3B21A

Crystal structure of ospi from shigella flexineri
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
192
Chain Sequence
b'NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNCSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Unknown function
total genus 61
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3b21A00
4XZXA 3B21A 3W30A 3W31A 4IP3A
chains in the Genus database with same CATH superfamily
3P5XA 4AXLA 5PADA 3U8EA 1MS6A 1YVBA 3KW9A 4WA6A 2AYNA 2E02A 1U9QX 1UKFA 2DZZA 2IBIA 2FTDA 1BGOA 4PI3A 2E01A 3CBJA 4KLBA 4K7CA 5EZSA 4PT5A 1DEUA 1ICFA 2E00A 2OULA 1EWOA 2JQGR 3LFYA 2HD5A 4QRVA 4RF1A 1KFUL 4XUIA 4CDCB 4N8WA 5F02A 1AYWA 4YV8A 3H8BA 2AIMA 1TL9A 4BOSA 1F2BA 2YJ9A 1MDWA 3ZUAA 2IPPB 4I05A 2XU3A 3AI8A 1MIRA 1SP4B 3BWKA 4PADA 1JQPA 1YALA 3TMPA 2DC7A 2XU5A 3LXSA 1S4VA 1ATKA 4I04A 4W4UA 1U5IA 3WXGA 2ATOA 3IOQA 2BTWB 4OW0A 1CPJA 5CVNB 1O0EA 5A24A 4X6HA 1EWLA 3PW3A 3I3TA 1Y4HA 4W5CA 1Q6KA 1EF7A 4YVAA 2BDLA 3ZNHA 2F7DA 3IV2A 2Y5BA 2FO5A 4YYVA 4BOPA 3H8CA 2AS8A 1AU4A 2HHNA 2R6NA 4FIPA 2DCDA 2ACTA 2O6XA 3USVA 1PPOA 5E6JA 2AUXA 3K8UA 1F2AA 2UZJA 4RNAA 2FRAA 3PHWA 1PIPA 1TU6A 5K16A 3PBHA 4X6JA 4M0WA 5CVOB 2DCCA 1YK8A 2R9FA 4QRGA 1F29A 3H7DA 1CQDA 4MI7A 1ITOA 2P0RA 3C0RA 4ZUXU 4CDDB 4D8EA 4XZXA 8PCHA 1TLOA 1PPNA 3CH2X 1STFE 2AGAA 1AYVA 4REZA 2DC6A 3W31A 3WXEA 3MHSA 4YYUA 2F1GA 1X9YA 5EF4A 1YK7A 1BP4A 2FRQA 2H7JA 2YJCA 1NLJA 3E1ZB 1KXRA 2JTCA 2R9NA 1CV8A 2P86A 2PBHA 5EZQA 1YZBA 3O65A 4R3DA 1AU3A 1ME3A 4QRXA 2YJ2A 2B1NA 4W5BA 4BSQA 1QXPA 2BDZA 2G8JA 3KWBX 3C9EA 3BY4A 3N3GA 1AU0A 3CH3X 3BPMA 2GFOA 3I06A 4IUMA 4OVZA 3OVXA 2XU1A 4IP3A 4XR7A 4RF0A 3DF0A 3MP2A 1QMYA 3BOWA 3MTNA 2DJGB 4WURA 2AU1A 3IEJA 4RY2A 4RKXA 4QBBA 2J7QA 2FYEA 4ZTBA 4DMXA 3N4CA 4CDEB 4D8IA 2DOSA 3PRPA 3MTVA 6PADA 3OVZA 5CVMA 3PHXA 3M99A 4N79A 3RNVA 2NQAA 1CJLA 1U9WA 1GLOA 1PCIA 2OP3A 2BU3A 1A6RA 3OISA 3ERVA 1M6DA 2Y6EA 3MJ5A 2R9MA 3NHEA 2AUZA 1QOLA 2J7QC 1KHQA 2FT2A 4PP2E 3PNRA 4BOUA 3IHPA 3QSDA 3PSEA 5FPWA 4BS5A 3BB7A 2YJBA 3B79A 3IUTA 2AVWA 2GHUA 3PRMA 3P5VA 3BCNA 3HD3A 4P6EA 3H6SA 2ARYA 1PVJA 2Z84A 3QT4A 4GUAA 1NQCA 1IWDA 1U9VA 4CDFB 1CVZA 3IFUA 1NL6A 3PHUA 2G8EA 3HHAA 4P6GA 2DZYA 3RVXA 3TRKA 4FK5A 4Q8GA 3TNXA 1GMYA 3F75A 1ZIVA 4N4ZA 4HXDB 1YT7A 4PP1A 