3N3KA

The catalytic domain of usp8 in complex with a usp8 specific inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
355
structure length
355
Chain Sequence
b'RLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 113
structure length 355
sequence length 355
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3kA00
1CVZA 3MHSA 1MS6A 1YT7A 4AXLA 4P6GA 2FO5A 2FTDA 4QRVA 1PPPA 4BQVA 2WBFX 1IWDA 3CBKA 1MEMA 4FK5A 2DCBA 2HH5A 4P6EA 4MZOA 2HHNA 2YJCA 3BWKA 1PPNA 2FRQA 1Q6KA 1NLJA 2O6XA 4WA6A 4BS6A 3OF9A 4YYUA 3PBHA 2DCCA 3N3KA 3QSDA 1ICFA 5CHVA 3PNRA 2DC7A 2E01A 4N8WA 3OF8A 2R9OA 2JQFR 1ME3A 1CPJA 3LXSA 3IMAA 4RY2A 3HHIA 1EF7A 1QDQA 3E1ZB 2R9MA 5FPWA 3M99A 1PE6A 2HXZA 3IEJA 3N4CA 3U8EA 1CTEA 3V6EA 1EWLA 2AUXA 4OEMA 2XU3A 2PBHA 3H8BA 1ZIVA 2G8EA 1O0EA 2NQAA 4QBBA 4QRXA 2GHUA 3H7DA 1A6RA 2DJGB 3C9EA 1X9YA 3H8CA 1MIRA 4XR7A 1BGOA 4BPVA 2PNSA 3USVA 1S4VA 2HD5A 2OP3A 4FIPA 1YALA 2F7DA 2XU5A 1AIMA 3O1GA 1THEA 2FT2A 3I3TA 5CVNB 3WXFA 3S3QA 2AYNA 3HWNA 1F2CA 2P0RA 3KWZA 1EWMA 1F29A 2G7YA 2YJ9A 4PP2E 3B79A 1F2BA 3CH3X 1MEGA 5PADA 1CQDA 1POPA 2R9CA 3LFYA 2P7UA 1U9QX 4N4ZA 3QJ3A 4YYSA 1GLOA 1FH0A 9PAPA 1PADA 2R9NA 1NB5A 2ATOA 3KWBX 3MTNA 1TL9A 3NHEA 4PADA 1AU4A 3P5WA 5K16A 5A24A 1CSBB 1ME4A 2E00A 1NB3A 3AI8A 2G6DA 4W4UA 3F75A 3H6SA 1F2AA 2CB5A 2DC9A 4G54A 1ATKA 1SNKA 4DMXA 1ZCMA 3DF0A 5CVOB 1Y08A 1AYVA 3KX1A 2CIOA 1K3BB 1SP4B 1BP4A 3O0UA 1JQPA 2NQDB 3H89A 3MHHA 2P86A 4DMYA 2BDLA 3KFQA 4MSXA 3OISA 4PP1A 2NQGA 2AU1A 1KFUL 1NL6A 5JA7A 3N3GA 5EGWA 3ZUAA 1U9VA 5F02A 4X6JA 2R9FA 2FYEA 3CH2X 4FJCA 1AECA 3HHAA 4YYVA 2DCDA 2NQIA 4CDCB 1YK8A 2JQGR 2YJ2A 1AYUA 1U5IA 3BPMA 2F1GA 1YK7A 2FRAA 1AU2A 1VSNA 2PREA 5EF4A 1EWPA 1CV8A 2DJFB 2G8JA 1QMYA 1CJLA 3HD3A 4YYWA 2E02A 2AYOA 3F5VA 3WXEA 2DZZA 2XU1A 3RVXA 3P5UA 2AS8A 3IOQA 4AXMA 4PI3A 3WXGA 3BOWA 3GCBA 4QRGA 3K24A 4XUIA 1PPDA 1AU3A 1AYWA 1QXPA 1M6DA 1MDWA 4MZSA 1NQCA 2B1MA 4X6HA 1YVBA 2YJBA 2VHSA 3IV2A 3OVXA 1KHQA 1PBHA 1CB5A 3RVWA 3RVVA 1PIPA 4K7CA 1KHPA 3IUTA 4N79A 3PDFA 4KLBA 3PW3A 2DZYA 2PADA 3TNXA 4CDFB 5J94A 3BC3A 2E03A 4Q8HA 3BCNA 3KKUA 1BQIA 2C0YA 1EWOA 3ERVA 1MHWA 1NPZA 2BDZA 4YYRA 2AVWA 3D6SA 2DC8A 4YVAA 2AIMA 1QOLA 1PPOA 4I05A 8PCHA 2IBIA 2FUDA 5JH3A 1Y4HA 1TLOA 4CZWA 1U9WA 3KW9A 1GECE 2R6NA 4W5CA 2GFOA 4W5BA 5CHTA 3V6CA 2IPPB 4BSQA 3S3RA 4OELA 1CS8A 1ITOA 3P5XA 4Q8GA 3K9MA 3K8UA 1KXRA 1DEUA 1KFXL 2B1NA 2YJ8A 4QH6A 2DC6A 3P5VA 6PADA 2XU4A 4X6IA 4BS5A 2H7JA 4I07A 4YV8A 4HWYA 1U9XA 1PXVA 1STFE 4ZUXU 3CBJA 3I06A 2ARYA 4CDEB 3IHPA 4CDDB 4YYQA 1DF0A 1GCBA 2OULA 2Y6EA 5CVMA 3OVZA 1AU0A 2DCAA 3KSEA 7PCKA 1GMYA 3QT4A 2FQ9A 2VHFA 3BPFA 1BY8A 2OZ2A 2ACTA 2AUZA 1HUCB 2Y5BA 3MORA 4I04A 1TU6A 1VJVA 1XKGA 1PCIA
