3B21A

Crystal structure of ospi from shigella flexineri
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
192
structure length
192
Chain Sequence
NVNVKKLLESLNSKSLGDMDKDSELAATLQKMINPSGGDGNCSGCALHACMAMLGYGVREAPVPNEISEYMTGFFHRHLEQIDSEGIVSHPNETYSKFRERIAENILQNTSKGSVVMISIEQATHWIAGFNDGEKIMFLDVQTGKGFNLYDPVEKSPDAFVDENSSVQVIHVSDQEFDHYANSSSWKSKRLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF169b
publication title The Shigella flexneri effector OspI deamidates UBC13 to dampen the inflammatory response
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Unknown function
total genus 61
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.140 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 3b21A00
4XZXA 3W30A 3W31A 3B21A 4IP3A
chains in the Genus database with same CATH superfamily
2AYNA 3HHAA 3BBAA 2H7JA 4OEMA 1KFXL 2PNSA 4A5UA 4BS6A 2B1MA 1QDQA 4DMXA 5EZSA 2PREA 4BS5A 5PADA 4BOQA 4ZTBA 4FK5A 4OELA 3S3RA 1PCIA 1AYUA 1PPDA 4D8BA 2GFOA 3B21A 3P5WA 4QH6A 1AU3A 3F5VA 1ATKA 4CZWA 1U9QX 2HH5A 3OVXA 5K16A 3NHEA 2HXZA 1TLOA 1PPOA 1F2BA 5FPWA 3HD3A 5EZQA 4P6GA 1PBHA 3WXEA 4RKXA 2JQFR 3DF0A 1SNKA 1PADA 3H6SA 1MEGA 1QMYA 2DCAA 1AU0A 1VSNA 3H89A 2HD5A 2ACTA 3D6SA 5JZEA 2DC6A 1KHPA 3M99A 4REZA 4OW0A 3BPMA 3C0RA 2UZJA 1EWLA 2BDZA 3RVXA 1POPA 1JQPA 2OULA 2JRIA 3H8BA 3V6CA 4PP1A 3WXGA 7PCKA 3HHIA 3I06A 1BP4A 3MP2A 4P6EA 4QRVA 4N8WA 2AU1A 1CPJA 3H8CA 4BOSA 4WURA 5E6JA 2AUXA 1U9VA 5CVNB 3ERVA 1U5IA 3N3GA 2JTCA 3KSEA 1ZCMA 2PADA 4K7CA 3E1ZB 3BCNA 3O65A 2G7YA 5F02A 4RY2A 2P86A 3IUTA 4YYUA 2BDLA 3S3QA 4YYWA 2CB5A 2E03A 4HXDB 4CDFB 3KX1A 3KWBX 2AS8A 1EF7A 3CBJA 3CH2X 1VJVA 1UKFA 4XZXA 4XUIA 3GCBA 4AXLA 1AIMA 1QXPA 4BPVA 3CH3X 9PAPA 1EWMA 2CIOA 2P7UA 3KFQA 2AGAA 4BOUA 2NQGA 1CV8A 5JH3A 2IPPB 1Y4HA 2ARYA 1BGOA 3P5XA 2BTWA 1KXRA 4GUAA 4I07A 1AU4A 4BOPA 4WA6A 4D8IA 4FIPA 2AYOA 4BQVA 4YYRA 4KLBA 1NB3A 2Y6EA 2DZYA 3CBKA 4D8EA 3I3TA 3V6EA 5A24A 2E01A 4CDCB 4DMYA 1PIPA 4Q8HA 5EF4A 1DF0A 3OF8A 4X6HA 3WXFA 2R9FA 3BOWA 2BTWB 3BC3A 3PRPA 1PXVA 2DZZA 3MTNA 2E00A 3QT4A 1CSBB 4N4ZA 2F1GA 4I05A 4QBBA 4Q8GA 1ME3A 1ME4A 4P16A 2B1NA 2XU4A 4FJCA 1CJLA 4RNAA 4IUMA 2BU3A 3ZNHA 4PADA 2P0RA 4R3DA 3USVA 2HWKA 5CHTA 2DOSA 4YYQA 3LFYA 2IBIA 3IV2A 4PT5A 1NQCA 1FH0A 2R6NA 4M0WA 1ZIVA 4PI3A 2FE8A 1DKIA 2DJGB 3N3KA 1CVZA 1ITOA 1YZBA 2Y5BA 4BSQA 2DC8A 4ZUXU 1Y08A 2R9OA 