3N3KA

The catalytic domain of usp8 in complex with a usp8 specific inhibitor
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
355
structure length
355
Chain Sequence
RLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A strategy for modulation of enzymes in the ubiquitin system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 113
structure length 355
sequence length 355
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00443 UCH Ubiquitin carboxyl-terminal hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3n3kA00
2BDZA 1AYVA 1NPZA 3KSEA 3KWBX 2DC9A 1CS8A 4I05A 2R9MA 1CV8A 4YYUA 3O1GA 3MHSA 2XU3A 1KFXL 2AUZA 1U9VA 4HWYA 1AU3A 1PPNA 3RVXA 2R9NA 1YVBA 1SNKA 2OULA 3F5VA 2CB5A 4WA6A 2DJFB 3QSDA 4CDCB 2NQDB 2YJCA 4W4UA 2AYOA 2FO5A 2NQGA 2F7DA 4BS5A 1MIRA 2OP3A 4G54A 1K3BB 3OISA 2R6NA 4AXLA 3H8CA 2O6XA 4FIPA 1CB5A 3HWNA 4MZSA 4QBBA 4OELA 1TL9A 2AU1A 3U8EA 4XUIA 1ITOA 2R9OA 2AIMA 1PADA 2JQFR 4PP1A 2ACTA 3BCNA 4W5CA 3F75A 3USVA 1KFUL 2JQGR 3CBKA 1PPPA 1HUCB 2YJ8A 2DC6A 3I06A 3QT4A 3H6SA 2FT2A 1QXPA 3S3QA 7PCKA 1PE6A 2G7YA 4I04A 4PP2E 1F2CA 6PADA 3GCBA 2IBIA 2GHUA 3H8BA 4N79A 3H89A 3PBHA 1BGOA 4X6HA 3CBJA 4PADA 2XU5A 1F2AA 1MDWA 1ATKA 2B1NA 3PNRA 2DJGB 3KKUA 2VHFA 9PAPA 3IOQA 3KWZA 2DC7A 3MORA 1MEGA 1AU4A 1O0EA 2P0RA 1YALA 3H7DA 2R9FA 1PCIA 3WXEA 3BPFA 3HHAA 3BPMA 2PREA 4MZOA 3KW9A 4RY2A 2E01A 2E02A 2ARYA 4BPVA 1Y08A 3RVWA 1POPA 4QRGA 4BSQA 3V6CA 4CDDB 3S3RA 2PADA 1BY8A 1CSBB 1PPDA 3ZUAA 3B79A 2HD5A 2HH5A 1EWMA 2G8JA 3N3KA 1ZIVA 1KXRA 2B1MA 2NQIA 1AYWA 2AS8A 2OZ2A 4K7CA 2E03A 4X6IA 1MEMA 3PW3A 4DMYA 3E1ZB 1EWLA 3CH3X 3NHEA 2GFOA 1NQCA 3LXSA 4KLBA 1NB5A 2P7UA 3O0UA 1QDQA 2YJBA 2DCBA 4CDFB 3MHHA 2AVWA 1SP4B 3BOWA 1CQDA 3BWKA 2IPPB 1AECA 3N3GA 4PI3A 4QRXA 1S4VA 2NQAA 2XU4A 1CVZA 1BQIA 4MSXA 1PIPA 3WXGA 2FUDA 3M99A 1YK8A 