3B21A

Crystal structure of ospi from shigella flexineri
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNCSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Unknown function
molecule keywords ORF169b
total genus 61
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3b21A00
4XZXA 3W31A 3B21A 3W30A 4IP3A
chains in the Genus database with same CATH superfamily
3MP2A 5EF4A 1YK7A 1CVZA 3MHHA 2JQGR 3QT4A 4YYRA 2BU3A 1AU3A 2NQGA 3H8BA 4BOSA 1IWDA 4CDDB 1PXVA 1AYWA 3WXGA 1AIMA 3BB7A 3GCBA 4RKXA 2AYOA 1BGOA 1U9VA 3H8CA 4RNAA 3P5XA 4QBBA 1CB5A 4FK5A 1TLOA 2DZYA 1PE6A 1Y08A 2AUZA 2GFOA 2DJGB 2OULA 1AYUA 3RVXA 2AS8A 1SNKA 3PNRA 2HHNA 3OVZA 3KFQA 3E9SA 4BOPA 1A6RA 2C0YA 1EWPA 2DC9A 1BY8A 5CVOB 5EZQA 3MORA 2PBHA 3U8EA 4ZUXU 3IMAA 2FUDA 3CH3X 4MZOA 4QH6A 4WA6A 1YZBA 2AUXA 2DCDA 1MS6A 3D6SA 4XR7A 1YK8A 3B79A 4ZTBA 3ZUAA 3H89A 5CHTA 4P6EA 4CZWA 3KKUA 3BOWA 4BPVA 3DF0A 3IUTA 4QRXA 4I07A 3E1ZB 4BOQA 2Y5BA 2XU5A 2YJBA 4Q8GA 2AVWA 3BCNA 3TRKA 1KFXL 4YYVA 2G6DA 3CH2X 2DCBA 1DKIA 1F29A 1KXRA 3IFUA 1MHWA 4PT5A 3IEJA 1NQCA 3P5UA 4D8BA 4BS6A 4BSQA 3PRPA 3BC3A 3N3GA 3PBHA 1VJVA 4GUAA 1O0EA 4W5CA 5JA7A 8PCHA 2IBIA 3IHPA 4YYQA 3OVXA 1CTEA 2BDZA 1MDWA 2Y6EA 5FPWA 1EF7A 1Y4HA 4BQVA 2P7UA 4FIPA 3P5WA 3KX1A 2E01A 2UZJA 4FJCA 2PADA 2YJ8A 1MIRA 5CVMA 4R3DA 1YT7A 3PHUA 4DMXA 1QMYA 1CS8A 1BP4A 1F2BA 1ZIVA 2HD5A 3HHIA 1YVBA 1F2AA 2DCAA 3CBJA 2DC8A 4PP1A 1AECA 1FH0A 1GMYA 3S3RA 1U9XA 5KO3A 4DMYA 3V6CA 1CQDA 4KLBA 1NB5A 1PIPA 2FRQA 4YYUA 4P6GA 3PW3A 4MZSA 1PADA 1QXPA 3H6SA 4XZXA 2Z84A 3K8UA 3MHSA 2HWKA 3WXEA 3IOQA 1U5IA 3N4CA 3S3QA 3USVA 2JTCA 4MI7A 3HHAA 4XUIA 4X6HA 1ITOA 3IV2A 1NB3A 2FT2A 4HWYA 4A5UA 3CBKA 2VHFA 4QRVA 2J7QA 3MJ5A 1CV8A 4W5BA 4IUMA 2R9OA 3PSEA 4YV8A 2NQIA 3MTNA 4HXDB 2FQ9A 3PDFA 2OZ2A 4I05A 1PPNA 3BBAA 3LXSA 1U9QX 1PCIA 2AIMA 4OW0A 4WURA 2J7QC 4D8EA 5E6JA 1TL9A 3AI8A 1UKFA 5F02A 2YJ2A 1VSNA 2DZZA 4REZA 3C0RA 2FRAA 2FTDA 1CSBB 1M6DA 5JZEA 1ICFA 1TU6A 4OELA 2R9MA 2R9FA 3TMPA 2CB5A 3I3TA 1CPJA 4X6JA 3BY4A 1PPOA 1POPA 7PCKA 2B1MA 3B21A 4G54A 3BWKA 3BPMA 2FYEA 3O0UA 3ZNHA 2DC7A 1Q6KA 1AU2A 4N79A 3W30A 1DEUA 3WXFA 2ARYA 2CIOA 2OP3A 4YYWA 4PP2E 1EWOA 3M99A 1PPPA 1ME4A 1CJLA 2P0RA 3F75A 3KSEA 4CDFB 3TNXA 4N8WA 2NQDB 1QDQA 5CVNB 1PPDA 4AXMA 