3N3KA

The catalytic domain of usp8 in complex with a usp8 specific inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
355
structure length
355
Chain Sequence
RLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 355
sequence length 355
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3kA00
1PBHA 3OISA 1MDWA 2H7JA 2DCBA 4FIPA 1U9QX 1CSBB 3D6SA 2XU5A 2HHNA 1QDQA 3F75A 1FH0A 2DJGB 1ICFA 3WXEA 2P0RA 1PXVA 1CJLA 3CBKA 1KFUL 2ATOA 1PPOA 4P6GA 4YVAA 4KLBA 3BPMA 1ITOA 1GMYA 1CPJA 2E01A 5F02A 5CVMA 2AU1A 1TL9A 1DF0A 2YJ8A 3CBJA 4PP1A 1NPZA 2GFOA 2JQFR 3AI8A 2DC8A 1F29A 1SP4B 3KX1A 1Y08A 2E00A 4X6JA 2JQGR 1AIMA 1THEA 1VSNA 2AUXA 4MZOA 5JA7A 1ME4A 4PP2E 3KWZA 3N3KA 3WXGA 4G54A 3LFYA 1PE6A 4ZUXU 2YJ2A 1PADA 3K9MA 2B1MA 1NLJA 3N3GA 2DCDA 4P6EA 4W5BA 3P5WA 3H8BA 1MEMA 2R9FA 3F5VA 4AXLA 3PW3A 1QOLA 5FPWA 1IWDA 1AYWA 4FJCA 1TU6A 1JQPA 5EGWA 2AIMA 2OZ2A 1YVBA 1PCIA 2AYNA 2R9MA 4I05A 1GECE 3S3RA 3M99A 2CB5A 3P5XA 1PPNA 5EF4A 1AYVA 1ZIVA 4YV8A 2FRQA 4I07A 3H6SA 1AU4A 1AU3A 1A6RA 1POPA 2NQGA 2NQIA 1AYUA 3OF8A 5A24A 4YYVA 3IHPA 3RVWA 3ZUAA 1AECA 3OF9A 4QH6A 3OVXA 1KHQA 2DZYA 2O6XA 4YYUA 2HH5A 2DJFB 3CH2X 4XR7A 3U8EA 1DEUA 2F7DA 2NQAA 3IUTA 4N8WA 1EWLA 3KWBX 1CQDA 1TLOA 1F2CA 1AU2A 3O0UA 1QMYA 1U9VA 2CIOA 3C9EA 4BS5A 2XU4A 4CDDB 3KSEA 4CDEB 3KW9A 4K7CA 3RVVA 1EF7A 3H89A 2VHSA 1M6DA 1CVZA 1EWMA 2FO5A 3BOWA 1S4VA 1BP4A 2IPPB 1K3BB 1BGOA 5CVNB 5K16A 2AS8A 9PAPA 1MEGA 2ARYA 2E03A 2AUZA 2BDZA 4QRGA 4CZWA 2F1GA 3P5VA 3MHSA 1Q6KA 4BS6A 2R6NA 3KFQA 3RVXA 1CS8A 3BC3A 4QBBA 2E02A 4YYQA 1BY8A 1PPDA 1KXRA 4QRVA 4CDFB 2P7UA 1NQCA 1NB5A 3QJ3A 3I3TA 3V6EA 2FYEA 1F2AA 2NQDB 4RY2A 1PPPA 1YK7A 3MTNA 2FT2A 2AYOA 1STFE 1CTEA 3QSDA 1U5IA 2YJBA 3MHHA 2FTDA 2DC7A 2FUDA 3IV2A 4WA6A 3PNRA 3PDFA 1BQIA 1YK8A 2OP3A 1O0EA 4DMYA 3H7DA 2R9CA 3OVZA 2HD5A 1U9WA 1NL6A 2DC9A 2G7YA 3IOQA 1X9YA 4PI3A 2IBIA 2B1NA 4OEMA 2G6DA 2AVWA 2PADA 1GLOA 4N79A 2DCAA 2PREA 3S3QA 3CH3X 3NHEA 3IMAA 1AU0A 3BWKA 4BQVA 1XKGA 2OULA 4X6HA 1KHPA 4X6IA 2DCCA 4DMXA 3E1ZB 2XU3A 4YYWA 2FQ9A 3HHAA 1YALA 1VJVA 4QRXA 2PBHA 1QXPA 3O1GA 4XUIA 4MZSA 3B79A 3USVA 3H8CA 4W4UA 3BPFA 5JH3A 3LXSA 5CHVA 2Y5BA 5J94A 2PNSA 1MIRA 4HWYA 3K8UA 4BPVA 1F2BA 2C0YA 2Y6EA 3KKUA 2YJCA 4BSQA 4YYSA 3PBHA 2VHFA 3QT4A 2DC6A 4N4ZA 1Y4HA 7PCKA 4YYRA 3I06A 1ME3A 3IEJA 3ERVA 6PADA 5CHTA 4Q8GA 1CB5A 3P5UA 2GHUA 2DZZA 2YJ9A 5CVOB 1NB3A 1MS6A 3HHIA 2HXZA 1MHWA 1KFXL 4CDCB 5PADA 3BCNA 1SNKA 2WBFX 8PCHA 1ATKA 2G8EA 4Q8HA 3TNXA 2XU1A 4OELA 1ZCMA 1GCBA 2BDLA 3GCBA 3HWNA 1EWPA 1YT7A 4PADA 3K24A 2P86A 4AXMA 1PIPA 3N4CA 4W5CA 2ACTA 1HUCB 2R9OA 1EWOA 1U9XA 2FRAA 3HD3A 3WXFA 4MSXA 2R9NA 3MORA 2G8JA 4I04A 3DF0A 3V6CA 1CV8A 4FK5A