4YVAA 4BS6A 1QMYA 4YYRA 1GCBA 1U5IA 5PADA 1AU2A 3K9MA 1NB3A 2H7JA 1GECE 2E00A 4Q8HA 4OEMA 1GLOA 4FK5A 3IHPA 3OF9A 3V6EA 1X9YA 1EF7A 5EF4A 1ICFA 1MS6A 1U9WA 2FTDA 3AI8A 4I07A 2HHNA 2XU1A 1CTEA 2WBFX 3BC3A 2FQ9A 3IEJA 2PBHA 5CVNB 3P5XA 4XR7A 3KX1A 3IV2A 2FRQA 3ERVA 1NLJA 3DF0A 5JA7A 2AUXA 3C9EA 2P86A 4YYWA 4QRVA 1BP4A 1VSNA 4BQVA 4ZUXU 8PCHA 1F2BA 2G6DA 5CHTA 2DCDA 1ZCMA 1YK7A 1EWPA 1MHWA 4CDEB 3K24A 2BDLA 1TU6A 3P5VA 2DZZA 4YYQA 3CH2X 5CHVA 1DF0A 2YJ9A 1CPJA 3IUTA 3KFQA 1Y4HA 5EGWA 3HHIA 1QOLA 1AIMA 2CIOA 1VJVA 3K8UA 4X6JA 1KHQA 1TLOA 3OVZA 1F29A 2Y6EA 2PNSA 1PBHA 1U9XA 4QH6A 2DCCA 2FRAA 1CJLA 3LFYA 3P5WA 2AYNA 3HD3A 1PPOA 4P6EA 5F02A 1U9QX 1DEUA 1ME3A 2DC8A 1NL6A 4CZWA 1PXVA 1THEA 4YV8A 1ME4A 2G8EA 4W5BA 1KHPA 3RVVA 5JH3A 1EWOA 3P5UA 1Q6KA 1JQPA 5FPWA 4YYVA 4Q8GA 1A6RA 4DMXA 5A24A 1IWDA 3MTNA 2R9CA 2DCAA 5K16A 2C0YA 2YJ2A 1XKGA 1GMYA 3QJ3A 3PDFA 4P6GA 3D6SA 4N4ZA 2F1GA 4FJCA 1YT7A 1STFE 3IMAA 3WXFA 2VHSA 1AYUA 3OF8A 5CVMA 3N4CA 2HXZA 3TNXA 5J94A 5CVOB 2Y5BA 2FYEA 1M6DA 2ATOA 3I3TA 4AXMA 4YYSA 1FH0A 4N8WA 1AU0A 3OVXA 2DZYA
chains in the Genus database with same CATH superfamily
2BDZA 5EZSA 2BTWA 4BOSA 1AYVA 1NPZA 3KSEA 3KWBX 2DC9A 1CS8A 4I05A 2R9MA 1CV8A 4YYUA 3O1GA 3MHSA 2XU3A 1KFXL 2AUZA 1U9VA 4HWYA 1YZBA 1AU3A 1PPNA 4OW0A 3RVXA 2R9NA 3PHWA 1YVBA 1SNKA 2OULA 3F5VA 2CB5A 4WA6A 2DJFB 3QSDA 4BOPA 4CDCB 2NQDB 2YJCA 4W4UA 2AYOA 2FO5A 2NQGA 3BY4A 2F7DA 4BS5A 1MIRA 2OP3A 4G54A 1K3BB 3OISA 4M0WA 2R6NA 4AXLA 3H8CA 2O6XA 4FIPA 1CB5A 3HWNA 4MZSA 4QBBA 4RF0A 4OELA 1TL9A 2AU1A 3U8EA 4XUIA 2HWKA 1ITOA 3MP2A 4HXDB 2R9OA 3TMPA 4RF1A 2AIMA 1PADA 2JQFR 4PP1A 4IUMA 2ACTA 3BCNA 4W5CA 3F75A 3USVA 1KFUL 2JQGR 3CBKA 4PT5A 1PPPA 1HUCB 4GUAA 2YJ8A 2DC6A 3I06A 3QT4A 3H6SA 2FT2A 1QXPA 3S3QA 7PCKA 1PE6A 2G7YA 4I04A 4PP2E 1F2CA 2J7QA 6PADA 3GCBA 2IBIA 2GHUA 3H8BA 4N79A 3H89A 3PBHA 1BGOA 4X6HA 3CBJA 4PADA 2XU5A 3MTVA 4ZTBA 1F2AA 1MDWA 1ATKA 2B1NA 3PNRA 2DJGB 3KKUA 2VHFA 9PAPA 3IOQA 3KWZA 3RNVA 2DC7A 3MORA 1MEGA 1AU4A 1O0EA 3H7DA 1YALA 2P0RA 2R9FA 1PCIA 3MJ5A 3WXEA 4BOZA 3BPFA 3HHAA 3BPMA 2PREA 4MZOA 3KW9A 4RY2A 2E01A 2E02A 2ARYA 4BPVA 1Y08A 3RVWA 1POPA 4QRGA 4BSQA 3V6CA 4CDDB 3S3RA 2PADA 1BY8A 1CSBB 1PPDA 3ZUAA 3B79A 2HD5A 2HH5A 1EWMA 2G8JA 3N3KA 1ZIVA 1KXRA 2B1MA 2NQIA 1AYWA 2AS8A 2OZ2A 4K7CA 2E03A 4X6IA 1MEMA 3PW3A 4DMYA 3E1ZB 1EWLA 3CH3X 3NHEA 2GFOA 1NQCA 3LXSA 4KLBA 4XZXA 1NB5A 2P7UA 3BBAA 3O0UA 1QDQA 2YJBA 2DCBA 4CDFB 3MHHA 2AVWA 3TRKA 1SP4B 3BOWA 1CQDA 3BWKA 3PSEA 2IPPB 1AECA 3N3GA 4PI3A 4QRXA 1S4VA 2NQAA 2XU4A 1CVZA 1BQIA 1PVJA 4MSXA 1PIPA 4REZA 3WXGA 2FUDA 3M99A 1YK8A 4YVAA 4BS6A 1QMYA 4YYRA 2JRIA 1GCBA 1U5IA 5PADA 1AU2A 3K9MA 1NB3A 2H7JA 1GECE 2FE8A 2E00A 4Q8HA 4OEMA 4A5UA 1GLOA 4FK5A 3IHPA 3OF9A 3V6EA 1X9YA 2DOSA 1EF7A 5EF4A 1ICFA 1MS6A 4WURA 1U9WA 2FTDA 3AI8A 4I07A 2HHNA 2XU1A 3BB7A 4RKXA 2BTWB 1CTEA 2WBFX 3BC3A 2FQ9A 3IEJA 2PBHA 5CVNB 3P5XA 4XR7A 5EZQA 3KX1A 3PHUA 3IV2A 2FRQA 3ERVA 2BU3A 3PT2A 1NLJA 2Z84A 3DF0A 5JA7A 2AUXA 3C9EA 2P86A 4YYWA 4QRVA 1BP4A 1VSNA 4BQVA 4ZUXU 8PCHA 1F2BA 3C0RA 2AGAA 2G6DA 5CHTA 2DCDA 4RNAA 2UZJA 1ZCMA 4D8IA 1YK7A 1EWPA 1MHWA 4CDEB 4D8BA 3K24A 2BDLA 4D8EA 1TU6A 3P5VA 2DZZA 4YYQA 3CH2X 5CHVA 1DF0A 2YJ9A 1CPJA 3IUTA 3KFQA 1Y4HA 4P16A 5EGWA 3HHIA 1AIMA 1QOLA 1DKIA 2CIOA 1VJVA 3W30A 5KO3A 3K8UA 4X6JA 1KHQA 1TLOA 4IP3A 3OVZA 4MM3B 1F29A 2Y6EA 2PNSA 1PBHA 1U9XA 4QH6A 2DCCA 2FRAA 1CJLA 3PRMA 3LFYA 3P5WA 2AYNA 3HD3A 1PPOA 4P6EA 5F02A 1U9QX 1DEUA 1ME3A 2DC8A 1NL6A 4CZWA 1PXVA 1THEA 4YV8A 3O65A 3PHXA 1ME4A 2G8EA 3IFUA 4W5BA 1KHPA 3RVVA 5JH3A 1EWOA 3P5UA 1Q6KA 1JQPA 5FPWA 3OQCA 4YYVA 4Q8GA 1A6RA 3E9SA 4DMXA 5A24A 1IWDA 3MTNA 3ZNHA 2R9CA 2DCAA 