chains in the Genus database with same CATH superfamily
1CVZA 3MHSA 1MS6A 1YT7A 4AXLA 3W31A 4P6GA 4GUAA 2FO5A 2FTDA 4QRVA 1PPPA 4BQVA 2DOSA 2WBFX 3BY4A 1IWDA 3CBKA 1MEMA 4FK5A 2DCBA 2HH5A 4P6EA 4MZOA 4OVZA 2HHNA 2YJCA 4MM3B 2BTWB 3BWKA 1PPNA 2FRQA 3PHXA 1Q6KA 1NLJA 2O6XA 4IUMA 4WA6A 4BS6A 4D8EA 3OF9A 4YYUA 3PBHA 2DCCA 3N3KA 3QSDA 1ICFA 5CHVA 3PNRA 2DC7A 2E01A 4N8WA 3OF8A 2R9OA 4BOQA 2JQFR 1ME3A 1CPJA 3RNVA 3LXSA 3IMAA 4RY2A 3HHIA 1EF7A 1QDQA 3E1ZB 2R9MA 5FPWA 4A5UA 3M99A 1PE6A 2HXZA 3IEJA 3N4CA 3TRKA 3U8EA 1CTEA 2JRIA 3TMPA 3V6EA 1EWLA 2AUXA 4OEMA 2XU3A 2PBHA 3H8BA 1ZIVA 2G8EA 1O0EA 2NQAA 4QBBA 2HWKA 4QRXA 2GHUA 3H7DA 1A6RA 2DJGB 3C9EA 1X9YA 3H8CA 1MIRA 4XR7A 4REZA 1BGOA 4BPVA 2PNSA 3USVA 2Z84A 2BTWA 1S4VA 2HD5A 2OP3A 4FIPA 1YALA 2F7DA 2XU5A 1AIMA 3O1GA 1THEA 2FT2A 3I3TA 5CVNB 3WXFA 2J7QC 5EZSA 3S3QA 2AYNA 3HWNA 1F2CA 2P0RA 3KWZA 1EWMA 1F29A 4BOPA 1UKFA 2G7YA 2YJ9A 3PRPA 4PP2E 4MI7A 3B79A 1F2BA 3CH3X 1MEGA 3E9SA 5PADA 1CQDA 1POPA 2R9CA 3LFYA 2P7UA 1U9QX 4N4ZA 3QJ3A 4YYSA 4BOUA 1GLOA 2AGAA 1FH0A 9PAPA 3W30A 1PADA 5EZQA 2R9NA 1NB5A 2ATOA 4RNAA 3KWBX 3MTNA 1TL9A 3NHEA 4IP3A 4PADA 3OQCA 1AU4A 3P5WA 5K16A 5A24A 1CSBB 1ME4A 4HXDB 2E00A 1NB3A 5JZEA 3AI8A 4RF0A 2G6DA 4W4UA 3F75A 3H6SA 1F2AA 2CB5A 2DC9A 4G54A 1ATKA 1SNKA 4DMXA 1ZCMA 4ZTBA 3DF0A 5CVOB 1Y08A 3B21A 1AYVA 3KX1A 2CIOA 3ZNHA 1K3BB 1SP4B 1BP4A 3O0UA 1JQPA 2BU3A 3PHUA 3PSEA 2NQDB 3H89A 3MHHA 5E6JA 2P86A 4DMYA 2BDLA 3KFQA 4MSXA 3OISA 3PHWA 4PP1A 2NQGA 2AU1A 1KFUL 1NL6A 3BBAA 5JA7A 3N3GA 5EGWA 2J7QA 1U9VA 4R3DA 3ZUAA 5F02A 4X6JA 2R9FA 2FYEA 4D8IA 3CH2X 4FJCA 1AECA 3HHAA 4BOSA 4YYVA 2DCDA 2NQIA 4CDCB 1YK8A 2JQGR 2YJ2A 1AYUA 1U5IA 3BPMA 2F1GA 1YK7A 2FRAA 1AU2A 1VSNA 2PREA 2UZJA 5EF4A 1EWPA 1CV8A 3PRMA 4P16A 2DJFB 2G8JA 1QMYA 1CJLA 3HD3A 4YYWA 2E02A 2AYOA 3F5VA 3WXEA 2DZZA 2XU1A 3RVXA 3P5UA 2AS8A 4OW0A 3IOQA 4AXMA 4PI3A 3WXGA 3BOWA 3GCBA 4QRGA 3K24A 4XUIA 1PPDA 3O65A 1AU3A 3PT2A 1AYWA 1QXPA 1M6DA 1MDWA 4MZSA 1NQCA 2B1MA 1DKIA 3BB7A 4X6HA 1YVBA 2YJBA 2VHSA 3IV2A 3OVXA 1KHQA 1PBHA 1CB5A 3RVWA 3RVVA 1PIPA 4K7CA 1KHPA 3IUTA 4N79A 3PDFA 4KLBA 3PW3A 4BOZA 3MP2A 2DZYA 2PADA 3TNXA 2JTCA 4CDFB 5J94A 3BC3A 2E03A 4Q8HA 3BCNA 4XZXA 3KKUA 1BQIA 2C0YA 1EWOA 3ERVA 1MHWA 1NPZA 2BDZA 4YYRA 