chains in the Genus database with same CATH superfamily
4IUMA 3E9SA 1PBHA 3OISA 1MDWA 2H7JA 2DCBA 4RF0A 4FIPA 1U9QX 1CSBB 3D6SA 2XU5A 2HHNA 1QDQA 3F75A 4D8IA 1FH0A 2DJGB 3B21A 1ICFA 3WXEA 2P0RA 1PXVA 1CJLA 3CBKA 1KFUL 2ATOA 1PPOA 4P6GA 4YVAA 4KLBA 3BPMA 4GUAA 4BOUA 4PT5A 1ITOA 1GMYA 1CPJA 2E01A 4OVZB 5F02A 2DOSA 4BOPA 5CVMA 2AU1A 1TL9A 1DF0A 2YJ8A 3CBJA 4PP1A 1NPZA 2GFOA 2BTWB 2JQFR 3AI8A 2DC8A 1F29A 1SP4B 3KX1A 1Y08A 2E00A 4X6JA 2JQGR 1AIMA 3BY4A 1THEA 1VSNA 2AUXA 4MZOA 5JA7A 1ME4A 4PP2E 4XZXA 3W30A 3KWZA 3N3KA 3WXGA 4G54A 3LFYA 1PE6A 4ZUXU 2YJ2A 1PADA 3K9MA 2B1MA 4P16A 4RKXA 1NLJA 3N3GA 4RF1A 2DCDA 4P6EA 4MM3B 4W5BA 3P5WA 3H8BA 1MEMA 3MTVA 2R9FA 3F5VA 4AXLA 3PW3A 1QOLA 5FPWA 1IWDA 1AYWA 4FJCA 1TU6A 3MP2A 1JQPA 5EGWA 2AIMA 2OZ2A 1YVBA 1PCIA 2AYNA 2R9MA 3PHWA 4I05A 1GECE 3S3RA 3M99A 2CB5A 3P5XA 1PPNA 5EF4A 3ZNHA 1AYVA 1ZIVA 4YV8A 2FRQA 3PHUA 4I07A 3H6SA 1AU4A 1AU3A 3PHXA 1A6RA 1POPA 2NQGA 2NQIA 1AYUA 3OF8A 5A24A 4YYVA 3IHPA 3RVWA 3ZUAA 1AECA 3OF9A 4QH6A 2JTCA 3OVXA 1KHQA 4M0WA 2FE8A 2DZYA 2O6XA 4WURA 2HH5A 4YYUA 5JZEA 2DJFB 3CH2X 4XR7A 3PT2A 3C0RA 3U8EA 1DEUA 2F7DA 2NQAA 3IUTA 4N8WA 1EWLA 3KWBX 1CQDA 1TLOA 1F2CA 1DKIA 3MJ5A 1AU2A 3O0UA 1QMYA 1U9VA 2CIOA 3C9EA 3PSEA 4BS5A 2BTWA 2XU4A 4CDDB 3KSEA 5E6JA 2HWKA 4CDEB 3KW9A 3W31A 4K7CA 3RVVA 1EF7A 3H89A 2VHSA 1M6DA 1CVZA 1EWMA 2FO5A 3BOWA 1S4VA 1BP4A 2IPPB 1K3BB 1BGOA 5CVNB 4HXDB 5K16A 4OW0A 2AS8A 9PAPA 1MEGA 2ARYA 2E03A 4BOQA 2AUZA 2BDZA 3RNVA 4QRGA 4CZWA 2F1GA 3P5VA 3MHSA 3OQCA 1Q6KA 4BS6A 2R6NA 3KFQA 3RVXA 1CS8A 3BC3A 4QBBA 2E02A 2UZJA 4YYQA 1BY8A 1PPDA 1KXRA 4QRVA 4CDFB 2P7UA 1NQCA 1NB5A 3QJ3A 3I3TA 3V6EA 2FYEA 2BU3A 1F2AA 1YZBA 2NQDB 4RY2A 1PPPA 1YK7A 3MTNA 2FT2A 2AYOA 1STFE 1CTEA 3QSDA 1U5IA 3BB7A 2YJBA 2AGAA 3MHHA 2FTDA 2DC7A 2FUDA 3IV2A 4WA6A 3PNRA 3PDFA 1BQIA 4REZA 1YK8A 2OP3A 4A5UA 1O0EA 4DMYA 5EZQA 3H7DA 2R9CA 5KO3A 3OVZA 2HD5A 1U9WA 1NL6A 2DC9A 2G7YA 3IOQA 1X9YA 4IP3A 4PI3A 2IBIA 2B1NA 3PRMA 4OEMA 2G6DA 4RNAA 2AVWA 2PADA 1GLOA 4N79A 2DCAA 2PREA 3S3QA 3CH3X 3NHEA 3IMAA 1AU0A 3BWKA 4BQVA 1XKGA 2OULA 4X6HA 1KHPA 4X6IA 2DCCA 4DMXA 4R3DA 3E1ZB 2XU3A 3O65A 4YYWA 2FQ9A 3HHAA 4OVZA 1YALA 1VJVA 3TRKA 4MI7A 4QRXA 3TMPA 2PBHA 1QXPA 3O1GA 3BBAA 4D8EA 4XUIA 4MZSA 3B79A 3USVA 3H8CA 4W4UA 4ZTBA 