1GECE 3N3KA 2R6NA 1THEA 2PNSA 2PREA 4PI3A 1PVJA 3RVWA 2HXZA 2G8JA 3F5VA 3KWBX 4RY2A 3PHWA 3OQCA 1SP4B 5CHVA 4I04A 2E03A 2XU1A 2DCCA 2VHSA 1ATKA 2NQAA 4N4ZA 1NL6A 1MEMA 2DOSA 3ERVA 3MTVA 4D8IA 3K24A 4RF0A 1ZCMA 3RNVA 1AU4A 1DF0A 3K9MA 2AU1A 4AXLA 5JH3A 3PT2A 4CDEB 4MSXA 3KW9A 1S4VA 4OVZA 4OVZB 1MEGA 1QOLA 3I06A 4P16A 1YALA 2FE8A 1AU0A 3O1GA 1K3BB 2FO5A 3KWZA 2IPPB 3BPFA 3HWNA 1JQPA 2YJ9A 1KHQA 3PHXA 4IP3A 6PADA 2BTWB 1PBHA 2BTWA 4RF1A 3W31A 1NPZA 2F7DA 2XU3A 2AGAA 2AYNA 4YVAA 1U9WA 4MM3B 4YYSA 2G7YA 2XU4A 5PADA 1NLJA 5EZSA 2R9NA 2YJCA 5J94A 3C9EA 4BS5A 3OISA 4QRGA 1EWMA 2JQFR 2DJFB 3P5VA 1BQIA 2O6XA 2R9CA 2E02A 3O65A 4Q8HA 4X6IA 2B1NA 3LFYA 1F2CA 1AYVA 1KHPA 1XKGA 2BDLA 4K7CA 2HH5A 2WBFX 3NHEA 1GLOA 2G8EA 2H7JA 2JRIA 4PADA 2P86A 2DC6A 2GHUA 4BOUA 3V6EA 1HUCB 3QJ3A 3HD3A 3H7DA 1GCBA 3RVVA 1STFE 1X9YA 1EWLA 1ME3A 3OF8A 5K16A 4BOZA 3OF9A 4M0WA 4CDCB 1KFUL 2ATOA 2F1GA 3PRMA 5A24A 2E00A 9PAPA 4W4UA 5EGWA 2ACTA 3QSDA 4OEMA
chains in the Genus database with same CATH topology
1PVJA 3BB7A 4RKXA 4BOPA 4BOQA 3MP2A 4HXDB 5JZEA 4OVZA 3PRPA 4MM3B 4OVZB 3TRKA 2UZJA 4P16A 5EZQA 5KO3A 3TMPA 2FE8A 4RNAA 3BBAA 3PHWA 4R3DA 4BOZA 3BY4A 3OQCA 3PHUA 1DKIA 1YZBA 2JTCA 5EZSA 3B21A 4M0WA 4MI7A 2BU3A 4GUAA 4OW0A 4WURA 3IFUA 2J7QC 4D8EA 4PT5A 4ZTBA 3W30A 5E6JA 2JRIA 2DOSA 3PRMA 3MTVA 4BOSA 4D8IA 4RF0A 4A5UA 3ZNHA 1UKFA 3RNVA 3PHXA 4IP3A 4XZXA 2BTWB 2Z84A 4BOUA 2BTWA 4RF1A 3W31A 3O65A 4D8BA 2J7QA 3MJ5A 3PT2A 3C0RA 2AGAA 4IUMA 2HWKA 3PSEA 4REZA 3E9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZX A;  3W31 A;  3B21 A;  3W30 A;  4IP3 A; 
#chains in the Genus database with same CATH topology
 3MP2 A;  5EF4 A;  1YK7 A;  1CVZ A;  3MHH A;  2JQG R;  3QT4 A;  4YYR A;  2BU3 A;  1AU3 A;  2NQG A;  3H8B A;  4BOS A;  1IWD A;  4CDD B;  1PXV A;  1AYW A;  3WXG A;  1AIM A;  3BB7 A;  3GCB A;  4RKX A;  2AYO A;  1BGO A;  1U9V A;  3H8C A;  4RNA A;  3P5X A;  4QBB A;  1CB5 A;  4FK5 A;  1TLO A;  2DZY A;  1PE6 A;  1Y08 A;  2AUZ A;  2GFO A;  2DJG B;  2OUL A;  1AYU A;  3RVX A;  2AS8 A;  1SNK A;  3PNR A;  2HHN A;  3OVZ A;  3KFQ A;  3E9S A;  4BOP A;  1A6R A;  2C0Y A;  1EWP A;  2DC9 A;  1BY8 A;  5CVO B;  5EZQ A;  3MOR A;  2PBH A;  3U8E A;  4ZUX U;  3IMA A;  2FUD A;  3CH3 