4I04A

Structure of zymogen of cathepsin b1 from schistosoma mansoni
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
315
structure length
304
Chain Sequence
FEPLSDDIISYINEHPNAGWRAEKSNRFHSLDDARIQMGARREEPDLRRTRRPTVDHNDWNVEIPSSFDSRKKWPRCKSIATIRDQSRCGSSWAFGAVEAMSDRSCIQSGGKQNVELSAVDLLSCCESCGLGCEGGILGPAWDYWVKEGIVTGSSKENHAGCEPYPFPKCGSKIYKTPRCKQTCQKKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEAGFTVYEDFLNYKSGIYKHITGETLGGHAIRIIGWGVENKAPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVTAGRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B-like peptidase (C01 family)
publication title Activation route of the Schistosoma mansoni cathepsin B1 drug target: structural map with a glycosaminoglycan switch
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 105
structure length 304
sequence length 315
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2012-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08127 Propeptide_C1 Peptidase family C1 propeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4i04A00
3ERVA 1PIPA 2XU5A 2NQDB 2R9MA 3K24A 1CVZA 2DJGB 3QJ3A 4RY2A 1PCIA 4YYUA 3LXSA 3ZUAA 4YYQA 3IHPA 2FUDA 3OF8A 2NQGA 5F02A 4MZSA 2AVWA 3V6EA 1FH0A 4I07A 2DZZA 1BP4A 3IUTA 1KHQA 1MDWA 1CTEA 1VSNA 3WXEA 1AU3A 3N3KA 1K3BB 1U9WA 3KSEA 2IPPB 1NLJA 2OZ2A 4W5BA 3OVZA 2CIOA 2DZYA 3WXFA 1PPNA 4I04A 1PPOA 1ATKA 4YYVA 3O1GA 1AECA 1CPJA 2FRQA 1X9YA 5EGWA 2DCBA 3IEJA 3N4CA 1F2BA 1MEGA 1YK7A 4N8WA 5PADA 1BY8A 1F2CA 2B1NA 4YYSA 4BPVA 1TU6A 1F29A 2IBIA 2WBFX 2E00A 2G8JA 3GCBA 3HHIA 3MHSA 3V6CA 4G54A 1AU0A 2XU4A 3DF0A 1PBHA 2ACTA 2FO5A 3QSDA 2JQGR 5FPWA 4CZWA 3BWKA 1THEA 2XU3A 4FIPA 3H7DA 4XR7A 1DEUA 1GCBA 2R6NA 1IWDA 2E01A 2HHNA 1CV8A 2YJ8A 1KFUL 2DC8A 1NL6A 4P6GA 4YVAA 3AI8A 1AIMA 5CVMA 5JA7A 3P5WA 1EWMA 2Y5BA 3H8CA 2Y6EA 3E1ZB 3MTNA 2P0RA 3O0UA 3K9MA 2R9NA 4MZOA 1YK8A 1AU2A 2BDZA 3OVXA 1F2AA 2DCDA 4FK5A 2F1GA 2NQAA 3F75A 4PI3A 2R9OA 4QRXA 1EWPA 1CS8A 3KX1A 1AU4A 1ZCMA 2DCCA 4N79A 2CB5A 1BGOA 1CJLA 1U9VA 3H6SA 2E02A 3K8UA 1NB3A 3MHHA 2FQ9A 1CB5A 1MEMA 2NQIA 4CDEB 2DCAA 4P6EA 1PXVA 1QDQA 3KFQA 3OF9A 4CDCB 5J94A 2YJ2A 4FJCA 4X6JA 4QRGA 8PCHA 4PP1A 1JQPA 2YJBA 2AUZA 1Q6KA 4WA6A 1Y4HA 2G8EA 1GECE 4PADA 4W4UA 2FRAA 2G7YA 3CH3X 2OULA 4KLBA 3H8BA 4BS5A 3KWZA 3CBJA 1Y08A 4AXLA 1AYVA 2AYOA 1SP4B 2AYNA 3USVA 1A6RA 3CH2X 3BPFA 4QH6A 1CSBB 2XU1A 1QMYA 4X6IA 2H7JA 2R9FA 5CHTA 3PW3A 1ME4A 3HHAA 1HUCB 1KXRA 5CVNB 4QBBA 1NB5A 3B79A 4YYWA 1AYWA 1U9QX 1CQDA 3BOWA 3QT4A 2ATOA 1GLOA 2AU1A 3RVXA 1NQCA 1DF0A 2FYEA 2OP3A 3N3GA 3KKUA 3S3RA 