3BPFA 5JH3A 3LXSA 5CHVA 2Y5BA 5J94A 2PNSA 1MIRA 4HWYA 3K8UA 4BPVA 1F2BA 2C0YA 2Y6EA 3KKUA 2YJCA 2Z84A 4BSQA 4YYSA 3PBHA 2VHFA 3QT4A 2DC6A 4N4ZA 1Y4HA 7PCKA 4YYRA 3I06A 4D8BA 1ME3A 3IEJA 3ERVA 6PADA 5CHTA 4Q8GA 1CB5A 1PVJA 3P5UA 2GHUA 2DZZA 2YJ9A 5CVOB 1NB3A 4BOSA 1MS6A 3HHIA 2HXZA 1MHWA 1KFXL 4CDCB 1UKFA 5PADA 3BCNA 1SNKA 2WBFX 8PCHA 1ATKA 2G8EA 4Q8HA 3TNXA 2XU1A 4OELA 1ZCMA 1GCBA 2BDLA 3GCBA 3HWNA 1EWPA 1YT7A 4PADA 3K24A 2P86A 5EZSA 4BOZA 3PRPA 2J7QA 4AXMA 2J7QC 1PIPA 3N4CA 4W5CA 2ACTA 1HUCB 2R9OA 1EWOA 2JRIA 1U9XA 2FRAA 3HD3A 3WXFA 3IFUA 4MSXA 2R9NA 3MORA 2G8JA 4I04A 3DF0A 3V6CA 1CV8A 4FK5A
chains in the Genus database with same CATH topology
1PBHA 3OISA 1MDWA 2H7JA 2DCBA 4FIPA 1U9QX 1CSBB 3D6SA 2XU5A 2HHNA 1QDQA 3D9WA 3F75A 1FH0A 2DJGB 1ICFA 1W5RA 3WXEA 2P0RA 1PXVA 1CJLA 3CBKA 1KFUL 2ATOA 1PPOA 4P6GA 4YVAA 4KLBA 3BPMA 1ITOA 1GMYA 1CPJA 2E01A 5F02A 5CVMA 2AU1A 1TL9A 1DF0A 2YJ8A 3CBJA 4PP1A 1NPZA 2GFOA 2JQFR 3AI8A 2DC8A 1F29A 1SP4B 3KX1A 1Y08A 2E00A 4X6JA 2JQGR 1AIMA 1E2TA 1THEA 1VSNA 2AUXA 4MZOA 5JA7A 1ME4A 4PP2E 3KWZA 3N3KA 3WXGA 4G54A 3LFYA 1PE6A 4ZUXU 2YJ2A 1PADA 3K9MA 2B1MA 1NLJA 3N3GA 2DCDA 4P6EA 4W5BA 3P5WA 3H8BA 1MEMA 2R9FA 3F5VA 4AXLA 3PW3A 1QOLA 5FPWA 1IWDA 1AYWA 4FJCA 1TU6A 1JQPA 5EGWA 2AIMA 2OZ2A 1YVBA 1PCIA 2AYNA 2R9MA 4I05A 1GECE 3S3RA 3M99A 2CB5A 3P5XA 1PPNA 5EF4A 1AYVA 1ZIVA 4YV8A 2FRQA 4I07A 3H6SA 1AU4A 1AU3A 4NV7A 1A6RA 1POPA 2NQGA 3LTWA 2NQIA 1AYUA 3OF8A 5A24A 4YYVA 3IHPA 3RVWA 3ZUAA 1AECA 3OF9A 4QH6A 3OVXA 1KHQA 2DZYA 2O6XA 4YYUA 2HH5A 2DJFB 3CH2X 4XR7A 3U8EA 1DEUA 2F7DA 2NQAA 3IUTA 4N8WA 1EWLA 3KWBX 1CQDA 1TLOA 1F2CA 1AU2A 3O0UA 1QMYA 1U9VA 2CIOA 3C9EA 4BS5A 2XU4A 4CDDB 3KSEA 4CDEB 3KW9A 4K7CA 3RVVA 1EF7A 3H89A 2VHSA 1M6DA 1CVZA 1EWMA 2FO5A 3BOWA 1S4VA 1BP4A 2IPPB 1K3BB 1BGOA 5CVNB 5K16A 2AS8A 9PAPA 1MEGA 2ARYA 2E03A 2AUZA 2BDZA 4QRGA 4GUZA 4CZWA 2F1GA 3P5VA 3MHSA 1Q6KA 4BS6A 2R6NA 3KFQA 3RVXA 1CS8A 3BC3A 4QBBA 2E02A 4YYQA 1BY8A 1PPDA 2VFBA 1KXRA 4QRVA 4CDFB 2P7UA 1NQCA 1NB5A 3QJ3A 3I3TA 3V6EA 2FYEA 4NV8A 1F2AA 1GX3A 2NQDB 4RY2A 1PPPA 1YK7A 3MTNA 2FT2A 2AYOA 1STFE 1CTEA 3QSDA 1U5IA 2YJBA 3MHHA 2FTDA 2DC7A 2FUDA 3IV2A 4WA6A 3PNRA 3PDFA 4B55A 1BQIA 1W4TA 1YK8A 2OP3A 1O0EA 4DMYA 3H7DA 2R9CA 2BSZA 3OVZA 2HD5A 1U9WA 1NL6A 2DC9A 2G7YA 3IOQA 1X9YA 4PI3A 2IBIA 2B1NA 4OEMA 2G6DA 2AVWA 2PADA 1GLOA 4N79A 2DCAA 2PREA 3S3QA 3CH3X 3NHEA 2VFCA 3IMAA 1AU0A 3BWKA 4BQVA 1XKGA 2OULA 4X6HA 1KHPA 4X6IA 2DCCA 4DMXA 3E1ZB 2XU3A 