2AVWA 3D6SA 2DC8A 4YVAA 2AIMA 1QOLA 1PPOA 4I05A 8PCHA 2IBIA 2FUDA 4D8BA 5JH3A 1Y4HA 1TLOA 4CZWA 1U9WA 3KW9A 1GECE 2R6NA 4W5CA 2GFOA 4W5BA 5CHTA 3V6CA 3MJ5A 2IPPB 4BSQA 3S3RA 4OELA 1CS8A 1ITOA 1PVJA 2FE8A 4RF1A 3P5XA 4Q8GA 3K9MA 3K8UA 1KXRA 1DEUA 1KFXL 2B1NA 2YJ8A 4QH6A 2DC6A 3P5VA 6PADA 2XU4A 4WURA 4OVZB 4X6IA 4BS5A 2H7JA 3MTVA 4I07A 4YV8A 4HWYA 1U9XA 1PXVA 1STFE 4ZUXU 3CBJA 3I06A 2ARYA 4CDEB 3IHPA 4CDDB 4YYQA 4M0WA 1DF0A 1GCBA 1YZBA 2OULA 2Y6EA 5CVMA 3OVZA 1AU0A 2DCAA 3KSEA 7PCKA 1GMYA 3QT4A 4RKXA 2FQ9A 3C0RA 2VHFA 5KO3A 3IFUA 3BPFA 4PT5A 1BY8A 2OZ2A 2ACTA 2AUZA 1HUCB 2Y5BA 3MORA 4I04A 1TU6A 1VJVA 1XKGA 1PCIA
chains in the Genus database with same CATH topology
1CVZA 2VFCA 3MHSA 1MS6A 1YT7A 4AXLA 4P6GA 2FO5A 2FTDA 4QRVA 1PPPA 4BQVA 2WBFX 1IWDA 3CBKA 1MEMA 4FK5A 2DCBA 2HH5A 4P6EA 4MZOA 2HHNA 2YJCA 3BWKA 1PPNA 2FRQA 1Q6KA 1NLJA 2O6XA 4WA6A 4BS6A 3OF9A 4YYUA 3PBHA 2DCCA 3LTWA 3N3KA 3QSDA 1ICFA 5CHVA 3PNRA 2DC7A 2E01A 4N8WA 3OF8A 2R9OA 2JQFR 1ME3A 1CPJA 3LXSA 3IMAA 4RY2A 3HHIA 1E2TA 1EF7A 1QDQA 3E1ZB 2R9MA 5FPWA 3M99A 1PE6A 2HXZA 3IEJA 3N4CA 4NV7A 3U8EA 1CTEA 3V6EA 1EWLA 2AUXA 4OEMA 2XU3A 2PBHA 3H8BA 1ZIVA 2G8EA 1O0EA 2NQAA 4B55A 4QBBA 4QRXA 2GHUA 3H7DA 1A6RA 2DJGB 3C9EA 1X9YA 3H8CA 1MIRA 4XR7A 1BGOA 4BPVA 2PNSA 3USVA 1S4VA 2HD5A 2OP3A 4FIPA 1YALA 2F7DA 2XU5A 1AIMA 3O1GA 1THEA 2FT2A 3I3TA 5CVNB 3WXFA 3S3QA 2AYNA 3HWNA 1F2CA 2P0RA 3KWZA 1EWMA 1F29A 2G7YA 2YJ9A 4PP2E 3B79A 1F2BA 3CH3X 1MEGA 5PADA 1CQDA 1POPA 2R9CA 3LFYA 2P7UA 1U9QX 4N4ZA 3QJ3A 4YYSA 1GLOA 1FH0A 9PAPA 1PADA 2R9NA 1NB5A 2ATOA 4BGFA 3KWBX 3MTNA 1TL9A 3NHEA 4PADA 1AU4A 3P5WA 5K16A 5A24A 1CSBB 1ME4A 2E00A 1W6FA 1NB3A 3AI8A 2G6DA 4W4UA 3F75A 3H6SA 1F2AA 2CB5A 2DC9A 4G54A 4C5PA 1ATKA 1SNKA 4DMXA 1ZCMA 3DF0A 5CVOB 1Y08A 1AYVA 3KX1A 2CIOA 1K3BB 1SP4B 1BP4A 3O0UA 1JQPA 2NQDB 3H89A 3MHHA 2P86A 4DMYA 2BDLA 3KFQA 4MSXA 3OISA 4PP1A 2NQGA 1GX3A 2AU1A 1KFUL 1NL6A 5JA7A 3N3GA 5EGWA 3ZUAA 1U9VA 5F02A 4X6JA 2R9FA 2FYEA 3CH2X 4FJCA 1AECA 3HHAA 4YYVA 2DCDA 2NQIA 4CDCB 1YK8A 2JQGR 2YJ2A 1AYUA 1U5IA 3BPMA 2F1GA 1YK7A 2FRAA 1AU2A 1VSNA 2PREA 5EF4A 1EWPA 1CV8A 2DJFB 2G8JA 1QMYA 1CJLA 3HD3A 4YYWA 2E02A 2AYOA 3F5VA 3WXEA 2DZZA 2XU1A 3RVXA 1W5RA 3P5UA 2AS8A 3IOQA 4AXMA 4PI3A 3WXGA 3BOWA 3GCBA 4QRGA 3K24A 4XUIA 1PPDA 1AU3A 1AYWA 1QXPA 1M6DA 1MDWA 4MZSA 1NQCA 2B1MA 4X6HA 1YVBA 2YJBA 2VHSA 3D9WA 3IV2A 3OVXA 1KHQA 1PBHA 1CB5A 3RVWA 3RVVA 1PIPA 4K7CA 1KHPA 3IUTA 4N79A 3PDFA 4KLBA 3PW3A 2DZYA 2PADA 