3OQCA 1MDWA 4YYSA 2FQ9A 2C0YA 1TL9A 4I04A 1CTEA 2YJ8A 2DCCA 2R9NA 1AECA 4YYVA 6PADA 4OVZB 2FRQA 1ICFA 2YJBA 3TRKA 3QSDA 3MJ5A 3HWNA 2DCDA 2FYEA 3N4CA 3K8UA 1O0EA 4HWYA 3PW3A 4AXMA 2NQDB 2VHSA 5EGWA 3PHUA 4RF1A 3B79A 2FRAA 3TMPA 3OF9A 2FT2A 4PP2E 3P5VA 1PVJA 3KW9A 1PE6A 3W31A 3H7DA 1MEMA 1YK7A 2YJ2A 8PCHA 3U8EA 3ZUAA 3F75A 1CB5A 1Q6KA 5CVMA 1A6RA 1F29A 3C9EA 4X6IA 4W5BA 1MIRA 2GHUA 3MHHA 2XU1A 2R9CA 1GECE 2G8JA 3AI8A 1PPNA 4QRXA 3PDFA 1F2AA 1CQDA 2AUZA 2NQIA 4QRGA 1YALA 1SP4B 1NB5A 2XU5A 2YJCA 3K24A 2VHFA 2HHNA 2DC7A 3MTVA 3RNVA 2G6DA 3O1GA 1GMYA 1QOLA 1IWDA 1AU2A 1MHWA 4W4UA 2F7DA 1YVBA 5CVOB 4MM3B 3PHXA 1S4VA 4CDDB 4XR7A 2AIMA 1GLOA 2DJFB 1NL6A 3PSEA 3TNXA 2DCBA 2OP3A 4N79A 1DEUA 1TU6A 2Z84A 1EWOA 2R9MA 1X9YA 3MORA 1K3BB 3OVZA 1M6DA 2O6XA 1NLJA 4MZSA 5CHVA 3MHSA 1U9XA 1BY8A 3O0UA 3BPFA 5KO3A 3KKUA 1CS8A 1U9WA 4YVAA 4MSXA 4OVZA 2AVWA 2FO5A 3PBHA 4CDEB 2E02A 4MI7A 1PPPA 3PT2A 3QJ3A 3PHWA 3BB7A 3LXSA 3IFUA 3KWZA 3IMAA 1AYWA 2OZ2A 2FUDA 2G8EA 1YK8A 3OISA 4RF0A 1NPZA 4W5CA 3PRMA 1F2CA 3P5UA 3RVVA 3IHPA 1EWPA 1AYVA 2FTDA 5J94A 2J7QA 2J7QC 2ATOA 4G54A 4YV8A 2PBHA 5JA7A 3W30A 1KHQA 1GCBA 2JQGR 4BOZA 3IOQA 2YJ9A 1XKGA 1HUCB 3E9SA 2DC9A 2NQAA 3RVWA 3BWKA 1STFE 4IP3A 1THEA 1MS6A 3BY4A 1BQIA 4X6JA 2XU3A 1YT7A 3IEJA 4MZOA 1KFUL 3PNRA 3K9MA 2WBFX
chains in the Genus database with same CATH topology
3O65A 4M0WA 3BBAA 3PSEA 2FE8A 1DKIA 2Z84A 4HXDB 4A5UA 1YZBA 3OQCA 5EZSA 1UKFA 4XZXA 4BOQA 4ZTBA 4D8BA 5KO3A 3B21A 2AGAA 4BOUA 4OVZA 4OVZB 3TRKA 3MJ5A 2BTWA 4MI7A 4GUAA 3PT2A 4BOPA 4D8IA 3PHWA 5EZQA 3BB7A 3IFUA 4RKXA 3PHUA 4RF1A 4RF0A 4D8EA 3TMPA 3PRMA 1PVJA 3W31A 2J7QA 2J7QC 5JZEA 2BTWB 3PRPA 4REZA 4OW0A 3C0RA 2UZJA 3W30A 4BOZA 3E9SA 4P16A 2JRIA 4IP3A 4RNAA 4IUMA 2BU3A 3ZNHA 3MP2A 4R3DA 3BY4A 2HWKA 3MTVA 3RNVA 4BOSA 2DOSA 4WURA 5E6JA 4PT5A 2JTCA 4MM3B 3PHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZX A;  3W30 A;  3W31 A;  3B21 A;  4IP3 A; 
#chains in the Genus database with same CATH topology
 2AYN A;  3HHA A;  3BBA A;  2H7J A;  4OEM A;  1KFX L;  2PNS A;  4A5U A;  4BS6 A;  2B1M A;  1QDQ A;  4DMX A;  5EZS A;  2PRE A;  4BS5 A;  5PAD A;  4BOQ A;  4ZTB A;  4FK5 A;  4OEL A;  3S3R A;  1PCI A;  1AYU A;  1PPD A;  4D8B A;  2GFO A;  3B21 A;  3P5W A;  4QH6 A;  1AU3 A;  3F5V A;  1ATK A;  4CZW A;  1U9Q X;  2HH5 A;  3OVX A;  5K16 A;  3NHE A;  2HXZ A;  1TLO A;  1PPO A;  1F2B A;  5FPW A;  3HD3 A;  5EZQ A;  4P6G A;  1PBH A;  3WXE A;  4RKX A;  2JQF R;  3DF0 A;  1SNK A;  1PAD A;  3H6S A;  1MEG A;  1QMY A;  2DCA A;  1AU0 A;  1VSN A;  3H89 A;  2HD5 A;  2ACT A;  3D6S A;  5JZE A;  2DC6 A;  1KHP A;  3M99 A;  4REZ A;  4OW0 A;  3BPM A;  3C0R A;  2UZJ A;  1EWL A;  2BDZ A;  3RVX A;  1POP A;  1JQP A;  2OUL A;  2JRI A;  3H8B A;  3V6C A;  4PP1 A;  3WXG A;  7PCK A;  3HHI A;  3I06 A;  1BP4 A;  3MP2 A;  4P6E A;  4QRV A;  4N8W A;  2AU1 A;  1CPJ A;  3H8C A;  4BOS A;  4WUR A;  5E6J A;  2AUX A;  1U9V A;  5CVN B;  3ERV A;  1U5I A;  3N3G A;  2JTC A;  3KSE A;  1ZCM A;  2PAD A;  4K7C A;  3E1Z B;  3BCN A;  3O65 A;  2G7Y A;  5F02 A;  4RY2 A;  2P86 A;  3IUT A;  4YYU A;  2BDL A;  3S3Q A;  4YYW A;  2CB5 A;  2E03 A;  4HXD B;  4CDF B;  3KX1 A;  3KWB X;  2AS8 A;  1EF7 A;  3CBJ A;  3CH2 X;  1VJV A;  1UKF A;  4XZX A;  4XUI A;  3GCB A;  4AXL A;  1AIM A;  1QXP A;  4BPV A;  3CH3 X;  9PAP A;  1EWM A;  2CIO A;  2P7U A;  3KFQ A;  2AGA A;  4BOU A;  2NQG A;  1CV8 A;  5JH3 A;  2IPP B;  1Y4H A;  2ARY A;  1BGO A;  3P5X A;  2BTW A;  1KXR A;  4GUA A;  4I07 A;  1AU4 A;  4BOP A;  4WA6 A;  4D8I A;  4FIP A;  2AYO A;  4BQV A;  4YYR A;  4KLB A;  1NB3 A;  2Y6E A;  2DZY A;  3CBK A;  4D8E A;  3I3T A;  3V6E A;  5A24 A;  2E01 A;  4CDC B;  4DMY A;  1PIP A;  4Q8H A;  5EF4 A;  1DF0 A;  3OF8 A;  4X6H A;  3WXF A;  2R9F A;  3BOW A;  2BTW B;  3BC3 A;  3PRP A;  1PXV A;  2DZZ A;  3MTN A;  2E00 A;  3QT4 A;  1CSB B;  4N4Z A;  2F1G A;  4I05 A;  4QBB A;  4Q8G A;  1ME3 A;  1ME4 A;  4P16 A;  2B1N A;  2XU4 A;  4FJC A;  1CJL A;  4RNA A;  4IUM A;  2BU3 A;  3ZNH A;  4PAD A;  2P0R A;  4R3D A;  3USV A;  2HWK A;  5CHT A;  2DOS A;  4YYQ A;  3LFY A;  2IBI A;  3IV2 A;  4PT5 A;  1NQC A;  1FH0 A;  2R6N A;  4M0W A;  1ZIV A;  4PI3 A;  2FE8 A;  1DKI A;  2DJG B;  3N3K A;  1CVZ A;  1ITO A;  1YZB A;  2Y5B A;  4BSQ A;  2DC8 A;  4ZUX U;  1Y08 A;  2R9O A;  3OQC A;  1MDW A;  4YYS A;  2FQ9 A;  2C0Y A;  1TL9 A;  4I04 A;  1CTE A;  2YJ8 A;  2DCC A;  2R9N A;  1AEC A;  4YYV A;  6PAD A;  4OVZ B;  2FRQ A;  1ICF A;  2YJB A;  3TRK A;  3QSD A;  3MJ5 A;  3HWN A;  2DCD A;  2FYE A;  3N4C A;  3K8U A;  1O0E A;  4HWY A;  3PW3 A;  4AXM A;  2NQD B;  2VHS A;  5EGW A;  3PHU A;  4RF1 A;  3B79 A;  2FRA A;  3TMP A;  3OF9 A;  2FT2 A;  4PP2 E;  3P5V A;  1PVJ A;  3KW9 A;  1PE6 A;  3W31 A;  