4Q8HA 3CBKA 2E03A 2FT2A 2PREA 3WXGA 1QXPA 1PE6A 4BSQA 1EWLA 4DMYA 1EF7A 1XKGA 3PDFA 1U5IA 1MS6A 3PBHA 4CDFB 1KFXL 2FTDA 4N4ZA 2YJ9A 3RVVA 3C9EA 2PADA 4X6HA 1NPZA 1U9XA 4I05A 2HH5A 1O0EA 2DC6A 1ITOA 4XUIA 3U8EA 1GMYA 1STFE 2G6DA 1PADA 1S4VA 3OISA 3PNRA 4QRVA 2PBHA 1TL9A 1MHWA 1YALA 4PP2E 6PADA 3M99A 2P86A 2P7UA 3BC3A 1YVBA 1TLOA 3LFYA 1SNKA 1ZIVA 1ME3A 2DC7A 7PCKA 3MORA 3S3QA 4OEMA 4AXMA 2R9CA 1POPA 3I06A 2DJFB 3D6SA 3F5VA 3TNXA 3HD3A 2C0YA 4MSXA 4BS6A 2PNSA 1ICFA 2DC9A 2B1MA 1KHPA 3H89A 9PAPA 3I3TA 3P5UA 3IV2A 1YT7A 2AIMA 3NHEA 2GHUA 1VJVA 5EF4A 1PPPA 3IMAA 4OELA 2F7DA 2YJCA 4YYRA 4HWYA 3P5VA 4DMXA 4W5CA 2VHSA 3BPMA 4Q8GA 1M6DA 2VHFA 2AUXA 4K7CA 5JH3A 5CVOB 1BQIA 3IOQA 1MIRA 1AYUA 1EWOA 4YV8A 3P5XA 2ARYA 5CHVA 3KWBX 5K16A 2JQFR 2AS8A 2HXZA 3RVWA 2GFOA 3HWNA 4ZUXU 3BCNA 1QOLA 2BDLA 1PPDA 3KW9A 4CDDB 2HD5A 4BQVA 5A24A 2O6XA
chains in the Genus database with same CATH superfamily
3ERVA 4BOQA 2FE8A 4RF0A 1PIPA 2XU5A 2NQDB 2R9MA 3K24A 1CVZA 4HXDB 2DJGB 3QJ3A 4RY2A 1PCIA 4YYUA 3LXSA 2Z84A 3ZUAA 4YYQA 3IHPA 2FUDA 3OF8A 4IP3A 2NQGA 5F02A 4MZSA 2AVWA 3V6EA 3BBAA 4OVZB 1FH0A 4I07A 2DZZA 1BP4A 3IUTA 1KHQA 1MDWA 1CTEA 1VSNA 3WXEA 1AU3A 3N3KA 3PT2A 1K3BB 3O65A 1U9WA 3BB7A 3BY4A 3KSEA 3IFUA 4D8BA 2IPPB 1NLJA 2OZ2A 4W5BA 3OVZA 2CIOA 3PRMA 2DZYA 3WXFA 3ZNHA 1PPNA 4I04A 1PPOA 1ATKA 4YYVA 3O1GA 3E9SA 1AECA 1YZBA 1CPJA 2FRQA 1X9YA 5EGWA 2DCBA 3IEJA 3N4CA 1F2BA 1MEGA 1YK7A 4N8WA 4BOZA 4REZA 5PADA 1BY8A 1F2CA 2B1NA 4P16A 4MI7A 4YYSA 4BPVA 1TU6A 1F29A 2IBIA 4BOPA 2WBFX 2E00A 2G8JA 4MM3B 3GCBA 3HHIA 3MHSA 3V6CA 4G54A 5EZQA 1AU0A 2XU4A 3DF0A 1PBHA 2ACTA 4IUMA 2FO5A 3QSDA 2JQGR 5FPWA 4ZTBA 4PT5A 4CZWA 3BWKA 1THEA 2XU3A 4FIPA 3H7DA 4XR7A 1DEUA 1GCBA 2JRIA 1PVJA 2R6NA 1IWDA 2E01A 2HHNA 4A5UA 2DOSA 1CV8A 2YJ8A 1KFUL 2DC8A 1NL6A 4P6GA 4YVAA 3AI8A 1AIMA 5CVMA 5JA7A 3P5WA 1EWMA 2Y5BA 3H8CA 2Y6EA 3E1ZB 3MTNA 2P0RA 3O0UA 3K9MA 2R9NA 4MZOA 1YK8A 1AU2A 2BDZA 3OVXA 1F2AA 2DCDA 4FK5A 2F1GA 2NQAA 3F75A 4PI3A 2R9OA 4QRXA 1EWPA 1CS8A 3KX1A 5JZEA 1AU4A 1ZCMA 2DCCA 4N79A 2CB5A 1BGOA 1CJLA 1U9VA 3H6SA 2E02A 3K8UA 1NB3A 3MHHA 1DKIA 2FQ9A 5EZSA 1CB5A 1MEMA 2NQIA 4CDEB 2DCAA 4P6EA 1PXVA 1QDQA 3KFQA 3OF9A 4CDCB 5J94A 2YJ2A 4FJCA 4X6JA 4QRGA 3MJ5A 8PCHA 4PP1A 1JQPA 2YJBA 2AUZA 1Q6KA 4WA6A 1Y4HA 2BU3A 2G8EA 1GECE 4PADA 4W4UA 2FRAA 2G7YA 4D8IA 3CH3X 3PHXA 2OULA 4KLBA 4D8EA 3H8BA 4BS5A 3KWZA 3CBJA 1Y08A 4AXLA 1AYVA 2AYOA 1SP4B 2AYNA 3USVA 1A6RA 3CH2X 3BPFA 4QH6A 1CSBB 4GUAA 2XU1A 1QMYA 4X6IA 2H7JA 2R9FA 5CHTA 3PW3A 1ME4A 3HHAA 1HUCB 1KXRA 5CVNB 3B21A 4BOSA 5KO3A 