3TNXA 2VFBA 4CDFB 5J94A 3BC3A 2E03A 4Q8HA 3BCNA 3KKUA 1BQIA 2C0YA 1EWOA 1W4TA 3ERVA 1MHWA 1NPZA 2BDZA 4YYRA 2AVWA 3D6SA 2DC8A 4YVAA 2AIMA 1QOLA 1PPOA 4I05A 8PCHA 2IBIA 2FUDA 5JH3A 1Y4HA 1TLOA 4CZWA 1U9WA 3KW9A 1GECE 2R6NA 4W5CA 2GFOA 4GUZA 4W5BA 5CHTA 3V6CA 2IPPB 4BSQA 3S3RA 4OELA 1CS8A 1ITOA 3P5XA 4Q8GA 3K9MA 3K8UA 1KXRA 1DEUA 1KFXL 2B1NA 2BSZA 2YJ8A 4QH6A 2DC6A 3P5VA 6PADA 2XU4A 4X6IA 4BS5A 2H7JA 4I07A 4YV8A 4HWYA 1U9XA 1PXVA 1STFE 4ZUXU 3CBJA 3I06A 2ARYA 4CDEB 3IHPA 4CDDB 4YYQA 1DF0A 1GCBA 2OULA 2Y6EA 5CVMA 3OVZA 1AU0A 2DCAA 3KSEA 7PCKA 1GMYA 3QT4A 2FQ9A 2VHFA 3BPFA 1BY8A 2OZ2A 2ACTA 2AUZA 1HUCB 2Y5BA 3MORA 4I04A 1TU6A 1VJVA 1XKGA 4NV8A 1PCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CVZ A;  3MHS A;  1MS6 A;  1YT7 A;  4AXL A;  4P6G A;  2FO5 A;  2FTD A;  4QRV A;  1PPP A;  4BQV A;  2WBF X;  1IWD A;  3CBK A;  1MEM A;  4FK5 A;  2DCB A;  2HH5 A;  4P6E A;  4MZO A;  2HHN A;  2YJC A;  3BWK A;  1PPN A;  2FRQ A;  1Q6K A;  1NLJ A;  2O6X A;  4WA6 A;  4BS6 A;  3OF9 A;  4YYU A;  3PBH A;  2DCC A;  3N3K A;  3QSD A;  1ICF A;  5CHV A;  3PNR A;  2DC7 A;  2E01 A;  4N8W A;  3OF8 A;  2R9O A;  2JQF R;  1ME3 A;  1CPJ A;  3LXS A;  3IMA A;  4RY2 A;  3HHI A;  1EF7 A;  1QDQ A;  3E1Z B;  2R9M A;  5FPW A;  3M99 A;  1PE6 A;  2HXZ A;  3IEJ A;  3N4C A;  3U8E A;  1CTE A;  3V6E A;  1EWL A;  2AUX A;  4OEM A;  2XU3 A;  2PBH A;  3H8B A;  1ZIV A;  2G8E A;  1O0E A;  2NQA A;  4QBB A;  4QRX A;  2GHU A;  3H7D A;  1A6R A;  2DJG B;  3C9E A;  1X9Y A;  3H8C A;  1MIR A;  4XR7 A;  1BGO A;  4BPV A;  2PNS A;  3USV A;  1S4V A;  2HD5 A;  2OP3 A;  4FIP A;  1YAL A;  2F7D A;  2XU5 A;  1AIM A;  3O1G A;  1THE A;  2FT2 A;  3I3T A;  5CVN B;  3WXF A;  3S3Q A;  2AYN A;  3HWN A;  1F2C A;  2P0R A;  3KWZ A;  1EWM A;  1F29 A;  2G7Y A;  2YJ9 A;  4PP2 E;  3B79 A;  1F2B A;  3CH3 X;  1MEG A;  5PAD A;  1CQD A;  1POP A;  2R9C A;  3LFY A;  2P7U A;  1U9Q X;  4N4Z A;  3QJ3 A;  4YYS A;  1GLO A;  1FH0 A;  9PAP A;  1PAD A;  2R9N A;  1NB5 A;  2ATO A;  3KWB X;  3MTN A;  1TL9 A;  3NHE A;  4PAD A;  1AU4 A;  3P5W A;  5K16 A;  5A24 A;  1CSB B;  1ME4 A;  2E00 A;  1NB3 A;  3AI8 A;  2G6D A;  4W4U A;  3F75 A;  3H6S A;  1F2A A;  2CB5 A;  2DC9 A;  4G54 A;  1ATK A;  1SNK A;  4DMX A;  1ZCM A;  3DF0 A;  5CVO B;  1Y08 A;  1AYV A;  3KX1 A;  2CIO A;  1K3B B;  1SP4 B;  1BP4 A;  3O0U A;  1JQP A;  2NQD B;  3H89 A;  3MHH A;  2P86 A;  4DMY A;  2BDL A;  3KFQ A;  4MSX A;  3OIS A;  4PP1 A;  2NQG A;  2AU1 A;  1KFU L;  1NL6 