5K16A 2C0YA 4OVZB 3B21A 2YJ2A 1XKGA 2J7QC 1GMYA 4MI7A 3QJ3A 3PDFA 4P6GA 3D6SA 4N4ZA 2F1GA 4FJCA 1YT7A 4R3DA 2JTCA 1STFE 3IMAA 3WXFA 2VHSA 1AYUA 3OF8A 5CVMA 3N4CA 2HXZA 3TNXA 5J94A 5CVOB 5E6JA 2Y5BA 5JZEA 2FYEA 4OVZA 1M6DA 3PRPA 2ATOA 3I3TA 4BOQA 4AXMA 1UKFA 4BOUA 4YYSA 1FH0A 4N8WA 1AU0A 3OVXA 3W31A 2DZYA
chains in the Genus database with same CATH topology
2BDZA 1AYVA 1NPZA 4NV8A 3KSEA 3KWBX 2DC9A 1CS8A 4I05A 2R9MA 1CV8A 4YYUA 3O1GA 3MHSA 2XU3A 1KFXL 2AUZA 1U9VA 4HWYA 1AU3A 1PPNA 3RVXA 2R9NA 1YVBA 1SNKA 2OULA 3F5VA 2CB5A 4WA6A 2DJFB 3QSDA 4CDCB 2NQDB 2YJCA 4W4UA 2AYOA 2FO5A 2NQGA 2F7DA 4BS5A 1MIRA 2OP3A 4G54A 1K3BB 3OISA 2R6NA 4AXLA 3H8CA 2O6XA 4FIPA 1CB5A 4BGFA 3HWNA 4MZSA 4QBBA 4OELA 1TL9A 2AU1A 3U8EA 4XUIA 1ITOA 1W6FA 2R9OA 2AIMA 1PADA 2JQFR 4PP1A 2ACTA 3BCNA 4W5CA 3F75A 3USVA 1KFUL 2JQGR 3CBKA 1PPPA 1HUCB 2YJ8A 2DC6A 3I06A 3QT4A 3H6SA 2FT2A 3LTWA 1QXPA 3S3QA 7PCKA 1PE6A 2G7YA 4I04A 4PP2E 1F2CA 6PADA 3GCBA 2IBIA 2GHUA 3H8BA 4N79A 3H89A 3PBHA 1BGOA 4X6HA 3CBJA 4PADA 2XU5A 2VFCA 1F2AA 1MDWA 1ATKA 2B1NA 3PNRA 2DJGB 3KKUA 2VHFA 9PAPA 3IOQA 3KWZA 2DC7A 3MORA 1MEGA 1AU4A 1O0EA 2P0RA 1YALA 3H7DA 2R9FA 1PCIA 3D9WA 3WXEA 3BPFA 3HHAA 3BPMA 2PREA 4MZOA 3KW9A 4RY2A 2E01A 2E02A 2ARYA 4BPVA 1Y08A 3RVWA 1POPA 4QRGA 4BSQA 3V6CA 4CDDB 3S3RA 2PADA 1BY8A 1CSBB 1PPDA 3ZUAA 3B79A 2HD5A 2HH5A 1EWMA 2G8JA 3N3KA 1ZIVA 1KXRA 2B1MA 2NQIA 1AYWA 2AS8A 4C5PA 2OZ2A 4K7CA 2E03A 4X6IA 1MEMA 3PW3A 4DMYA 3E1ZB 1EWLA 3CH3X 3NHEA 2GFOA 1NQCA 3LXSA 4KLBA 2VFBA 1NB5A 2P7UA 3O0UA 1QDQA 2YJBA 2DCBA 4CDFB 3MHHA 2AVWA 1SP4B 3BOWA 1CQDA 3BWKA 2IPPB 1AECA 3N3GA 4PI3A 4QRXA 1S4VA 2NQAA 2XU4A 1CVZA 1BQIA 4MSXA 1PIPA 3WXGA 2FUDA 3M99A 1YK8A 4YVAA 4BS6A 1QMYA 4YYRA 1GCBA 1U5IA 5PADA 1AU2A 3K9MA 1NB3A 2H7JA 1GECE 2E00A 4Q8HA 4OEMA 1GLOA 4FK5A 3IHPA 3OF9A 3V6EA 1X9YA 1EF7A 