1HUCB 3P5UA 3PDFA 3QJ3A 4D8BA 1DF0A 4OVZB 1SNKA 4MSXA 3V6CA 3RVVA 1VSNA 2JQFR 3N3KA 3OF9A 4BS6A 4MZSA 3MHHA 9PAPA 3RVWA 3OQCA 5JZEA 2FUDA 4HWYA 2B1MA 1BQIA 1U9XA 2DCBA 3D6SA 5EGWA 4YYWA 3KFQA 3B21A 2DJFB 1XKGA 4MM3B 4OEMA 1PBHA 3BBAA 2VHSA 2DCAA 3PT2A 2PREA 3H89A 2YJ8A 3O0UA 1CB5A 1ZCMA 1ME4A 2WBFX 4Q8HA 1BY8A 4X6IA 1PADA 4AXMA 4G54A 2DC9A 2FQ9A 3MORA 2C0YA 3K24A 3KSEA 2PNSA 1NB3A 5JA7A 3IMAA 3BC3A 1QDQA 2PADA 2VHFA 4YYRA 1CSBB 3W30A 2HH5A 4DMYA 2R9OA 2AYOA 3BPFA 1GCBA 1MHWA 1NB5A 3KWZA 1VJVA 1DKIA 1Y08A 4YYQA 1MEGA 1CTEA 3V6EA 2DC8A 1KFXL 1EWMA 3KX1A 1EWPA 3S3QA 1POPA 4QH6A 2P7UA 3CBKA 1AIMA 1THEA 5J94A 3O1GA 4BPVA 2OZ2A 5CHVA 1GECE 3K9MA 4OELA 3GCBA 2HXZA 4MZOA 2CB5A 1AU2A 1F2CA 3HHIA 1PPPA 4BOQA 1PE6A 2BTWA 2R9CA 2G6DA 4BOZA 7PCKA 2NQIA 5KO3A 4CZWA 2JRIA 1FH0A 3F5VA 1AYUA 2FE8A 1PPDA 2XU4A 2HWKA 2CIOA 5JH3A 4YYSA 1CS8A 3S3RA 4BQVA 4FJCA 1K3BB 5CHTA 1MEMA 1AECA 1NPZA 3P5WA 3E9SA 3OF8A 4I07A 4P16A 3WXFA 1KHPA 2NQDB 3KKUA 3HWNA 1PXVA 2G7YA 2NQGA 4A5UA 2E03A
chains in the Genus database with same CATH topology
2BU3A 4M0WA 4MI7A 1UKFA 3MJ5A 3C0RA 4D8EA 4XZXA 3W30A 2J7QC 5EZSA 4PT5A 2AGAA 4BOUA 4REZA 3W31A 4RF1A 3PSEA 3BB7A 1DKIA 3PRMA 4BOSA 1PVJA 2Z84A 4GUAA 2JTCA 3IFUA 3PHUA 5EZQA 3TRKA 3TMPA 1YZBA 3O65A 4R3DA 4HXDB 3BY4A 4D8BA 4OVZB 2BTWB 4OW0A 4IUMA 4OVZA 4BOQA 2BTWA 4IP3A 4BOZA 4RF0A 3MP2A 5KO3A 3OQCA 5JZEA 4WURA 3ZNHA 2JRIA 2FE8A 4RKXA 4BOPA 2J7QA 2HWKA 4ZTBA 3B21A 4D8IA 2DOSA 3PRPA 4MM3B 3BBAA 3MTVA 3PT2A 5E6JA 3E9SA 2UZJA 4P16A 4RNAA 3PHWA 3PHXA 3RNVA 4A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZX A;  3B21 A;  3W30 A;  3W31 A;  4IP3 A; 
#chains in the Genus database with same CATH topology
 3P5X A;  4AXL A;  5PAD A;  3U8E A;  1MS6 A;  1YVB A;  3KW9 A;  4WA6 A;  2AYN A;  2E02 A;  1U9Q X;  1UKF A;  2DZZ A;  2IBI A;  2FTD A;  1BGO A;  4PI3 A;  2E01 A;  3CBJ A;  4KLB A;  4K7C A;  5EZS A;  4PT5 A;  1DEU A;  1ICF A;  2E00 A;  2OUL A;  1EWO A;  2JQG R;  3LFY A;  2HD5 A;  4QRV A;  4RF1 A;  1KFU L;  4XUI A;  4CDC B;  4N8W A;  5F02 A;  1AYW A;  4YV8 A;  3H8B A;  2AIM A;  1TL9 A;  4BOS A;  1F2B A;  2YJ9 A;  1MDW A;  3ZUA A;  2IPP B;  4I05 A;  2XU3 A;  3AI8 A;  1MIR A;  1SP4 B;  3BWK A;  4PAD A;  1JQP A;  1YAL A;  3TMP A;  2DC7 