4QBBA 1NB5A 3B79A 4YYWA 1AYWA 1U9QX 1CQDA 3BOWA 3QT4A 2ATOA 1GLOA 2AU1A 3TRKA 3RVXA 1NQCA 1DF0A 2FYEA 2OP3A 3N3GA 3KKUA 3S3RA 4Q8HA 3CBKA 2E03A 2FT2A 2PREA 3WXGA 3PRPA 1QXPA 1PE6A 4BSQA 1EWLA 4DMYA 1EF7A 3MTVA 1XKGA 4WURA 2J7QC 3PDFA 1U5IA 4M0WA 1MS6A 3PBHA 4CDFB 4XZXA 4RKXA 1KFXL 2FTDA 4N4ZA 2YJ9A 3RVVA 3C9EA 2PADA 1UKFA 3PHUA 4X6HA 3MP2A 1NPZA 1U9XA 4I05A 2BTWA 1O0EA 2DC6A 2HH5A 1ITOA 4XUIA 3U8EA 1GMYA 1STFE 2G6DA 1PADA 1S4VA 4RF1A 3OISA 3PNRA 4QRVA 2PBHA 1TL9A 1MHWA 3TMPA 1YALA 4PP2E 6PADA 3M99A 2P86A 2P7UA 3W31A 3BC3A 1YVBA 1TLOA 3LFYA 1SNKA 1ZIVA 3OQCA 1ME3A 2DC7A 7PCKA 3MORA 3S3QA 4OEMA 4AXMA 2R9CA 1POPA 3I06A 2DJFB 3D6SA 3F5VA 3TNXA 3HD3A 2C0YA 4MSXA 4BS6A 4OVZA 2PNSA 1ICFA 2DC9A 2JTCA 2B1MA 1KHPA 3H89A 9PAPA 3I3TA 3P5UA 3IV2A 1YT7A 2AIMA 2HWKA 3NHEA 2GHUA 1VJVA 5EF4A 1PPPA 3IMAA 4OELA 2F7DA 2YJCA 4YYRA 4HWYA 4BOUA 3P5VA 4DMXA 4RNAA 4W5CA 2VHSA 3BPMA 4Q8GA 1M6DA 2VHFA 2AUXA 4K7CA 5JH3A 2AGAA 5CVOB 1BQIA 3IOQA 1MIRA 4OW0A 1AYUA 1EWOA 4YV8A 3P5XA 3PHWA 5E6JA 2BTWB 3W30A 2ARYA 5CHVA 3KWBX 3RNVA 5K16A 2JQFR 2AS8A 2HXZA 3RVWA 3C0RA 3HWNA 2GFOA 2UZJA 3BCNA 1QOLA 2BDLA 4ZUXU 2J7QA 1PPDA 3KW9A 4CDDB 2HD5A 4BQVA 5A24A 3PSEA 2O6XA 4R3DA
chains in the Genus database with same CATH topology
3ERVA 4NV8A 1PIPA 2XU5A 2NQDB 2R9MA 3K24A 1CVZA 2DJGB 3QJ3A 4RY2A 1PCIA 4YYUA 3LXSA 3ZUAA 1W6FA 4YYQA 3IHPA 2FUDA 3OF8A 2NQGA 5F02A 4MZSA 2AVWA 3V6EA 1FH0A 4I07A 2DZZA 1BP4A 3IUTA 1KHQA 1MDWA 1CTEA 1VSNA 3WXEA 1AU3A 3N3KA 1K3BB 4GUZA 1U9WA 3KSEA 2IPPB 1NLJA 2OZ2A 4W5BA 3OVZA 2CIOA 2DZYA 3WXFA 1PPNA 4I04A 1PPOA 1ATKA 4YYVA 3O1GA 1AECA 1CPJA 2FRQA 1X9YA 5EGWA 2DCBA 3IEJA 3N4CA 1F2BA 1MEGA 1YK7A 4N8WA 5PADA 1BY8A 1F2CA 2B1NA 2BSZA 4YYSA 4BPVA 1TU6A 1F29A 2IBIA 2WBFX 2E00A 2G8JA 3GCBA 3HHIA 3MHSA 3V6CA 4G54A 1AU0A 2XU4A 3DF0A 1PBHA 2ACTA 1W4TA 2FO5A 3QSDA 2JQGR 5FPWA 4CZWA 3BWKA 1THEA 2XU3A 4FIPA 3H7DA 4XR7A 1DEUA 1GCBA 2R6NA 1IWDA 2E01A 2HHNA 1CV8A 2YJ8A 1KFUL 2DC8A 1NL6A 4P6GA 4YVAA 3AI8A 1AIMA 5CVMA 5JA7A 3P5WA 1EWMA 2Y5BA 3H8CA 2Y6EA 3E1ZB 3MTNA 2P0RA 3O0UA 3K9MA 2R9NA 4MZOA 1YK8A 1AU2A 2BDZA 3OVXA 1F2AA 2DCDA 4FK5A 2F1GA 2NQAA 3F75A 4PI3A 2R9OA 4QRXA 1EWPA 1CS8A 2VFBA 3KX1A 1AU4A 1ZCMA 2DCCA 3D9WA 4N79A 2CB5A 1BGOA 1CJLA 1U9VA 3H6SA 2E02A 3K8UA 1NB3A 3MHHA 2FQ9A 1CB5A 1MEMA 2NQIA 4CDEB 2DCAA 4P6EA 1PXVA 1QDQA 3KFQA 3OF9A 4CDCB 5J94A 2YJ2A 4FJCA 4X6JA 4QRGA 8PCHA 4PP1A 1JQPA 2YJBA 2AUZA 1Q6KA 4WA6A 1Y4HA 2G8EA 1GECE 4PADA 4W4UA 2FRAA 2G7YA 3CH3X 2OULA 4KLBA 3H8BA 4BS5A 3KWZA 3CBJA 1Y08A 4AXLA 1AYVA 2AYOA 1SP4B 2AYNA 3USVA 1A6RA 3CH2X 