5EF4A 1ICFA 1MS6A 1U9WA 2FTDA 3AI8A 4I07A 2HHNA 2XU1A 1CTEA 2WBFX 3BC3A 2FQ9A 4NV7A 3IEJA 2PBHA 5CVNB 3P5XA 4XR7A 1GX3A 3KX1A 3IV2A 2FRQA 3ERVA 1NLJA 3DF0A 5JA7A 2AUXA 3C9EA 2P86A 4YYWA 4QRVA 1BP4A 1VSNA 4BQVA 4ZUXU 8PCHA 1F2BA 2G6DA 5CHTA 2DCDA 1ZCMA 1YK7A 1EWPA 1MHWA 4CDEB 3K24A 2BDLA 1TU6A 3P5VA 2DZZA 4YYQA 3CH2X 5CHVA 1DF0A 1E2TA 2YJ9A 1CPJA 3IUTA 3KFQA 1Y4HA 5EGWA 3HHIA 1QOLA 1AIMA 2CIOA 1VJVA 3K8UA 4X6JA 1KHQA 1TLOA 3OVZA 1F29A 2Y6EA 2PNSA 1PBHA 1U9XA 4QH6A 2DCCA 2FRAA 1CJLA 3LFYA 3P5WA 2AYNA 3HD3A 1PPOA 4P6EA 5F02A 1U9QX 1DEUA 1ME3A 2DC8A 1NL6A 4CZWA 1PXVA 1THEA 4YV8A 1ME4A 1W5RA 2G8EA 4W5BA 1KHPA 3RVVA 5JH3A 1EWOA 3P5UA 1Q6KA 1JQPA 5FPWA 4GUZA 4YYVA 4B55A 4Q8GA 1A6RA 4DMXA 5A24A 1IWDA 3MTNA 1W4TA 2R9CA 2DCAA 5K16A 2C0YA 2YJ2A 1XKGA 2BSZA 1GMYA 3QJ3A 3PDFA 4P6GA 3D6SA 4N4ZA 2F1GA 4FJCA 1YT7A 1STFE 3IMAA 3WXFA 2VHSA 1AYUA 3OF8A 5CVMA 3N4CA 2HXZA 3TNXA 5J94A 5CVOB 2Y5BA 2FYEA 1M6DA 2ATOA 3I3TA 4AXMA 4YYSA 1FH0A 4N8WA 1AU0A 3OVXA 2DZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDZ A;  1AYV A;  1NPZ A;  3KSE A;  3KWB X;  2DC9 A;  1CS8 A;  4I05 A;  2R9M A;  1CV8 A;  4YYU A;  3O1G A;  3MHS A;  2XU3 A;  1KFX L;  2AUZ A;  1U9V A;  4HWY A;  1AU3 A;  1PPN A;  3RVX A;  2R9N A;  1YVB A;  1SNK A;  2OUL A;  3F5V A;  2CB5 A;  4WA6 A;  2DJF B;  3QSD A;  4CDC B;  2NQD B;  2YJC A;  4W4U A;  2AYO A;  2FO5 A;  2NQG A;  2F7D A;  4BS5 A;  1MIR A;  2OP3 A;  4G54 A;  1K3B B;  3OIS A;  2R6N A;  4AXL A;  3H8C A;  2O6X A;  4FIP A;  1CB5 A;  3HWN A;  4MZS A;  4QBB A;  4OEL A;  1TL9 A;  2AU1 A;  3U8E A;  4XUI A;  1ITO A;  2R9O A;  2AIM A;  1PAD A;  2JQF R;  4PP1 A;  2ACT A;  3BCN A;  4W5C A;  3F75 A;  3USV A;  1KFU L;  2JQG R;  3CBK A;  1PPP A;  1HUC B;  2YJ8 A;  2DC6 A;  3I06 A;  3QT4 A;  3H6S A;  2FT2 A;  1QXP A;  3S3Q A;  7PCK A;  1PE6 