4YYWA 4BGFA 2FQ9A 3HHAA 1YALA 1VJVA 4QRXA 4C5PA 2PBHA 1QXPA 3O1GA 4XUIA 4MZSA 3B79A 3USVA 3H8CA 4W4UA 3BPFA 5JH3A 3LXSA 5CHVA 2Y5BA 5J94A 2PNSA 1MIRA 4HWYA 3K8UA 4BPVA 1F2BA 2C0YA 2Y6EA 3KKUA 2YJCA 4BSQA 4YYSA 3PBHA 2VHFA 3QT4A 2DC6A 4N4ZA 1Y4HA 7PCKA 4YYRA 3I06A 1ME3A 3IEJA 3ERVA 6PADA 5CHTA 4Q8GA 1CB5A 3P5UA 2GHUA 2DZZA 2YJ9A 5CVOB 1NB3A 1MS6A 3HHIA 2HXZA 1MHWA 1KFXL 4CDCB 5PADA 3BCNA 1SNKA 2WBFX 8PCHA 1ATKA 2G8EA 4Q8HA 3TNXA 2XU1A 4OELA 1ZCMA 1GCBA 2BDLA 3GCBA 3HWNA 1EWPA 1YT7A 4PADA 3K24A 2P86A 4AXMA 1PIPA 3N4CA 4W5CA 2ACTA 1HUCB 2R9OA 1EWOA 1U9XA 2FRAA 3HD3A 1W6FA 3WXFA 4MSXA 2R9NA 3MORA 2G8JA 4I04A 3DF0A 3V6CA 1CV8A 4FK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBH A;  3OIS A;  1MDW A;  2H7J A;  2DCB A;  4FIP A;  1U9Q X;  1CSB B;  3D6S A;  2XU5 A;  2HHN A;  1QDQ A;  3F75 A;  1FH0 A;  2DJG B;  1ICF A;  3WXE A;  2P0R A;  1PXV A;  1CJL A;  3CBK A;  1KFU L;  2ATO A;  1PPO A;  4P6G A;  4YVA A;  4KLB A;  3BPM A;  1ITO A;  1GMY A;  1CPJ A;  2E01 A;  5F02 A;  5CVM A;  2AU1 A;  1TL9 A;  1DF0 A;  2YJ8 A;  3CBJ A;  4PP1 A;  1NPZ A;  2GFO A;  2JQF R;  3AI8 A;  2DC8 A;  1F29 A;  1SP4 B;  3KX1 A;  1Y08 A;  2E00 A;  4X6J A;  2JQG R;  1AIM A;  1THE A;  1VSN A;  2AUX A;  4MZO A;  5JA7 A;  1ME4 A;  4PP2 E;  3KWZ A;  3N3K A;  3WXG A;  4G54 A;  3LFY A;  1PE6 A;  4ZUX U;  2YJ2 A;  1PAD A;  3K9M A;  2B1M A;  1NLJ A;  3N3G A;  2DCD A;  4P6E A;  4W5B A;  3P5W A;  3H8B A;  1MEM A;  2R9F A;  3F5V A;  4AXL A;  3PW3 A;  1QOL A;  5FPW A;  1IWD A;  1AYW A;  4FJC A;  1TU6 A;  1JQP A;  5EGW A;  2AIM A;  2OZ2 A;  1YVB A;  1PCI A;  2AYN A;  2R9M A;  4I05 A;  1GEC E;  3S3R A;  3M99 A;  2CB5 A;  3P5X A;  1PPN A;  5EF4 A;  1AYV A;  1ZIV A;  4YV8 A;  2FRQ A;  4I07 A;  3H6S A;  1AU4 A;  1AU3 A;  1A6R A;  1POP A;  2NQG A;  2NQI A;  1AYU A;  3OF8 A;  5A24 A;  4YYV A;  3IHP A;  3RVW A;  3ZUA A;  1AEC A;  3OF9 A;  4QH6 A;  3OVX A;  1KHQ A;  2DZY A;  2O6X A;  4YYU A;  2HH5 A;  2DJF B;  3CH2 X;  4XR7 A;  3U8E A;  1DEU A;  2F7D A;  2NQA A;  3IUT A;  4N8W A;  1EWL A;  3KWB X;  1CQD A;  1TLO A;  1F2C A;  1AU2 A;  3O0U A;  1QMY A;  1U9V A;  2CIO A;  3C9E A;  4BS5 A;  2XU4 A;  4CDD B;  3KSE A;  4CDE B;  3KW9 A;  4K7C A;  3RVV A;  1EF7 A;  3H89 A;  2VHS A;  1M6D A;  1CVZ A;  1EWM A;  2FO5 A;  3BOW A;  1S4V A;  1BP4 A;  2IPP B;  1K3B B;  1BGO A;  5CVN B;  5K16 A;  2AS8 A;  9PAP A;  1MEG A;  2ARY A;  2E03 A;  2AUZ A;  2BDZ A;  4QRG A;  4CZW A;  2F1G A;  3P5V A;  