3BPFA 4QH6A 1CSBB 2XU1A 1QMYA 4X6IA 2H7JA 2R9FA 5CHTA 1E2TA 2VFCA 3PW3A 1ME4A 3HHAA 1HUCB 1KXRA 5CVNB 4QBBA 1NB5A 3B79A 4YYWA 1AYWA 1U9QX 1CQDA 3BOWA 3QT4A 2ATOA 1GLOA 2AU1A 3RVXA 1NQCA 1DF0A 2FYEA 2OP3A 3N3GA 3KKUA 4B55A 3S3RA 4Q8HA 3CBKA 2E03A 2FT2A 2PREA 3WXGA 1QXPA 1PE6A 4BSQA 1EWLA 4DMYA 1EF7A 1XKGA 3PDFA 4C5PA 1W5RA 1U5IA 1MS6A 3PBHA 4CDFB 1KFXL 2FTDA 4N4ZA 2YJ9A 3RVVA 3C9EA 4BGFA 2PADA 4X6HA 3LTWA 1NPZA 1U9XA 4I05A 2HH5A 1O0EA 2DC6A 1ITOA 4XUIA 3U8EA 1GMYA 1STFE 2G6DA 1PADA 1S4VA 3OISA 3PNRA 4QRVA 2PBHA 1TL9A 1MHWA 1YALA 4PP2E 6PADA 3M99A 2P86A 2P7UA 3BC3A 1YVBA 1TLOA 3LFYA 1SNKA 1ZIVA 1ME3A 2DC7A 7PCKA 3MORA 3S3QA 4OEMA 4AXMA 2R9CA 1POPA 3I06A 2DJFB 3D6SA 3F5VA 3TNXA 3HD3A 2C0YA 4MSXA 1GX3A 4BS6A 2PNSA 1ICFA 2DC9A 2B1MA 1KHPA 3H89A 9PAPA 3I3TA 3P5UA 3IV2A 1YT7A 2AIMA 3NHEA 2GHUA 4NV7A 1VJVA 5EF4A 1PPPA 3IMAA 4OELA 2F7DA 2YJCA 4YYRA 4HWYA 3P5VA 4DMXA 4W5CA 2VHSA 3BPMA 4Q8GA 1M6DA 2VHFA 2AUXA 4K7CA 5JH3A 5CVOB 1BQIA 3IOQA 1MIRA 1AYUA 1EWOA 4YV8A 3P5XA 2ARYA 5CHVA 3KWBX 5K16A 2JQFR 2AS8A 2HXZA 3RVWA 2GFOA 3HWNA 4ZUXU 3BCNA 1QOLA 2BDLA 1PPDA 3KW9A 4CDDB 2HD5A 4BQVA 5A24A 2O6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERV A;  1PIP A;  2XU5 A;  2NQD B;  2R9M A;  3K24 A;  1CVZ A;  2DJG B;  3QJ3 A;  4RY2 A;  1PCI A;  4YYU A;  3LXS A;  3ZUA A;  4YYQ A;  3IHP A;  2FUD A;  3OF8 A;  2NQG A;  5F02 A;  4MZS A;  2AVW A;  3V6E A;  1FH0 A;  4I07 A;  2DZZ A;  1BP4 A;  3IUT A;  1KHQ A;  1MDW A;  1CTE A;  1VSN A;  3WXE A;  1AU3 A;  3N3K A;  1K3B B;  1U9W A;  3KSE A;  2IPP B;  1NLJ A;  2OZ2 A;  4W5B A;  3OVZ A;  2CIO A;  2DZY A;  3WXF A;  1PPN A;  4I04 A;  1PPO A;  1ATK A;  4YYV A;  3O1G A;  1AEC A;  1CPJ A;  2FRQ A;  1X9Y A;  5EGW A;  2DCB A;  3IEJ A;  3N4C A;  1F2B A;  1MEG A;  1YK7 A;  4N8W A;  5PAD A;  1BY8 A;  1F2C A;  2B1N A;  4YYS A;  4BPV A;  1TU6 A;  1F29 A;  2IBI A;  2WBF X;  2E00 A;  2G8J A;  3GCB A;  3HHI A;  3MHS A;  3V6C A;  4G54 A;  1AU0 A;  2XU4 A;  3DF0 A;  1PBH A;  2ACT A;  2FO5 A;  3QSD A;  2JQG R;  5FPW A;  4CZW A;  3BWK A;  1THE A;  2XU3 A;  4FIP A;  3H7D A;  4XR7 A;  1DEU A;  1GCB A;  2R6N A;  1IWD A;  2E01 A;  2HHN A;  1CV8 A;  2YJ8 A;  1KFU L;  2DC8 A;  1NL6 A;  4P6G A;  4YVA A;  3AI8 A;  1AIM A;  5CVM A;  5JA7 A;  3P5W A;  1EWM A;  2Y5B A;  3H8C A;  2Y6E A;  3E1Z B;  3MTN A;  2P0R A;  3O0U A;  3K9M A;  2R9N A;  4MZO A;  1YK8 A;  1AU2 A;  2BDZ A;  3OVX A;  1F2A A;  2DCD A;  4FK5 A;  2F1G A;  2NQA A;  3F75 A;  4PI3 A;  2R9O A;  4QRX A;  1EWP A;  1CS8 A;  3KX1 A;  1AU4 A;  1ZCM A;  2DCC A;  4N79 A;  