A;  2XU5 A;  3LXS A;  1S4V A;  1ATK A;  4I04 A;  4W4U A;  1U5I A;  3WXG A;  2ATO A;  3IOQ A;  2BTW B;  4OW0 A;  1CPJ A;  5CVN B;  1O0E A;  5A24 A;  4X6H A;  1EWL A;  3PW3 A;  3I3T A;  1Y4H A;  4W5C A;  1Q6K A;  1EF7 A;  4YVA A;  2BDL A;  3ZNH A;  2F7D A;  3IV2 A;  2Y5B A;  2FO5 A;  4YYV A;  4BOP A;  3H8C A;  2AS8 A;  1AU4 A;  2HHN A;  2R6N A;  4FIP A;  2DCD A;  2ACT A;  2O6X A;  3USV A;  1PPO A;  5E6J A;  2AUX A;  3K8U A;  1F2A A;  2UZJ A;  4RNA A;  2FRA A;  3PHW A;  1PIP A;  1TU6 A;  5K16 A;  3PBH A;  4X6J A;  4M0W A;  5CVO B;  2DCC A;  1YK8 A;  2R9F A;  4QRG A;  1F29 A;  3H7D A;  1CQD A;  4MI7 A;  1ITO A;  2P0R A;  3C0R A;  4ZUX U;  4CDD B;  4D8E A;  4XZX A;  8PCH A;  1TLO A;  1PPN A;  3CH2 X;  1STF E;  2AGA A;  1AYV A;  4REZ A;  2DC6 A;  3W31 A;  3WXE A;  3MHS A;  4YYU A;  2F1G A;  1X9Y A;  5EF4 A;  1YK7 A;  1BP4 A;  2FRQ A;  2H7J A;  2YJC A;  1NLJ A;  3E1Z B;  1KXR A;  2JTC A;  2R9N A;  1CV8 A;  2P86 A;  2PBH A;  5EZQ A;  1YZB A;  3O65 A;  4R3D A;  1AU3 A;  1ME3 A;  4QRX A;  2YJ2 A;  2B1N A;  4W5B A;  4BSQ A;  1QXP A;  2BDZ A;  2G8J A;  3KWB X;  3C9E A;  3BY4 A;  3N3G A;  1AU0 A;  3CH3 X;  3BPM A;  2GFO A;  3I06 A;  4IUM A;  4OVZ A;  3OVX A;  2XU1 A;  4IP3 A;  4XR7 A;  4RF0 A;  3DF0 A;  3MP2 A;  1QMY A;  3BOW A;  3MTN A;  2DJG B;  4WUR A;  2AU1 A;  3IEJ A;  4RY2 A;  4RKX A;  4QBB A;  2J7Q A;  2FYE A;  4ZTB A;  4DMX A;  3N4C A;  4CDE B;  4D8I A;  2DOS A;  3PRP A;  3MTV A;  6PAD A;  3OVZ A;  5CVM A;  3PHX A;  3M99 A;  4N79 A;  3RNV A;  2NQA A;  1CJL A;  1U9W A;  1GLO A;  1PCI A;  2OP3 A;  2BU3 A;  1A6R A;  3OIS A;  3ERV A;  1M6D A;  2Y6E A;  3MJ5 A;  2R9M A;  3NHE A;  2AUZ A;  1QOL A;  2J7Q C;  1KHQ A;  2FT2 A;  4PP2 E;  3PNR A;  4BOU A;  3IHP A;  3QSD A;  3PSE A;  5FPW A;  4BS5 A;  3BB7 A;  2YJB A;  3B79 A;  3IUT A;  2AVW A;  2GHU A;  3PRM A;  3P5V A;  3BCN A;  3HD3 A;  4P6E A;  3H6S A;  2ARY A;  1PVJ A;  2Z84 A;  3QT4 A;  4GUA A;  1NQC A;  1IWD A;  1U9V A;  4CDF B;  1CVZ A;  3IFU A;  1NL6 A;  3PHU A;  2G8E A;  3HHA A;  4P6G A;  2DZY A;  3RVX A;  3TRK A;  4FK5 A;  4Q8G A;  3TNX A;  1GMY A;  3F75 A;  1ZIV A;  4N4Z A;  4HXD B;  1YT7 A;  4PP1 A;  1HUC B;  3P5U A;  3PDF A;  3QJ3 A;  4D8B A;  1DF0 A;  4OVZ B;  1SNK A;  4MSX A;  3V6C