A;  5JA7 A;  3N3G A;  5EGW A;  3ZUA A;  1U9V A;  5F02 A;  4X6J A;  2R9F A;  2FYE A;  3CH2 X;  4FJC A;  1AEC A;  3HHA A;  4YYV A;  2DCD A;  2NQI A;  4CDC B;  1YK8 A;  2JQG R;  2YJ2 A;  1AYU A;  1U5I A;  3BPM A;  2F1G A;  1YK7 A;  2FRA A;  1AU2 A;  1VSN A;  2PRE A;  5EF4 A;  1EWP A;  1CV8 A;  2DJF B;  2G8J A;  1QMY A;  1CJL A;  3HD3 A;  4YYW A;  2E02 A;  2AYO A;  3F5V A;  3WXE A;  2DZZ A;  2XU1 A;  3RVX A;  3P5U A;  2AS8 A;  3IOQ A;  4AXM A;  4PI3 A;  3WXG A;  3BOW A;  3GCB A;  4QRG A;  3K24 A;  4XUI A;  1PPD A;  1AU3 A;  1AYW A;  1QXP A;  1M6D A;  1MDW A;  4MZS A;  1NQC A;  2B1M A;  4X6H A;  1YVB A;  2YJB A;  2VHS A;  3IV2 A;  3OVX A;  1KHQ A;  1PBH A;  1CB5 A;  3RVW A;  3RVV A;  1PIP A;  4K7C A;  1KHP A;  3IUT A;  4N79 A;  3PDF A;  4KLB A;  3PW3 A;  2DZY A;  2PAD A;  3TNX A;  4CDF B;  5J94 A;  3BC3 A;  2E03 A;  4Q8H A;  3BCN A;  3KKU A;  1BQI A;  2C0Y A;  1EWO A;  3ERV A;  1MHW A;  1NPZ A;  2BDZ A;  4YYR A;  2AVW A;  3D6S A;  2DC8 A;  4YVA A;  2AIM A;  1QOL A;  1PPO A;  4I05 A;  8PCH A;  2IBI A;  2FUD A;  5JH3 A;  1Y4H A;  1TLO A;  4CZW A;  1U9W A;  3KW9 A;  1GEC E;  2R6N A;  4W5C A;  2GFO A;  4W5B A;  5CHT A;  3V6C A;  2IPP B;  4BSQ A;  3S3R A;  4OEL A;  1CS8 A;  1ITO A;  3P5X A;  4Q8G A;  3K9M A;  3K8U A;  1KXR A;  1DEU A;  1KFX L;  2B1N A;  2YJ8 A;  4QH6 A;  2DC6 A;  3P5V A;  6PAD A;  2XU4 A;  4X6I A;  4BS5 A;  2H7J A;  4I07 A;  4YV8 A;  4HWY A;  1U9X A;  1PXV A;  1STF E;  4ZUX U;  3CBJ A;  3I06 A;  2ARY A;  4CDE B;  3IHP A;  4CDD B;  4YYQ A;  1DF0 A;  1GCB A;  2OUL A;  2Y6E A;  5CVM A;  3OVZ A;  1AU0 A;  2DCA A;  3KSE A;  7PCK A;  1GMY A;  3QT4 A;  2FQ9 A;  2VHF A;  3BPF A;  1BY8 A;  2OZ2 A;  2ACT A;  2AUZ A;  1HUC B;  2Y5B A;  3MOR A;  4I04 A;  1TU6 A;  1VJV A;  1XKG A;  1PCI A; 
#chains in the Genus database with same CATH topology
 1CVZ A;  3MHS A;  1MS6 A;  1YT7 A;  4AXL A;  3W31 A;  4P6G A;  4GUA A;  2FO5 A;  2FTD A;  4QRV A;  1PPP A;  4BQV A;  2DOS A;  2WBF X;  3BY4 A;  1IWD A;  3CBK A;  1MEM A;  4FK5 A;  2DCB A;  2HH5 A;  4P6E A;  4MZO A;  4OVZ A;  2HHN A;  2YJC A;  4MM3 B;  2BTW B;  3BWK A;  1PPN A;  2FRQ A;  3PHX A;  1Q6K A;  1NLJ A;  2O6X A;  4IUM A;  4WA6 A;  4BS6 A;  4D8E A;  3OF9 A;  4YYU A;  3PBH A;  2DCC A;  3N3K A;  3QSD A;  1ICF A;  5CHV A;  3PNR A;  2DC7 A;  2E01 A;  4N8W A;  3OF8 A;  2R9O A;  4BOQ A;  2JQF R;  1ME3 A;  1CPJ A;  3RNV A;  3LXS A;  3IMA A;  4RY2 A;  3HHI A;  1EF7 A;  1QDQ A;  3E1Z B;  2R9M