2CB5 A;  1BGO A;  1CJL A;  1U9V A;  3H6S A;  2E02 A;  3K8U A;  1NB3 A;  3MHH A;  2FQ9 A;  1CB5 A;  1MEM A;  2NQI A;  4CDE B;  2DCA A;  4P6E A;  1PXV A;  1QDQ A;  3KFQ A;  3OF9 A;  4CDC B;  5J94 A;  2YJ2 A;  4FJC A;  4X6J A;  4QRG A;  8PCH A;  4PP1 A;  1JQP A;  2YJB A;  2AUZ A;  1Q6K A;  4WA6 A;  1Y4H A;  2G8E A;  1GEC E;  4PAD A;  4W4U A;  2FRA A;  2G7Y A;  3CH3 X;  2OUL A;  4KLB A;  3H8B A;  4BS5 A;  3KWZ A;  3CBJ A;  1Y08 A;  4AXL A;  1AYV A;  2AYO A;  1SP4 B;  2AYN A;  3USV A;  1A6R A;  3CH2 X;  3BPF A;  4QH6 A;  1CSB B;  2XU1 A;  1QMY A;  4X6I A;  2H7J A;  2R9F A;  5CHT A;  3PW3 A;  1ME4 A;  3HHA A;  1HUC B;  1KXR A;  5CVN B;  4QBB A;  1NB5 A;  3B79 A;  4YYW A;  1AYW A;  1U9Q X;  1CQD A;  3BOW A;  3QT4 A;  2ATO A;  1GLO A;  2AU1 A;  3RVX A;  1NQC A;  1DF0 A;  2FYE A;  2OP3 A;  3N3G A;  3KKU A;  3S3R A;  4Q8H A;  3CBK A;  2E03 A;  2FT2 A;  2PRE A;  3WXG A;  1QXP A;  1PE6 A;  4BSQ A;  1EWL A;  4DMY A;  1EF7 A;  1XKG A;  3PDF A;  1U5I A;  1MS6 A;  3PBH A;  4CDF B;  1KFX L;  2FTD A;  4N4Z A;  2YJ9 A;  3RVV A;  3C9E A;  2PAD A;  4X6H A;  1NPZ A;  1U9X A;  4I05 A;  2HH5 A;  1O0E A;  2DC6 A;  1ITO A;  4XUI A;  3U8E A;  1GMY A;  1STF E;  2G6D A;  1PAD A;  1S4V A;  3OIS A;  3PNR A;  4QRV A;  2PBH A;  1TL9 A;  1MHW A;  1YAL A;  4PP2 E;  6PAD A;  3M99 A;  2P86 A;  2P7U A;  3BC3 A;  1YVB A;  1TLO A;  3LFY A;  1SNK A;  1ZIV A;  1ME3 A;  2DC7 A;  7PCK A;  3MOR A;  3S3Q A;  4OEM A;  4AXM A;  2R9C A;  1POP A;  3I06 A;  2DJF B;  3D6S A;  3F5V A;  3TNX A;  3HD3 A;  2C0Y A;  4MSX A;  4BS6 A;  2PNS A;  1ICF A;  2DC9 A;  2B1M A;  1KHP A;  3H89 A;  9PAP A;  3I3T A;  3P5U A;  3IV2 A;  1YT7 A;  2AIM A;  3NHE A;  2GHU A;  1VJV A;  5EF4 A;  1PPP A;  3IMA A;  4OEL A;  2F7D A;  2YJC A;  4YYR A;  4HWY A;  3P5V A;  4DMX A;  4W5C A;  2VHS A;  3BPM A;  4Q8G A;  1M6D A;  2VHF A;  2AUX A;  4K7C A;  5JH3 A;  5CVO B;  1BQI A;  3IOQ A;  1MIR A;  1AYU A;  1EWO A;  4YV8 A;  3P5X A;  2ARY A;  5CHV A;  3KWB X;  5K16 A;  2JQF R;  2AS8 A;  2HXZ A;  3RVW A;  2GFO A;  3HWN A;  4ZUX U;  3BCN A;  1QOL A;  2BDL A;  1PPD A;  3KW9 A;  4CDD B;  2HD5 A;  4BQV A;  5A24 A;  2O6X A; 
#chains in the Genus database with same CATH topology