3MHS A;  1Q6K A;  4BS6 A;  2R6N A;  3KFQ A;  3RVX A;  1CS8 A;  3BC3 A;  4QBB A;  2E02 A;  4YYQ A;  1BY8 A;  1PPD A;  1KXR A;  4QRV A;  4CDF B;  2P7U A;  1NQC A;  1NB5 A;  3QJ3 A;  3I3T A;  3V6E A;  2FYE A;  1F2A A;  2NQD B;  4RY2 A;  1PPP A;  1YK7 A;  3MTN A;  2FT2 A;  2AYO A;  1STF E;  1CTE A;  3QSD A;  1U5I A;  2YJB A;  3MHH A;  2FTD A;  2DC7 A;  2FUD A;  3IV2 A;  4WA6 A;  3PNR A;  3PDF A;  1BQI A;  1YK8 A;  2OP3 A;  1O0E A;  4DMY A;  3H7D A;  2R9C A;  3OVZ A;  2HD5 A;  1U9W A;  1NL6 A;  2DC9 A;  2G7Y A;  3IOQ A;  1X9Y A;  4PI3 A;  2IBI A;  2B1N A;  4OEM A;  2G6D A;  2AVW A;  2PAD A;  1GLO A;  4N79 A;  2DCA A;  2PRE A;  3S3Q A;  3CH3 X;  3NHE A;  3IMA A;  1AU0 A;  3BWK A;  4BQV A;  1XKG A;  2OUL A;  4X6H A;  1KHP A;  4X6I A;  2DCC A;  4DMX A;  3E1Z B;  2XU3 A;  4YYW A;  2FQ9 A;  3HHA A;  1YAL A;  1VJV A;  4QRX A;  2PBH A;  1QXP A;  3O1G A;  4XUI A;  4MZS A;  3B79 A;  3USV A;  3H8C A;  4W4U A;  3BPF A;  5JH3 A;  3LXS A;  5CHV A;  2Y5B A;  5J94 A;  2PNS A;  1MIR A;  4HWY A;  3K8U A;  4BPV A;  1F2B A;  2C0Y A;  2Y6E A;  3KKU A;  2YJC A;  4BSQ A;  4YYS A;  3PBH A;  2VHF A;  3QT4 A;  2DC6 A;  4N4Z A;  1Y4H A;  7PCK A;  4YYR A;  3I06 A;  1ME3 A;  3IEJ A;  3ERV A;  6PAD A;  5CHT A;  4Q8G A;  1CB5 A;  3P5U A;  2GHU A;  2DZZ A;  2YJ9 A;  5CVO B;  1NB3 A;  1MS6 A;  3HHI A;  2HXZ A;  1MHW A;  1KFX L;  4CDC B;  5PAD A;  3BCN A;  1SNK A;  2WBF X;  8PCH A;  1ATK A;  2G8E A;  4Q8H A;  3TNX A;  2XU1 A;  4OEL A;  1ZCM A;  1GCB A;  2BDL A;  3GCB A;  3HWN A;  1EWP A;  1YT7 A;  4PAD A;  3K24 A;  2P86 A;  4AXM A;  1PIP A;  3N4C A;  4W5C A;  2ACT A;  1HUC B;  2R9O A;  1EWO A;  1U9X A;  2FRA A;  3HD3 A;  3WXF A;  4MSX A;  2R9N A;  3MOR A;  2G8J A;  4I04 A;  3DF0 A;  3V6C A;  1CV8 A;  4FK5 A; 
#chains in the Genus database with same CATH topology
 4IUM A;  3E9S A;  1PBH A;  3OIS A;  1MDW A;  2H7J A;  2DCB A;  4RF0 A;  4FIP A;  1U9Q X;  1CSB B;  3D6S A;  2XU5 A;  2HHN A;  1QDQ A;  3F75 A;  4D8I A;  1FH0 A;  2DJG B;  3B21 A;  1ICF A;  3WXE A;  2P0R A;  1PXV A;  1CJL A;  3CBK A;  1KFU L;  2ATO A;  1PPO A;  4P6G A;  4YVA A;  4KLB A;  3BPM A;  4GUA A;  4BOU A;  4PT5 A;  1ITO A;  1GMY A;  1CPJ A;  2E01 A;  4OVZ B;  5F02 A;  2DOS A;  4BOP A;  5CVM A;  2AU1 A;  1TL9 A;  1DF0 A;  2YJ8 A;  3CBJ A;  4PP1 A;  1NPZ A;  2GFO A;  2BTW B;  2JQF R;  3AI8 A;  2DC8 A;  1F29 A;  1SP4 B;  3KX1 A;  1Y08 A;  2E00 A;  4X6J A;  2JQG R;  1AIM A;  3BY4 A;  1THE A;  1VSN