A;  5FPW A;  4A5U A;  3M99 A;  1PE6 A;  2HXZ A;  3IEJ A;  3N4C A;  3TRK A;  3U8E A;  1CTE A;  2JRI A;  3TMP A;  3V6E A;  1EWL A;  2AUX A;  4OEM A;  2XU3 A;  2PBH A;  3H8B A;  1ZIV A;  2G8E A;  1O0E A;  2NQA A;  4QBB A;  2HWK A;  4QRX A;  2GHU A;  3H7D A;  1A6R A;  2DJG B;  3C9E A;  1X9Y A;  3H8C A;  1MIR A;  4XR7 A;  4REZ A;  1BGO A;  4BPV A;  2PNS A;  3USV A;  2Z84 A;  2BTW A;  1S4V A;  2HD5 A;  2OP3 A;  4FIP A;  1YAL A;  2F7D A;  2XU5 A;  1AIM A;  3O1G A;  1THE A;  2FT2 A;  3I3T A;  5CVN B;  3WXF A;  2J7Q C;  5EZS A;  3S3Q A;  2AYN A;  3HWN A;  1F2C A;  2P0R A;  3KWZ A;  1EWM A;  1F29 A;  4BOP A;  1UKF A;  2G7Y A;  2YJ9 A;  3PRP A;  4PP2 E;  4MI7 A;  3B79 A;  1F2B A;  3CH3 X;  1MEG A;  3E9S A;  5PAD A;  1CQD A;  1POP A;  2R9C A;  3LFY A;  2P7U A;  1U9Q X;  4N4Z A;  3QJ3 A;  4YYS A;  4BOU A;  1GLO A;  2AGA A;  1FH0 A;  9PAP A;  3W30 A;  1PAD A;  5EZQ A;  2R9N A;  1NB5 A;  2ATO A;  4RNA A;  3KWB X;  3MTN A;  1TL9 A;  3NHE A;  4IP3 A;  4PAD A;  3OQC A;  1AU4 A;  3P5W A;  5K16 A;  5A24 A;  1CSB B;  1ME4 A;  4HXD B;  2E00 A;  1NB3 A;  5JZE A;  3AI8 A;  4RF0 A;  2G6D A;  4W4U A;  3F75 A;  3H6S A;  1F2A A;  2CB5 A;  2DC9 A;  4G54 A;  1ATK A;  1SNK A;  4DMX A;  1ZCM A;  4ZTB A;  3DF0 A;  5CVO B;  1Y08 A;  3B21 A;  1AYV A;  3KX1 A;  2CIO A;  3ZNH A;  1K3B B;  1SP4 B;  1BP4 A;  3O0U A;  1JQP A;  2BU3 A;  3PHU A;  3PSE A;  2NQD B;  3H89 A;  3MHH A;  5E6J A;  2P86 A;  4DMY A;  2BDL A;  3KFQ A;  4MSX A;  3OIS A;  3PHW A;  4PP1 A;  2NQG A;  2AU1 A;  1KFU L;  1NL6 A;  3BBA A;  5JA7 A;  3N3G A;  5EGW A;  2J7Q A;  1U9V A;  4R3D A;  3ZUA A;  5F02 A;  4X6J A;  2R9F A;  2FYE A;  4D8I A;  3CH2 X;  4FJC A;  1AEC A;  3HHA A;  4BOS A;  4YYV A;  2DCD A;  2NQI A;  4CDC B;  1YK8 A;  2JQG R;  2YJ2 A;  1AYU A;  1U5I A;  3BPM A;  2F1G A;  1YK7 A;  2FRA A;  1AU2 A;  1VSN A;  2PRE A;  2UZJ A;  5EF4 A;  1EWP A;  1CV8 A;  3PRM A;  4P16 A;  2DJF B;  2G8J A;  1QMY A;  1CJL A;  3HD3 A;  4YYW A;  2E02 A;  2AYO A;  3F5V A;  3WXE A;  2DZZ A;  2XU1 A;  3RVX A;  3P5U A;  2AS8 A;  4OW0 A;  3IOQ A;  4AXM A;  4PI3 A;  3WXG A;  3BOW A;  3GCB A;  4QRG A;  3K24 A;  4XUI A;  1PPD A;  3O65 A;  1AU3 A;  3PT2 A;  1AYW A;  1QXP A;  1M6D A;  1MDW A;  4MZS A;  1NQC A;  2B1M A;  1DKI A;  3BB7 A;  4X6H A;  1YVB A;  2YJB A;  2VHS A;  3IV2 A;  3OVX A;  1KHQ A;  1PBH A;  1CB5 A;  3RVW A;  3RVV A;  1PIP A;  4K7C A;  1KHP A;  3IUT A;  4N79 A;  3PDF A;  4KLB A;  3PW3 A;  4BOZ A;  3MP2 A;  