMY A;  1E2T A;  2R9M A;  2F1G A;  1PCI A;  4RY2 A;  1CJL A;  3KSE A;  2H7J A;  3PW3 A;  4DMY A;  5K16 A;  9PAP A;  1ZIV A;  2DC8 A;  1ATK A;  2XU1 A;  5PAD A;  4QH6 A;  4C5P A;  4QRV A;  4YYW A;  1AU4 A;  4PI3 A;  1JQP A;  1MEG A;  1GX3 A;  3P5U A;  1KFX L;  4QRG A;  2NQI A;  1AU0 A;  2IPP B;  2G7Y A;  2AS8 A;  5J94 A;  3IEJ A;  1MDW A;  1AEC A;  3MTN A;  2E00 A;  2AVW A;  1PBH A;  3BPF A;  4WA6 A;  2OZ2 A;  8PCH A;  2JQG R;  2E01 A;  2YJ9 A;  3QJ3 A;  2DJG B;  3F5V A;  1F2B A;  1A6R A;  3KFQ A;  1AYU A;  2PBH A;  1CPJ A;  2HHN A;  4X6H A;  2JQF R;  4MZO A;  2Y5B A;  3CH3 X;  5FPW A;  1W4T A;  4I05 A;  2F7D A;  2XU3 A;  1MHW A;  1BP4 A;  3KKU A;  1KFU L;  1ZCM A;  2YJ2 A;  1Q6K A;  1PIP A;  2IBI A;  4CDF B;  2VHS A;  4BQV A;  4X6J A;  4BSQ A;  2FUD A;  1YVB A;  3B79 A;  1TU6 A;  4P6E A;  2AU1 A;  2G8J A;  2WBF X;  1ITO A;  1U9Q X;  3LFY A;  1SNK A;  4DMX A;  3D6S A;  2VFC A;  3LTW A;  3USV A;  1W5R A;  3I3T A;  1KHQ A;  4YYR A;  1BY8 A;  3HHI A;  1Y4H A;  3OVZ A;  3LXS A;  3CBK A;  1Y08 A;  1F2C A;  2HH5 A;  1ME3 A;  4N4Z A;  3KWZ A;  1FH0 A;  4P6G A;  3H89 A;  4HWY A;  1W6F A;  3MHS A;  4N8W A;  3C9E A;  1IWD A;  1EWM A;  3OF8 A;  4K7C A;  3H6S A;  2B1N A;  2OP3 A;  1AYW A;  3N3G A;  4XR7 A;  3K24 A;  3K9M A;  2PNS A;  5CVO B;  1XKG A;  1PPD A;  1QDQ A;  2G8E A;  3BC3 A;  3S3R A;  3M99 A;  3O0U A;  3TNX A;  3OVX A;  1BGO A;  4Q8H A;  2DC6 A;  2AYO A;  3U8E A;  2FO5 A;  1MEM A;  3MOR A;  3NHE A;  2OUL A;  3O1G A;  4MSX A;  4FIP A;  1YT7 A;  5A24 A;  4AXL A;  3V6E A;  3K8U A;  2XU4 A;  4OEM A;  2DZY A;  2DCD A;  2DJF B;  3HD3 A;  3OIS A;  2BSZ A;  3GCB A;  1CS8 A;  3MHH A;  4Q8G A;  5CVN B;  1AU2 A;  3RVW A;  4NV7 A;  1GLO A;  1GCB A;  1BQI A;  1AU3 A;  1PPN A;  1MIR A;  2R6N A;  1AYV A;  5F02 A;  1NB5 A;  2BDL A;  4NV8 A;  4FK5 A;  3ZUA A;  1THE A;  1O0E A;  2Y6E A;  2E03 A;  2DCA A;  3ERV A;  1K3B B;  2CIO A;  3H8B A;  2AYN A;  1M6D A;  4PP2 E;  2O6X A;  4FJC A;  7PCK A;  1KXR A;  1PPO A;  4BPV A;  4W5B A;  5JA7 A;  1NPZ A;  3IUT A;  2FYE A;  2ARY A;  2P0R A;  2AIM A;  3F75 A;  2FTD A;  3N3K A;  1CB5 A;  2R9N A;  2GHU A;  3PDF A;  1PE6 A;  2XU5 A;  3BWK A;  1VSN A;  1NB3 A;  4XUI A;  2CB5 A;  3IOQ A;  3I06 A;  2VFB A;  1TLO A;  2YJ8 A;  2VHF A;  2AUZ A;  4W5C A;  4KLB A;  1SP4 B;  1PPP A;  2HD5 A;  1U5I A;  2R9C A;  1QMY A;  4QBB A;  1EWL A;  1KHP A;  1MS6 A;  1ICF A;  4W4U A;  1NL6 A;  1U9W A;  2BDZ A;  1F2A A;  2DZZ A;  3WXF A;  4N79 A;  1TL9 A;  4BS5 A;  4I07 A;  2FRA A;  1HUC B;  3D9W A;  2DC9 A;  2ACT A;  3PBH A;  2AUX A;  1CV8 A;  5CHT A;  4YYU A;  2NQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...