A;  2G7Y A;  4I04 A;  4PP2 E;  1F2C A;  6PAD A;  3GCB A;  2IBI A;  2GHU A;  3H8B A;  4N79 A;  3H89 A;  3PBH A;  1BGO A;  4X6H A;  3CBJ A;  4PAD A;  2XU5 A;  1F2A A;  1MDW A;  1ATK A;  2B1N A;  3PNR A;  2DJG B;  3KKU A;  2VHF A;  9PAP A;  3IOQ A;  3KWZ A;  2DC7 A;  3MOR A;  1MEG A;  1AU4 A;  1O0E A;  2P0R A;  1YAL A;  3H7D A;  2R9F A;  1PCI A;  3WXE A;  3BPF A;  3HHA A;  3BPM A;  2PRE A;  4MZO A;  3KW9 A;  4RY2 A;  2E01 A;  2E02 A;  2ARY A;  4BPV A;  1Y08 A;  3RVW A;  1POP A;  4QRG A;  4BSQ A;  3V6C A;  4CDD B;  3S3R A;  2PAD A;  1BY8 A;  1CSB B;  1PPD A;  3ZUA A;  3B79 A;  2HD5 A;  2HH5 A;  1EWM A;  2G8J A;  3N3K A;  1ZIV A;  1KXR A;  2B1M A;  2NQI A;  1AYW A;  2AS8 A;  2OZ2 A;  4K7C A;  2E03 A;  4X6I A;  1MEM A;  3PW3 A;  4DMY A;  3E1Z B;  1EWL A;  3CH3 X;  3NHE A;  2GFO A;  1NQC A;  3LXS A;  4KLB A;  1NB5 A;  2P7U A;  3O0U A;  1QDQ A;  2YJB A;  2DCB A;  4CDF B;  3MHH A;  2AVW A;  1SP4 B;  3BOW A;  1CQD A;  3BWK A;  2IPP B;  1AEC A;  3N3G A;  4PI3 A;  4QRX A;  1S4V A;  2NQA A;  2XU4 A;  1CVZ A;  1BQI A;  4MSX A;  1PIP A;  3WXG A;  2FUD A;  3M99 A;  1YK8 A;  4YVA A;  4BS6 A;  1QMY A;  4YYR A;  1GCB A;  1U5I A;  5PAD A;  1AU2 A;  3K9M A;  1NB3 A;  2H7J A;  1GEC E;  2E00 A;  4Q8H A;  4OEM A;  1GLO A;  4FK5 A;  3IHP A;  3OF9 A;  3V6E A;  1X9Y A;  1EF7 A;  5EF4 A;  1ICF A;  1MS6 A;  1U9W A;  2FTD A;  3AI8 A;  4I07 A;  2HHN A;  2XU1 A;  1CTE A;  2WBF X;  3BC3 A;  2FQ9 A;  3IEJ A;  2PBH A;  5CVN B;  3P5X A;  4XR7 A;  3KX1 A;  3IV2 A;  2FRQ A;  3ERV A;  1NLJ A;  3DF0 A;  5JA7 A;  2AUX A;  3C9E A;  2P86 A;  4YYW A;  4QRV A;  1BP4 A;  1VSN A;  4BQV A;  4ZUX U;  8PCH A;  1F2B A;  2G6D A;  5CHT A;  2DCD A;  1ZCM A;  1YK7 A;  1EWP A;  1MHW A;  4CDE B;  3K24 A;  2BDL A;  1TU6 A;  3P5V A;  2DZZ A;  4YYQ A;  3CH2 X;  5CHV A;  1DF0 A;  2YJ9 