3H7D A;  1MEM A;  1YK7 A;  2YJ2 A;  8PCH A;  3U8E A;  3ZUA A;  3F75 A;  1CB5 A;  1Q6K A;  5CVM A;  1A6R A;  1F29 A;  3C9E A;  4X6I A;  4W5B A;  1MIR A;  2GHU A;  3MHH A;  2XU1 A;  2R9C A;  1GEC E;  2G8J A;  3AI8 A;  1PPN A;  4QRX A;  3PDF A;  1F2A A;  1CQD A;  2AUZ A;  2NQI A;  4QRG A;  1YAL A;  1SP4 B;  1NB5 A;  2XU5 A;  2YJC A;  3K24 A;  2VHF A;  2HHN A;  2DC7 A;  3MTV A;  3RNV A;  2G6D A;  3O1G A;  1GMY A;  1QOL A;  1IWD A;  1AU2 A;  1MHW A;  4W4U A;  2F7D A;  1YVB A;  5CVO B;  4MM3 B;  3PHX A;  1S4V A;  4CDD B;  4XR7 A;  2AIM A;  1GLO A;  2DJF B;  1NL6 A;  3PSE A;  3TNX A;  2DCB A;  2OP3 A;  4N79 A;  1DEU A;  1TU6 A;  2Z84 A;  1EWO A;  2R9M A;  1X9Y A;  3MOR A;  1K3B B;  3OVZ A;  1M6D A;  2O6X A;  1NLJ A;  4MZS A;  5CHV A;  3MHS A;  1U9X A;  1BY8 A;  3O0U A;  3BPF A;  5KO3 A;  3KKU A;  1CS8 A;  1U9W A;  4YVA A;  4MSX A;  4OVZ A;  2AVW A;  2FO5 A;  3PBH A;  4CDE B;  2E02 A;  4MI7 A;  1PPP A;  3PT2 A;  3QJ3 A;  3PHW A;  3BB7 A;  3LXS A;  3IFU A;  3KWZ A;  3IMA A;  1AYW A;  2OZ2 A;  2FUD A;  2G8E A;  1YK8 A;  3OIS A;  4RF0 A;  1NPZ A;  4W5C A;  3PRM A;  1F2C A;  3P5U A;  3RVV A;  3IHP A;  1EWP A;  1AYV A;  2FTD A;  5J94 A;  2J7Q A;  2J7Q C;  2ATO A;  4G54 A;  4YV8 A;  2PBH A;  5JA7 A;  3W30 A;  1KHQ A;  1GCB A;  2JQG R;  4BOZ A;  3IOQ A;  2YJ9 A;  1XKG A;  1HUC B;  3E9S A;  2DC9 A;  2NQA A;  3RVW A;  3BWK A;  1STF E;  4IP3 A;  1THE A;  1MS6 A;  3BY4 A;  1BQI A;  4X6J A;  2XU3 A;  1YT7 A;  3IEJ A;  4MZO A;  1KFU L;  3PNR A;  3K9M A;  2WBF X; 
#chains in the Genus database with same CATH homology
 3O65 A;  4M0W A;  3BBA A;  3PSE A;  2FE8 A;  1DKI A;  2Z84 A;  4HXD B;  4A5U A;  1YZB A;  3OQC A;  5EZS A;  1UKF A;  4XZX A;  4BOQ A;  4ZTB A;  4D8B A;  5KO3 A;  3B21 A;  2AGA A;  4BOU A;  4OVZ A;  4OVZ B;  3TRK A;  3MJ5 A;  2BTW A;  4MI7 A;  4GUA A;  3PT2 A;  4BOP A;  4D8I A;  3PHW A;  5EZQ A;  3BB7 A;  3IFU A;  4RKX A;  3PHU A;  4RF1 A;  4RF0 A;  4D8E A;  3TMP A;  3PRM A;  1PVJ A;  3W31 A;  2J7Q A;  2J7Q C;  5JZE A;  2BTW B;  3PRP A;  4REZ A;  4OW0 A;  3C0R A;  2UZJ A;  3W30 A;  4BOZ A;  3E9S A;  4P16 A;  2JRI A;  4IP3 A;  4RNA A;  4IUM A;  2BU3 A;  3ZNH A;  3MP2 A;  4R3D A;  3BY4 A;  2HWK A;  3MTV A;  3RNV A;  4BOS A;  2DOS A;  4WUR A;  5E6J A;  4PT5 A;  2JTC A;  4MM3 B;  3PHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...