2DZY A;  2PAD A;  3TNX A;  2JTC A;  4CDF B;  5J94 A;  3BC3 A;  2E03 A;  4Q8H A;  3BCN A;  4XZX A;  3KKU A;  1BQI A;  2C0Y A;  1EWO A;  3ERV A;  1MHW A;  1NPZ A;  2BDZ A;  4YYR A;  2AVW A;  3D6S A;  2DC8 A;  4YVA A;  2AIM A;  1QOL A;  1PPO A;  4I05 A;  8PCH A;  2IBI A;  2FUD A;  4D8B A;  5JH3 A;  1Y4H A;  1TLO A;  4CZW A;  1U9W A;  3KW9 A;  1GEC E;  2R6N A;  4W5C A;  2GFO A;  4W5B A;  5CHT A;  3V6C A;  3MJ5 A;  2IPP B;  4BSQ A;  3S3R A;  4OEL A;  1CS8 A;  1ITO A;  1PVJ A;  2FE8 A;  4RF1 A;  3P5X A;  4Q8G A;  3K9M A;  3K8U A;  1KXR A;  1DEU A;  1KFX L;  2B1N A;  2YJ8 A;  4QH6 A;  2DC6 A;  3P5V A;  6PAD A;  2XU4 A;  4WUR A;  4OVZ B;  4X6I A;  4BS5 A;  2H7J A;  3MTV A;  4I07 A;  4YV8 A;  4HWY A;  1U9X A;  1PXV A;  1STF E;  4ZUX U;  3CBJ A;  3I06 A;  2ARY A;  4CDE B;  3IHP A;  4CDD B;  4YYQ A;  4M0W A;  1DF0 A;  1GCB A;  1YZB A;  2OUL A;  2Y6E A;  5CVM A;  3OVZ A;  1AU0 A;  2DCA A;  3KSE A;  7PCK A;  1GMY A;  3QT4 A;  4RKX A;  2FQ9 A;  3C0R A;  2VHF A;  5KO3 A;  3IFU A;  3BPF A;  4PT5 A;  1BY8 A;  2OZ2 A;  2ACT A;  2AUZ A;  1HUC B;  2Y5B A;  3MOR A;  4I04 A;  1TU6 A;  1VJV A;  1XKG A;  1PCI A; 
#chains in the Genus database with same CATH homology
 1CVZ A;  2VFC A;  3MHS A;  1MS6 A;  1YT7 A;  4AXL A;  4P6G A;  2FO5 A;  2FTD A;  4QRV A;  1PPP A;  4BQV A;  2WBF X;  1IWD A;  3CBK A;  1MEM A;  4FK5 A;  2DCB A;  2HH5 A;  4P6E A;  4MZO A;  2HHN A;  2YJC A;  3BWK A;  1PPN A;  2FRQ A;  1Q6K A;  1NLJ A;  2O6X A;  4WA6 A;  4BS6 A;  3OF9 A;  4YYU A;  3PBH A;  2DCC A;  3LTW A;  3N3K A;  3QSD A;  1ICF A;  5CHV A;  3PNR A;  2DC7 A;  2E01 A;  4N8W A;  3OF8 A;  2R9O A;  2JQF R;  1ME3 A;  1CPJ A;  3LXS A;  3IMA A;  4RY2 A;  3HHI A;  1E2T A;  1EF7 A;  1QDQ A;  3E1Z B;  2R9M A;  5FPW A;  3M99 A;  1PE6 A;  2HXZ A;  3IEJ A;  3N4C A;  4NV7 A;  3U8E A;  1CTE A;  3V6E A;  1EWL A;  2AUX A;  4OEM A;  2XU3 A;  2PBH A;  3H8B A;  1ZIV A;  2G8E A;  1O0E A;  2NQA A;  4B55 A;  4QBB A;  4QRX A;  2GHU A;  3H7D A;  1A6R A;  2DJG B;  3C9E A;  1X9Y A;  3H8C A;  1MIR A;  4XR7 A;  1BGO A;  4BPV A;  2PNS A;  3USV A;  1S4V A;  2HD5 A;  2OP3 A;  4FIP A;  1YAL A;  2F7D A;  2XU5 A;  1AIM A;  3O1G A;  1THE A;  2FT2 A;  3I3T A;  5CVN B;  3WXF A;  3S3Q A;  2AYN A;  3HWN A;  1F2C A;  2P0R A;  3KWZ A;  1EWM A;  1F29 A;  2G7Y A;  2YJ9 A;  4PP2 E;  3B79 A;  1F2B A;  3CH3 X;  1MEG A;  5PAD A;  1CQD A;  1POP A;  2R9C A;  3LFY A;  2P7U A;  1U9Q X;  4N4Z A;  3QJ3 A;  4YYS A;  1GLO A;  