A;  2AUX A;  4MZO A;  5JA7 A;  1ME4 A;  4PP2 E;  4XZX A;  3W30 A;  3KWZ A;  3N3K A;  3WXG A;  4G54 A;  3LFY A;  1PE6 A;  4ZUX U;  2YJ2 A;  1PAD A;  3K9M A;  2B1M A;  4P16 A;  4RKX A;  1NLJ A;  3N3G A;  4RF1 A;  2DCD A;  4P6E A;  4MM3 B;  4W5B A;  3P5W A;  3H8B A;  1MEM A;  3MTV A;  2R9F A;  3F5V A;  4AXL A;  3PW3 A;  1QOL A;  5FPW A;  1IWD A;  1AYW A;  4FJC A;  1TU6 A;  3MP2 A;  1JQP A;  5EGW A;  2AIM A;  2OZ2 A;  1YVB A;  1PCI A;  2AYN A;  2R9M A;  3PHW A;  4I05 A;  1GEC E;  3S3R A;  3M99 A;  2CB5 A;  3P5X A;  1PPN A;  5EF4 A;  3ZNH A;  1AYV A;  1ZIV A;  4YV8 A;  2FRQ A;  3PHU A;  4I07 A;  3H6S A;  1AU4 A;  1AU3 A;  3PHX A;  1A6R A;  1POP A;  2NQG A;  2NQI A;  1AYU A;  3OF8 A;  5A24 A;  4YYV A;  3IHP A;  3RVW A;  3ZUA A;  1AEC A;  3OF9 A;  4QH6 A;  2JTC A;  3OVX A;  1KHQ A;  4M0W A;  2FE8 A;  2DZY A;  2O6X A;  4WUR A;  2HH5 A;  4YYU A;  5JZE A;  2DJF B;  3CH2 X;  4XR7 A;  3PT2 A;  3C0R A;  3U8E A;  1DEU A;  2F7D A;  2NQA A;  3IUT A;  4N8W A;  1EWL A;  3KWB X;  1CQD A;  1TLO A;  1F2C A;  1DKI A;  3MJ5 A;  1AU2 A;  3O0U A;  1QMY A;  1U9V A;  2CIO A;  3C9E A;  3PSE A;  4BS5 A;  2BTW A;  2XU4 A;  4CDD B;  3KSE A;  5E6J A;  2HWK A;  4CDE B;  3KW9 A;  3W31 A;  4K7C A;  3RVV A;  1EF7 A;  3H89 A;  2VHS A;  1M6D A;  1CVZ A;  1EWM A;  2FO5 A;  3BOW A;  1S4V A;  1BP4 A;  2IPP B;  1K3B B;  1BGO A;  5CVN B;  4HXD B;  5K16 A;  4OW0 A;  2AS8 A;  9PAP A;  1MEG A;  2ARY A;  2E03 A;  4BOQ A;  2AUZ A;  2BDZ A;  3RNV A;  4QRG A;  4CZW A;  2F1G A;  3P5V A;  3MHS A;  3OQC A;  1Q6K A;  4BS6 A;  2R6N A;  3KFQ A;  3RVX A;  1CS8 A;  3BC3 A;  4QBB A;  2E02 A;  2UZJ A;  4YYQ A;  1BY8 A;  1PPD A;  1KXR A;  4QRV A;  4CDF B;  2P7U A;  1NQC A;  1NB5 A;  3QJ3 A;  3I3T A;  3V6E A;  2FYE A;  2BU3 A;  1F2A A;  1YZB A;  2NQD B;  4RY2 A;  1PPP A;  1YK7 A;  3MTN A;  2FT2 A;  2AYO A;  1STF E;  1CTE A;  3QSD A;  1U5I A;  3BB7 A;  2YJB A;  2AGA A;  3MHH A;  2FTD A;  2DC7 A;  2FUD A;  3IV2 A;  4WA6 A;  3PNR A;  3PDF A;  1BQI A;  4REZ A;  1YK8 A;  2OP3 A;  4A5U A;  1O0E A;  4DMY A;  5EZQ A;  3H7D A;  2R9C A;  5KO3 A;  3OVZ A;  2HD5 A;  1U9W A;  1NL6 A;  2DC9 A;  2G7Y A;  3IOQ A;  1X9Y A;  4IP3 A;  4PI3 A;  2IBI A;  2B1N A;  3PRM A;  4OEM A;  2G6D A;  4RNA A;  2AVW A;  2PAD A;  1GLO A;  4N79 A;  2DCA A;  2PRE A;  3S3Q A;  3CH3 X;  3NHE A;  3IMA A;  1AU0 A;  3BWK A;  4BQV A;  1XKG A;  2OUL A;  4X6H A;  1KHP A;  4X6I A;  2DCC A;  4DMX A;  4R3D A;  3E1Z B;  2XU3 A;  3O65 