 3ERV A;  4BOQ A;  2FE8 A;  4RF0 A;  1PIP A;  2XU5 A;  2NQD B;  2R9M A;  3K24 A;  1CVZ A;  4HXD B;  2DJG B;  3QJ3 A;  4RY2 A;  1PCI A;  4YYU A;  3LXS A;  2Z84 A;  3ZUA A;  4YYQ A;  3IHP A;  2FUD A;  3OF8 A;  4IP3 A;  2NQG A;  5F02 A;  4MZS A;  2AVW A;  3V6E A;  3BBA A;  4OVZ B;  1FH0 A;  4I07 A;  2DZZ A;  1BP4 A;  3IUT A;  1KHQ A;  1MDW A;  1CTE A;  1VSN A;  3WXE A;  1AU3 A;  3N3K A;  3PT2 A;  1K3B B;  3O65 A;  1U9W A;  3BB7 A;  3BY4 A;  3KSE A;  3IFU A;  4D8B A;  2IPP B;  1NLJ A;  2OZ2 A;  4W5B A;  3OVZ A;  2CIO A;  3PRM A;  2DZY A;  3WXF A;  3ZNH A;  1PPN A;  4I04 A;  1PPO A;  1ATK A;  4YYV A;  3O1G A;  3E9S A;  1AEC A;  1YZB A;  1CPJ A;  2FRQ A;  1X9Y A;  5EGW A;  2DCB A;  3IEJ A;  3N4C A;  1F2B A;  1MEG A;  1YK7 A;  4N8W A;  4BOZ A;  4REZ A;  5PAD A;  1BY8 A;  1F2C A;  2B1N A;  4P16 A;  4MI7 A;  4YYS A;  4BPV A;  1TU6 A;  1F29 A;  2IBI A;  4BOP A;  2WBF X;  2E00 A;  2G8J A;  4MM3 B;  3GCB A;  3HHI A;  3MHS A;  3V6C A;  4G54 A;  5EZQ A;  1AU0 A;  2XU4 A;  3DF0 A;  1PBH A;  2ACT A;  4IUM A;  2FO5 A;  3QSD A;  2JQG R;  5FPW A;  4ZTB A;  4PT5 A;  4CZW A;  3BWK A;  1THE A;  2XU3 A;  4FIP A;  3H7D A;  4XR7 A;  1DEU A;  1GCB A;  2JRI A;  1PVJ A;  2R6N A;  1IWD A;  2E01 A;  2HHN A;  4A5U A;  2DOS A;  1CV8 A;  2YJ8 A;  1KFU L;  2DC8 A;  1NL6 A;  4P6G A;  4YVA A;  3AI8 A;  1AIM A;  5CVM A;  5JA7 A;  3P5W A;  1EWM A;  2Y5B A;  3H8C A;  2Y6E A;  3E1Z B;  3MTN A;  2P0R A;  3O0U A;  3K9M A;  2R9N A;  4MZO A;  1YK8 A;  1AU2 A;  2BDZ A;  3OVX A;  1F2A A;  2DCD A;  4FK5 A;  2F1G A;  2NQA A;  3F75 A;  4PI3 A;  2R9O A;  4QRX A;  1EWP A;  1CS8 A;  3KX1 A;  5JZE A;  1AU4 A;  1ZCM A;  2DCC A;  4N79 A;  2CB5 A;  1BGO A;  1CJL A;  1U9V A;  3H6S A;  2E02 A;  3K8U A;  1NB3 A;  3MHH A;  1DKI A;  2FQ9 A;  5EZS A;  1CB5 A;  1MEM A;  2NQI A;  4CDE B;  2DCA A;  4P6E A;  1PXV A;  1QDQ A;  3KFQ A;  3OF9 A;  4CDC B;  5J94 A;  2YJ2 A;  4FJC A;  4X6J A;  4QRG A;  3MJ5 A;  8PCH A;  4PP1 A;  1JQP A;  2YJB A;  2AUZ A;  1Q6K A;  4WA6 A;  1Y4H A;  2BU3 A;  2G8E A;  1GEC E;  4PAD A;  4W4U A;  2FRA A;  2G7Y A;  4D8I A;  3CH3 X;  3PHX A;  2OUL A;  4KLB A;  4D8E A;  3H8B A;  4BS5 A;  3KWZ A;  3CBJ A;  1Y08 A;  4AXL A;  1AYV A;  2AYO A;  1SP4 B;  2AYN A;  3USV A;  1A6R A;  3CH2 X;  3BPF A;  4QH6 A;  1CSB B;  4GUA A;  2XU1 A;  1QMY A;  4X6I A;  2H7J A;  2R9F A;  5CHT A;  3PW3 A;  1ME4 A;  3HHA A;  1HUC B;  1KXR A;  5CVN B;  3B21 A;  4BOS A;  5KO3 A;  4QBB A;  1NB5 A;  3B79 A;  4YYW A;  1AYW A;  1U9Q X;  1CQD A;  3BOW A;  3QT4 A;  2ATO A;  1GLO A;  2AU1 A;  3TRK A;  3RVX A;  1NQC A;  1DF0 A;  2FYE A;  2OP3 A;  3N3G A;  3KKU A;  3S3R A;  4Q8H A;  3CBK A;  2E03 A;  2FT2 A;  2PRE A;  3WXG A;  3PRP A;  1QXP A;  1PE6 A;  4BSQ A;  1EWL A;  4DMY A;  1EF7 A;  3MTV A;  1XKG A;  4WUR A;  2J7Q C;  3PDF A;  1U5I A;  4M0W A;  1MS6 A;  3PBH A;  4CDF B;  4XZX A;  4RKX A;  1KFX L;  2FTD A;  4N4Z A;  