A;  3RVV A;  1VSN A;  2JQF R;  3N3K A;  3OF9 A;  4BS6 A;  4MZS A;  3MHH A;  9PAP A;  3RVW A;  3OQC A;  5JZE A;  2FUD A;  4HWY A;  2B1M A;  1BQI A;  1U9X A;  2DCB A;  3D6S A;  5EGW A;  4YYW A;  3KFQ A;  3B21 A;  2DJF B;  1XKG A;  4MM3 B;  4OEM A;  1PBH A;  3BBA A;  2VHS A;  2DCA A;  3PT2 A;  2PRE A;  3H89 A;  2YJ8 A;  3O0U A;  1CB5 A;  1ZCM A;  1ME4 A;  2WBF X;  4Q8H A;  1BY8 A;  4X6I A;  1PAD A;  4AXM A;  4G54 A;  2DC9 A;  2FQ9 A;  3MOR A;  2C0Y A;  3K24 A;  3KSE A;  2PNS A;  1NB3 A;  5JA7 A;  3IMA A;  3BC3 A;  1QDQ A;  2PAD A;  2VHF A;  4YYR A;  1CSB B;  3W30 A;  2HH5 A;  4DMY A;  2R9O A;  2AYO A;  3BPF A;  1GCB A;  1MHW A;  1NB5 A;  3KWZ A;  1VJV A;  1DKI A;  1Y08 A;  4YYQ A;  1MEG A;  1CTE A;  3V6E A;  2DC8 A;  1KFX L;  1EWM A;  3KX1 A;  1EWP A;  3S3Q A;  1POP A;  4QH6 A;  2P7U A;  3CBK A;  1AIM A;  1THE A;  5J94 A;  3O1G A;  4BPV A;  2OZ2 A;  5CHV A;  1GEC E;  3K9M A;  4OEL A;  3GCB A;  2HXZ A;  4MZO A;  2CB5 A;  1AU2 A;  1F2C A;  3HHI A;  1PPP A;  4BOQ A;  1PE6 A;  2BTW A;  2R9C A;  2G6D A;  4BOZ A;  7PCK A;  2NQI A;  5KO3 A;  4CZW A;  2JRI A;  1FH0 A;  3F5V A;  1AYU A;  2FE8 A;  1PPD A;  2XU4 A;  2HWK A;  2CIO A;  5JH3 A;  4YYS A;  1CS8 A;  3S3R A;  4BQV A;  4FJC A;  1K3B B;  5CHT A;  1MEM A;  1AEC A;  1NPZ A;  3P5W A;  3E9S A;  3OF8 A;  4I07 A;  4P16 A;  3WXF A;  1KHP A;  2NQD B;  3KKU A;  3HWN A;  1PXV A;  2G7Y A;  2NQG A;  4A5U A;  2E03 A; 
#chains in the Genus database with same CATH homology
 2BU3 A;  4M0W A;  4MI7 A;  1UKF A;  3MJ5 A;  3C0R A;  4D8E A;  4XZX A;  3W30 A;  2J7Q C;  5EZS A;  4PT5 A;  2AGA A;  4BOU A;  4REZ A;  3W31 A;  4RF1 A;  3PSE A;  3BB7 A;  1DKI A;  3PRM A;  4BOS A;  1PVJ A;  2Z84 A;  4GUA A;  2JTC A;  3IFU A;  3PHU A;  5EZQ A;  3TRK A;  3TMP A;  1YZB A;  3O65 A;  4R3D A;  4HXD B;  3BY4 A;  4D8B A;  4OVZ B;  2BTW B;  4OW0 A;  4IUM A;  4OVZ A;  4BOQ A;  2BTW A;  4IP3 A;  4BOZ A;  4RF0 A;  3MP2 A;  5KO3 A;  3OQC A;  5JZE A;  4WUR A;  3ZNH A;  2JRI A;  2FE8 A;  4RKX A;  4BOP A;  2J7Q A;  2HWK A;  4ZTB A;  3B21 A;  4D8I A;  2DOS A;  3PRP A;  4MM3 B;  3BBA A;  3MTV A;  3PT2 A;  5E6J A;  3E9S A;  2UZJ A;  4P16 A;  4RNA A;  3PHW A;  3PHX A;  3RNV A;  4A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...