X;  4MZO A;  4QH6 A;  4WA6 A;  1YZB A;  2AUX A;  2DCD A;  1MS6 A;  3D6S A;  4XR7 A;  1YK8 A;  3B79 A;  4ZTB A;  3ZUA A;  3H89 A;  5CHT A;  4P6E A;  4CZW A;  3KKU A;  3BOW A;  4BPV A;  3DF0 A;  3IUT A;  4QRX A;  4I07 A;  3E1Z B;  4BOQ A;  2Y5B A;  2XU5 A;  2YJB A;  4Q8G A;  2AVW A;  3BCN A;  3TRK A;  1KFX L;  4YYV A;  2G6D A;  3CH2 X;  2DCB A;  1DKI A;  1F29 A;  1KXR A;  3IFU A;  1MHW A;  4PT5 A;  3IEJ A;  1NQC A;  3P5U A;  4D8B A;  4BS6 A;  4BSQ A;  3PRP A;  3BC3 A;  3N3G A;  3PBH A;  1VJV A;  4GUA A;  1O0E A;  4W5C A;  5JA7 A;  8PCH A;  2IBI A;  3IHP A;  4YYQ A;  3OVX A;  1CTE A;  2BDZ A;  1MDW A;  2Y6E A;  5FPW A;  1EF7 A;  1Y4H A;  4BQV A;  2P7U A;  4FIP A;  3P5W A;  3KX1 A;  2E01 A;  2UZJ A;  4FJC A;  2PAD A;  2YJ8 A;  1MIR A;  5CVM A;  4R3D A;  1YT7 A;  3PHU A;  4DMX A;  1QMY A;  1CS8 A;  1BP4 A;  1F2B A;  1ZIV A;  2HD5 A;  3HHI A;  1YVB A;  1F2A A;  2DCA A;  3CBJ A;  2DC8 A;  4PP1 A;  1AEC A;  1FH0 A;  1GMY A;  3S3R A;  1U9X A;  5KO3 A;  4DMY A;  3V6C A;  1CQD A;  4KLB A;  1NB5 A;  1PIP A;  2FRQ A;  4YYU A;  4P6G A;  3PW3 A;  4MZS A;  1PAD A;  1QXP A;  3H6S A;  4XZX A;  2Z84 A;  3K8U A;  3MHS A;  2HWK A;  3WXE A;  3IOQ A;  1U5I A;  3N4C A;  3S3Q A;  3USV A;  2JTC A;  4MI7 A;  3HHA A;  4XUI A;  4X6H A;  1ITO A;  3IV2 A;  1NB3 A;  2FT2 A;  4HWY A;  4A5U A;  3CBK A;  2VHF A;  4QRV A;  2J7Q A;  3MJ5 A;  1CV8 A;  4W5B A;  4IUM A;  2R9O A;  3PSE A;  4YV8 A;  2NQI A;  3MTN A;  4HXD B;  2FQ9 A;  3PDF A;  2OZ2 A;  4I05 A;  1PPN A;  3BBA A;  3LXS A;  1U9Q X;  1PCI A;  2AIM A;  4OW0 A;  4WUR A;  2J7Q C;  4D8E A;  5E6J A;  1TL9 A;  3AI8 A;  1UKF A;  5F02 A;  2YJ2 A;  1VSN A;  2DZZ A;  4REZ A;  3C0R A;  2FRA A;  2FTD A;  1CSB B;  1M6D A;  5JZE A;  1ICF A;  1TU6 A;  4OEL A;  2R9M A;  2R9F A;  3TMP A;  2CB5 A;  3I3T A;  1CPJ A;  4X6J A;  3BY4 A;  1PPO A;  1POP A;  7PCK A;  2B1M A;  3B21 A;  4G54 A;  3BWK A;  3BPM A;  2FYE A;  3O0U A;  3ZNH A;  2DC7 A;  1Q6K A;  1AU2 A;  4N79 A;  3W30 A;  1DEU A;  3WXF A;  2ARY A;  2CIO A;  2OP3 A;  4YYW A;  4PP2 E;  1EWO A;  3M99 A;  1PPP A;  1ME4 A;  1CJL A;  2P0R A;  3F75 A;  3KSE A;  4CDF B;  3TNX A;  4N8W A;  2NQD B;  1QDQ A;  5CVN B;  1PPD A;  4AXM A;  1GEC E;  3N3K A;  2R6N A;  1THE A;  