2YJ9 A;  3RVV A;  3C9E A;  2PAD A;  1UKF A;  3PHU A;  4X6H A;  3MP2 A;  1NPZ A;  1U9X A;  4I05 A;  2BTW A;  1O0E A;  2DC6 A;  2HH5 A;  1ITO A;  4XUI A;  3U8E A;  1GMY A;  1STF E;  2G6D A;  1PAD A;  1S4V A;  4RF1 A;  3OIS A;  3PNR A;  4QRV A;  2PBH A;  1TL9 A;  1MHW A;  3TMP A;  1YAL A;  4PP2 E;  6PAD A;  3M99 A;  2P86 A;  2P7U A;  3W31 A;  3BC3 A;  1YVB A;  1TLO A;  3LFY A;  1SNK A;  1ZIV A;  3OQC A;  1ME3 A;  2DC7 A;  7PCK A;  3MOR A;  3S3Q A;  4OEM A;  4AXM A;  2R9C A;  1POP A;  3I06 A;  2DJF B;  3D6S A;  3F5V A;  3TNX A;  3HD3 A;  2C0Y A;  4MSX A;  4BS6 A;  4OVZ A;  2PNS A;  1ICF A;  2DC9 A;  2JTC A;  2B1M A;  1KHP A;  3H89 A;  9PAP A;  3I3T A;  3P5U A;  3IV2 A;  1YT7 A;  2AIM A;  2HWK A;  3NHE A;  2GHU A;  1VJV A;  5EF4 A;  1PPP A;  3IMA A;  4OEL A;  2F7D A;  2YJC A;  4YYR A;  4HWY A;  4BOU A;  3P5V A;  4DMX A;  4RNA A;  4W5C A;  2VHS A;  3BPM A;  4Q8G A;  1M6D A;  2VHF A;  2AUX A;  4K7C A;  5JH3 A;  2AGA A;  5CVO B;  1BQI A;  3IOQ A;  1MIR A;  4OW0 A;  1AYU A;  1EWO A;  4YV8 A;  3P5X A;  3PHW A;  5E6J A;  2BTW B;  3W30 A;  2ARY A;  5CHV A;  3KWB X;  3RNV A;  5K16 A;  2JQF R;  2AS8 A;  2HXZ A;  3RVW A;  3C0R A;  3HWN A;  2GFO A;  2UZJ A;  3BCN A;  1QOL A;  2BDL A;  4ZUX U;  2J7Q A;  1PPD A;  3KW9 A;  4CDD B;  2HD5 A;  4BQV A;  5A24 A;  3PSE A;  2O6X A;  4R3D A; 
#chains in the Genus database with same CATH homology
 3ERV A;  4NV8 A;  1PIP A;  2XU5 A;  2NQD B;  2R9M A;  3K24 A;  1CVZ A;  2DJG B;  3QJ3 A;  4RY2 A;  1PCI A;  4YYU A;  3LXS A;  3ZUA A;  1W6F A;  4YYQ A;  3IHP A;  2FUD A;  3OF8 A;  2NQG A;  5F02 A;  4MZS A;  2AVW A;  3V6E A;  1FH0 A;  4I07 A;  2DZZ A;  1BP4 A;  3IUT A;  1KHQ A;  1MDW A;  1CTE A;  1VSN A;  3WXE A;  1AU3 A;  3N3K A;  1K3B B;  4GUZ A;  1U9W A;  3KSE A;  2IPP B;  1NLJ A;  2OZ2 A;  4W5B A;  3OVZ A;  2CIO A;  2DZY A;  3WXF A;  1PPN A;  4I04 A;  1PPO A;  1ATK A;  4YYV A;  3O1G A;  1AEC A;  1CPJ A;  2FRQ A;  1X9Y A;  5EGW A;  2DCB A;  3IEJ A;  3N4C A;  1F2B A;  1MEG A;  1YK7 A;  4N8W A;  5PAD A;  1BY8 A;  1F2C A;  2B1N A;  2BSZ A;  4YYS A;  4BPV A;  1TU6 A;  1F29 A;  2IBI A;  2WBF X;  2E00 A;  2G8J A;  3GCB A;  3HHI A;  3MHS A;  3V6C A;  4G54 A;  1AU0 A;  2XU4 A;  3DF0 A;  1PBH A;  2ACT A;  1W4T A;  2FO5 A;  3QSD A;  2JQG R;  5FPW A;  4CZW A;  3BWK A;  1THE A;  2XU3 A;  4FIP A;  3H7D A;  4XR7 A;  1DEU A;  1GCB A;  2R6N A;  1IWD A;  2E01 A;  2HHN A;  1CV8 A;  2YJ8 A;  1KFU L;  2DC8 A;  1NL6 A;  4P6G A;  4YVA A;  3AI8 A;  1AIM A;  5CVM A;  5JA7 A;  3P5W A;  1EWM A;  2Y5B A;  3H8C A;  2Y6E A;  3E1Z