1FH0 A;  9PAP A;  1PAD A;  2R9N A;  1NB5 A;  2ATO A;  4BGF A;  3KWB X;  3MTN A;  1TL9 A;  3NHE A;  4PAD A;  1AU4 A;  3P5W A;  5K16 A;  5A24 A;  1CSB B;  1ME4 A;  2E00 A;  1W6F A;  1NB3 A;  3AI8 A;  2G6D A;  4W4U A;  3F75 A;  3H6S A;  1F2A A;  2CB5 A;  2DC9 A;  4G54 A;  4C5P A;  1ATK A;  1SNK A;  4DMX A;  1ZCM A;  3DF0 A;  5CVO B;  1Y08 A;  1AYV A;  3KX1 A;  2CIO A;  1K3B B;  1SP4 B;  1BP4 A;  3O0U A;  1JQP A;  2NQD B;  3H89 A;  3MHH A;  2P86 A;  4DMY A;  2BDL A;  3KFQ A;  4MSX A;  3OIS A;  4PP1 A;  2NQG A;  1GX3 A;  2AU1 A;  1KFU L;  1NL6 A;  5JA7 A;  3N3G A;  5EGW A;  3ZUA A;  1U9V A;  5F02 A;  4X6J A;  2R9F A;  2FYE A;  3CH2 X;  4FJC A;  1AEC A;  3HHA A;  4YYV A;  2DCD A;  2NQI A;  4CDC B;  1YK8 A;  2JQG R;  2YJ2 A;  1AYU A;  1U5I A;  3BPM A;  2F1G A;  1YK7 A;  2FRA A;  1AU2 A;  1VSN A;  2PRE A;  5EF4 A;  1EWP A;  1CV8 A;  2DJF B;  2G8J A;  1QMY A;  1CJL A;  3HD3 A;  4YYW A;  2E02 A;  2AYO A;  3F5V A;  3WXE A;  2DZZ A;  2XU1 A;  3RVX A;  1W5R A;  3P5U A;  2AS8 A;  3IOQ A;  4AXM A;  4PI3 A;  3WXG A;  3BOW A;  3GCB A;  4QRG A;  3K24 A;  4XUI A;  1PPD A;  1AU3 A;  1AYW A;  1QXP A;  1M6D A;  1MDW A;  4MZS A;  1NQC A;  2B1M A;  4X6H A;  1YVB A;  2YJB A;  2VHS A;  3D9W A;  3IV2 A;  3OVX A;  1KHQ A;  1PBH A;  1CB5 A;  3RVW A;  3RVV A;  1PIP A;  4K7C A;  1KHP A;  3IUT A;  4N79 A;  3PDF A;  4KLB A;  3PW3 A;  2DZY A;  2PAD A;  3TNX A;  2VFB A;  4CDF B;  5J94 A;  3BC3 A;  2E03 A;  4Q8H A;  3BCN A;  3KKU A;  1BQI A;  2C0Y A;  1EWO A;  1W4T A;  3ERV A;  1MHW A;  1NPZ A;  2BDZ A;  4YYR A;  2AVW A;  3D6S A;  2DC8 A;  4YVA A;  2AIM A;  1QOL A;  1PPO A;  4I05 A;  8PCH A;  2IBI A;  2FUD A;  5JH3 A;  1Y4H A;  1TLO A;  4CZW A;  1U9W A;  3KW9 A;  1GEC E;  2R6N A;  4W5C A;  2GFO A;  4GUZ A;  4W5B A;  5CHT A;  3V6C A;  2IPP B;  4BSQ A;  3S3R A;  4OEL A;  1CS8 A;  1ITO A;  3P5X A;  4Q8G A;  3K9M A;  3K8U A;  1KXR A;  1DEU A;  1KFX L;  2B1N A;  2BSZ A;  2YJ8 A;  4QH6 A;  2DC6 A;  3P5V A;  6PAD A;  2XU4 A;  4X6I A;  4BS5 A;  2H7J A;  4I07 A;  4YV8 A;  4HWY A;  1U9X A;  1PXV A;  1STF E;  4ZUX U;  3CBJ A;  3I06 A;  2ARY A;  4CDE B;  3IHP A;  4CDD B;  4YYQ A;  1DF0 A;  1GCB A;  2OUL A;  2Y6E A;  5CVM A;  3OVZ A;  1AU0 A;  2DCA A;  3KSE A;  7PCK A;  1GMY A;  3QT4 A;  2FQ9 A;  2VHF A;  3BPF A;  1BY8 A;  2OZ2 A;  2ACT A;  2AUZ A;  1HUC B;  2Y5B A;  3MOR A;  4I04 A;  1TU6 A;  1VJV A;  1XKG A;  4NV8 A;  1PCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...