A;  4YYW A;  2FQ9 A;  3HHA A;  4OVZ A;  1YAL A;  1VJV A;  3TRK A;  4MI7 A;  4QRX A;  3TMP A;  2PBH A;  1QXP A;  3O1G A;  3BBA A;  4D8E A;  4XUI A;  4MZS A;  3B79 A;  3USV A;  3H8C A;  4W4U A;  4ZTB A;  3BPF A;  5JH3 A;  3LXS A;  5CHV A;  2Y5B A;  5J94 A;  2PNS A;  1MIR A;  4HWY A;  3K8U A;  4BPV A;  1F2B A;  2C0Y A;  2Y6E A;  3KKU A;  2YJC A;  2Z84 A;  4BSQ A;  4YYS A;  3PBH A;  2VHF A;  3QT4 A;  2DC6 A;  4N4Z A;  1Y4H A;  7PCK A;  4YYR A;  3I06 A;  4D8B A;  1ME3 A;  3IEJ A;  3ERV A;  6PAD A;  5CHT A;  4Q8G A;  1CB5 A;  1PVJ A;  3P5U A;  2GHU A;  2DZZ A;  2YJ9 A;  5CVO B;  1NB3 A;  4BOS A;  1MS6 A;  3HHI A;  2HXZ A;  1MHW A;  1KFX L;  4CDC B;  1UKF A;  5PAD A;  3BCN A;  1SNK A;  2WBF X;  8PCH A;  1ATK A;  2G8E A;  4Q8H A;  3TNX A;  2XU1 A;  4OEL A;  1ZCM A;  1GCB A;  2BDL A;  3GCB A;  3HWN A;  1EWP A;  1YT7 A;  4PAD A;  3K24 A;  2P86 A;  5EZS A;  4BOZ A;  3PRP A;  2J7Q A;  4AXM A;  2J7Q C;  1PIP A;  3N4C A;  4W5C A;  2ACT A;  1HUC B;  2R9O A;  1EWO A;  2JRI A;  1U9X A;  2FRA A;  3HD3 A;  3WXF A;  3IFU A;  4MSX A;  2R9N A;  3MOR A;  2G8J A;  4I04 A;  3DF0 A;  3V6C A;  1CV8 A;  4FK5 A; 
#chains in the Genus database with same CATH homology
 1PBH A;  3OIS A;  1MDW A;  2H7J A;  2DCB A;  4FIP A;  1U9Q X;  1CSB B;  3D6S A;  2XU5 A;  2HHN A;  1QDQ A;  3D9W A;  3F75 A;  1FH0 A;  2DJG B;  1ICF A;  1W5R A;  3WXE A;  2P0R A;  1PXV A;  1CJL A;  3CBK A;  1KFU L;  2ATO A;  1PPO A;  4P6G A;  4YVA A;  4KLB A;  3BPM A;  1ITO A;  1GMY A;  1CPJ A;  2E01 A;  5F02 A;  5CVM A;  2AU1 A;  1TL9 A;  1DF0 A;  2YJ8 A;  3CBJ A;  4PP1 A;  1NPZ A;  2GFO A;  2JQF R;  3AI8 A;  2DC8 A;  1F29 A;  1SP4 B;  3KX1 A;  1Y08 A;  2E00 A;  4X6J A;  2JQG R;  1AIM A;  1E2T A;  1THE A;  1VSN A;  2AUX A;  4MZO A;  5JA7 A;  1ME4 A;  4PP2 E;  3KWZ A;  3N3K A;  3WXG A;  4G54 A;  3LFY A;  1PE6 A;  4ZUX U;  2YJ2 A;  1PAD A;  3K9M A;  2B1M A;  1NLJ A;  3N3G A;  2DCD A;  4P6E A;  4W5B A;  3P5W A;  3H8B A;  1MEM A;  2R9F A;  3F5V A;  4AXL A;  3PW3 A;  1QOL A;  5FPW A;  1IWD A;  1AYW A;  4FJC A;  1TU6 A;  1JQP A;  5EGW A;  2AIM A;  2OZ2 A;  1YVB A;  1PCI A;  2AYN A;  2R9M A;  4I05 A;  1GEC E;  3S3R A;  3M99 A;  2CB5 A;  3P5X A;  1PPN A;  5EF4 A;  1AYV A;  1ZIV A;  4YV8 A;  2FRQ A;  4I07 A;  3H6S A;  1AU4 A;  1AU3 A;  4NV7 A;  1A6R A;  1POP A;  2NQG A;  3LTW A;  2NQI A;  1AYU A;  3OF8 A;  5A24 A;  4YYV A;  3IHP A;  3RVW A;  3ZUA A;  1AEC A;  3OF9 A;  4QH6 A;  3OVX A;  1KHQ A;  2DZY