B;  3MTN A;  2P0R A;  3O0U A;  3K9M A;  2R9N A;  4MZO A;  1YK8 A;  1AU2 A;  2BDZ A;  3OVX A;  1F2A A;  2DCD A;  4FK5 A;  2F1G A;  2NQA A;  3F75 A;  4PI3 A;  2R9O A;  4QRX A;  1EWP A;  1CS8 A;  2VFB A;  3KX1 A;  1AU4 A;  1ZCM A;  2DCC A;  3D9W A;  4N79 A;  2CB5 A;  1BGO A;  1CJL A;  1U9V A;  3H6S A;  2E02 A;  3K8U A;  1NB3 A;  3MHH A;  2FQ9 A;  1CB5 A;  1MEM A;  2NQI A;  4CDE B;  2DCA A;  4P6E A;  1PXV A;  1QDQ A;  3KFQ A;  3OF9 A;  4CDC B;  5J94 A;  2YJ2 A;  4FJC A;  4X6J A;  4QRG A;  8PCH A;  4PP1 A;  1JQP A;  2YJB A;  2AUZ A;  1Q6K A;  4WA6 A;  1Y4H A;  2G8E A;  1GEC E;  4PAD A;  4W4U A;  2FRA A;  2G7Y A;  3CH3 X;  2OUL A;  4KLB A;  3H8B A;  4BS5 A;  3KWZ A;  3CBJ A;  1Y08 A;  4AXL A;  1AYV A;  2AYO A;  1SP4 B;  2AYN A;  3USV A;  1A6R A;  3CH2 X;  3BPF A;  4QH6 A;  1CSB B;  2XU1 A;  1QMY A;  4X6I A;  2H7J A;  2R9F A;  5CHT A;  1E2T A;  2VFC A;  3PW3 A;  1ME4 A;  3HHA A;  1HUC B;  1KXR A;  5CVN B;  4QBB A;  1NB5 A;  3B79 A;  4YYW A;  1AYW A;  1U9Q X;  1CQD A;  3BOW A;  3QT4 A;  2ATO A;  1GLO A;  2AU1 A;  3RVX A;  1NQC A;  1DF0 A;  2FYE A;  2OP3 A;  3N3G A;  3KKU A;  4B55 A;  3S3R A;  4Q8H A;  3CBK A;  2E03 A;  2FT2 A;  2PRE A;  3WXG A;  1QXP A;  1PE6 A;  4BSQ A;  1EWL A;  4DMY A;  1EF7 A;  1XKG A;  3PDF A;  4C5P A;  1W5R A;  1U5I A;  1MS6 A;  3PBH A;  4CDF B;  1KFX L;  2FTD A;  4N4Z A;  2YJ9 A;  3RVV A;  3C9E A;  4BGF A;  2PAD A;  4X6H A;  3LTW A;  1NPZ A;  1U9X A;  4I05 A;  2HH5 A;  1O0E A;  2DC6 A;  1ITO A;  4XUI A;  3U8E A;  1GMY A;  1STF E;  2G6D A;  1PAD A;  1S4V A;  3OIS A;  3PNR A;  4QRV A;  2PBH A;  1TL9 A;  1MHW A;  1YAL A;  4PP2 E;  6PAD A;  3M99 A;  2P86 A;  2P7U A;  3BC3 A;  1YVB A;  1TLO A;  3LFY A;  1SNK A;  1ZIV A;  1ME3 A;  2DC7 A;  7PCK A;  3MOR A;  3S3Q A;  4OEM A;  4AXM A;  2R9C A;  1POP A;  3I06 A;  2DJF B;  3D6S A;  3F5V A;  3TNX A;  3HD3 A;  2C0Y A;  4MSX A;  1GX3 A;  4BS6 A;  2PNS A;  1ICF A;  2DC9 A;  2B1M A;  1KHP A;  3H89 A;  9PAP A;  3I3T A;  3P5U A;  3IV2 A;  1YT7 A;  2AIM A;  3NHE A;  2GHU A;  4NV7 A;  1VJV A;  5EF4 A;  1PPP A;  3IMA A;  4OEL A;  2F7D A;  2YJC A;  4YYR A;  4HWY A;  3P5V A;  4DMX A;  4W5C A;  2VHS A;  3BPM A;  4Q8G A;  1M6D A;  2VHF A;  2AUX A;  4K7C A;  5JH3 A;  5CVO B;  1BQI A;  3IOQ A;  1MIR A;  1AYU A;  1EWO A;  4YV8 A;  3P5X A;  2ARY A;  5CHV A;  3KWB X;  5K16 A;  2JQF R;  2AS8 A;  2HXZ A;  3RVW A;  2GFO A;  3HWN A;  4ZUX U;  3BCN A;  1QOL A;  2BDL A;  1PPD A;  3KW9 A;  4CDD B;  2HD5 A;  4BQV A;  5A24 A;  2O6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...