2PNS A;  2PRE A;  4PI3 A;  1PVJ A;  3RVW A;  2HXZ A;  2G8J A;  3F5V A;  3KWB X;  4RY2 A;  3PHW A;  3OQC A;  1SP4 B;  5CHV A;  4I04 A;  2E03 A;  2XU1 A;  2DCC A;  2VHS A;  1ATK A;  2NQA A;  4N4Z A;  1NL6 A;  1MEM A;  2DOS A;  3ERV A;  3MTV A;  4D8I A;  3K24 A;  4RF0 A;  1ZCM A;  3RNV A;  1AU4 A;  1DF0 A;  3K9M A;  2AU1 A;  4AXL A;  5JH3 A;  3PT2 A;  4CDE B;  4MSX A;  3KW9 A;  1S4V A;  4OVZ A;  4OVZ B;  1MEG A;  1QOL A;  3I06 A;  4P16 A;  1YAL A;  2FE8 A;  1AU0 A;  3O1G A;  1K3B B;  2FO5 A;  3KWZ A;  2IPP B;  3BPF A;  3HWN A;  1JQP A;  2YJ9 A;  1KHQ A;  3PHX A;  4IP3 A;  6PAD A;  2BTW B;  1PBH A;  2BTW A;  4RF1 A;  3W31 A;  1NPZ A;  2F7D A;  2XU3 A;  2AGA A;  2AYN A;  4YVA A;  1U9W A;  4MM3 B;  4YYS A;  2G7Y A;  2XU4 A;  5PAD A;  1NLJ A;  5EZS A;  2R9N A;  2YJC A;  5J94 A;  3C9E A;  4BS5 A;  3OIS A;  4QRG A;  1EWM A;  2JQF R;  2DJF B;  3P5V A;  1BQI A;  2O6X A;  2R9C A;  2E02 A;  3O65 A;  4Q8H A;  4X6I A;  2B1N A;  3LFY A;  1F2C A;  1AYV A;  1KHP A;  1XKG A;  2BDL A;  4K7C A;  2HH5 A;  2WBF X;  3NHE A;  1GLO A;  2G8E A;  2H7J A;  2JRI A;  4PAD A;  2P86 A;  2DC6 A;  2GHU A;  4BOU A;  3V6E A;  1HUC B;  3QJ3 A;  3HD3 A;  3H7D A;  1GCB A;  3RVV A;  1STF E;  1X9Y A;  1EWL A;  1ME3 A;  3OF8 A;  5K16 A;  4BOZ A;  3OF9 A;  4M0W A;  4CDC B;  1KFU L;  2ATO A;  2F1G A;  3PRM A;  5A24 A;  2E00 A;  9PAP A;  4W4U A;  5EGW A;  2ACT A;  3QSD A;  4OEM A; 
#chains in the Genus database with same CATH homology
 1PVJ A;  3BB7 A;  4RKX A;  4BOP A;  4BOQ A;  3MP2 A;  4HXD B;  5JZE A;  4OVZ A;  3PRP A;  4MM3 B;  4OVZ B;  3TRK A;  2UZJ A;  4P16 A;  5EZQ A;  5KO3 A;  3TMP A;  2FE8 A;  4RNA A;  3BBA A;  3PHW A;  4R3D A;  4BOZ A;  3BY4 A;  3OQC A;  3PHU A;  1DKI A;  1YZB A;  2JTC A;  5EZS A;  3B21 A;  4M0W A;  4MI7 A;  2BU3 A;  4GUA A;  4OW0 A;  4WUR A;  3IFU A;  2J7Q C;  4D8E A;  4PT5 A;  4ZTB A;  3W30 A;  5E6J A;  2JRI A;  2DOS A;  3PRM A;  3MTV A;  4BOS A;  4D8I A;  4RF0 A;  4A5U A;  3ZNH A;  1UKF A;  3RNV A;  3PHX A;  4IP3 A;  4XZX A;  2BTW B;  2Z84 A;  4BOU A;  2BTW A;  4RF1 A;  3W31 A;  3O65 A;  4D8B A;  2J7Q A;  3MJ5 A;  3PT2 A;  3C0R A;  2AGA A;  4IUM A;  2HWK A;  3PSE A;  4REZ A;  3E9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...