A;  2O6X A;  4YYU A;  2HH5 A;  2DJF B;  3CH2 X;  4XR7 A;  3U8E A;  1DEU A;  2F7D A;  2NQA A;  3IUT A;  4N8W A;  1EWL A;  3KWB X;  1CQD A;  1TLO A;  1F2C A;  1AU2 A;  3O0U A;  1QMY A;  1U9V A;  2CIO A;  3C9E A;  4BS5 A;  2XU4 A;  4CDD B;  3KSE A;  4CDE B;  3KW9 A;  4K7C A;  3RVV A;  1EF7 A;  3H89 A;  2VHS A;  1M6D A;  1CVZ A;  1EWM A;  2FO5 A;  3BOW A;  1S4V A;  1BP4 A;  2IPP B;  1K3B B;  1BGO A;  5CVN B;  5K16 A;  2AS8 A;  9PAP A;  1MEG A;  2ARY A;  2E03 A;  2AUZ A;  2BDZ A;  4QRG A;  4GUZ A;  4CZW A;  2F1G A;  3P5V A;  3MHS A;  1Q6K A;  4BS6 A;  2R6N A;  3KFQ A;  3RVX A;  1CS8 A;  3BC3 A;  4QBB A;  2E02 A;  4YYQ A;  1BY8 A;  1PPD A;  2VFB A;  1KXR A;  4QRV A;  4CDF B;  2P7U A;  1NQC A;  1NB5 A;  3QJ3 A;  3I3T A;  3V6E A;  2FYE A;  4NV8 A;  1F2A A;  1GX3 A;  2NQD B;  4RY2 A;  1PPP A;  1YK7 A;  3MTN A;  2FT2 A;  2AYO A;  1STF E;  1CTE A;  3QSD A;  1U5I A;  2YJB A;  3MHH A;  2FTD A;  2DC7 A;  2FUD A;  3IV2 A;  4WA6 A;  3PNR A;  3PDF A;  4B55 A;  1BQI A;  1W4T A;  1YK8 A;  2OP3 A;  1O0E A;  4DMY A;  3H7D A;  2R9C A;  2BSZ A;  3OVZ A;  2HD5 A;  1U9W A;  1NL6 A;  2DC9 A;  2G7Y A;  3IOQ A;  1X9Y A;  4PI3 A;  2IBI A;  2B1N A;  4OEM A;  2G6D A;  2AVW A;  2PAD A;  1GLO A;  4N79 A;  2DCA A;  2PRE A;  3S3Q A;  3CH3 X;  3NHE A;  2VFC A;  3IMA A;  1AU0 A;  3BWK A;  4BQV A;  1XKG A;  2OUL A;  4X6H A;  1KHP A;  4X6I A;  2DCC A;  4DMX A;  3E1Z B;  2XU3 A;  4YYW A;  4BGF A;  2FQ9 A;  3HHA A;  1YAL A;  1VJV A;  4QRX A;  4C5P A;  2PBH A;  1QXP A;  3O1G A;  4XUI A;  4MZS A;  3B79 A;  3USV A;  3H8C A;  4W4U A;  3BPF A;  5JH3 A;  3LXS A;  5CHV A;  2Y5B A;  5J94 A;  2PNS A;  1MIR A;  4HWY A;  3K8U A;  4BPV A;  1F2B A;  2C0Y A;  2Y6E A;  3KKU A;  2YJC A;  4BSQ A;  4YYS A;  3PBH A;  2VHF A;  3QT4 A;  2DC6 A;  4N4Z A;  1Y4H A;  7PCK A;  4YYR A;  3I06 A;  1ME3 A;  3IEJ A;  3ERV A;  6PAD A;  5CHT A;  4Q8G A;  1CB5 A;  3P5U A;  2GHU A;  2DZZ A;  2YJ9 A;  5CVO B;  1NB3 A;  1MS6 A;  3HHI A;  2HXZ A;  1MHW A;  1KFX L;  4CDC B;  5PAD A;  3BCN A;  1SNK A;  2WBF X;  8PCH A;  1ATK A;  2G8E A;  4Q8H A;  3TNX A;  2XU1 A;  4OEL A;  1ZCM A;  1GCB A;  2BDL A;  3GCB A;  3HWN A;  1EWP A;  1YT7 A;  4PAD A;  3K24 A;  2P86 A;  4AXM A;  1PIP A;  3N4C A;  4W5C A;  2ACT A;  1HUC B;  2R9O A;  1EWO A;  1U9X A;  2FRA A;  3HD3 A;  1W6F A;  3WXF A;  4MSX A;  2R9N A;  3MOR A;  2G8J A;  4I04 A;  3DF0 A;  3V6C A;  1CV8 A;  4FK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...