A;  1CPJ A;  3IUT A;  3KFQ A;  1Y4H A;  5EGW A;  3HHI A;  1QOL A;  1AIM A;  2CIO A;  1VJV A;  3K8U A;  4X6J A;  1KHQ A;  1TLO A;  3OVZ A;  1F29 A;  2Y6E A;  2PNS A;  1PBH A;  1U9X A;  4QH6 A;  2DCC A;  2FRA A;  1CJL A;  3LFY A;  3P5W A;  2AYN A;  3HD3 A;  1PPO A;  4P6E A;  5F02 A;  1U9Q X;  1DEU A;  1ME3 A;  2DC8 A;  1NL6 A;  4CZW A;  1PXV A;  1THE A;  4YV8 A;  1ME4 A;  2G8E A;  4W5B A;  1KHP A;  3RVV A;  5JH3 A;  1EWO A;  3P5U A;  1Q6K A;  1JQP A;  5FPW A;  4YYV A;  4Q8G A;  1A6R A;  4DMX A;  5A24 A;  1IWD A;  3MTN A;  2R9C A;  2DCA A;  5K16 A;  2C0Y A;  2YJ2 A;  1XKG A;  1GMY A;  3QJ3 A;  3PDF A;  4P6G A;  3D6S A;  4N4Z A;  2F1G A;  4FJC A;  1YT7 A;  1STF E;  3IMA A;  3WXF A;  2VHS A;  1AYU A;  3OF8 A;  5CVM A;  3N4C A;  2HXZ A;  3TNX A;  5J94 A;  5CVO B;  2Y5B A;  2FYE A;  1M6D A;  2ATO A;  3I3T A;  4AXM A;  4YYS A;  1FH0 A;  4N8W A;  1AU0 A;  3OVX A;  2DZY A; 
#chains in the Genus database with same CATH topology
 2BDZ A;  5EZS A;  2BTW A;  4BOS A;  1AYV A;  1NPZ A;  3KSE A;  3KWB X;  2DC9 A;  1CS8 A;  4I05 A;  2R9M A;  1CV8 A;  4YYU A;  3O1G A;  3MHS A;  2XU3 A;  1KFX L;  2AUZ A;  1U9V A;  4HWY A;  1YZB A;  1AU3 A;  1PPN A;  4OW0 A;  3RVX A;  2R9N A;  3PHW A;  1YVB A;  1SNK A;  2OUL A;  3F5V A;  2CB5 A;  4WA6 A;  2DJF B;  3QSD A;  4BOP A;  4CDC B;  2NQD B;  2YJC A;  4W4U A;  2AYO A;  2FO5 A;  2NQG A;  3BY4 A;  2F7D A;  4BS5 A;  1MIR A;  2OP3 A;  4G54 A;  1K3B B;  3OIS A;  4M0W A;  2R6N A;  4AXL A;  3H8C A;  2O6X A;  4FIP A;  1CB5 A;  3HWN A;  4MZS A;  4QBB A;  4RF0 A;  4OEL A;  1TL9 A;  2AU1 A;  3U8E A;  4XUI A;  2HWK A;  1ITO A;  3MP2 A;  4HXD B;  2R9O A;  3TMP A;  4RF1 A;  2AIM A;  1PAD A;  2JQF R;  4PP1 A;  4IUM A;  2ACT A;  3BCN A;  4W5C A;  3F75 A;  3USV A;  1KFU L;  2JQG R;  3CBK A;  4PT5 A;  1PPP A;  1HUC B;  4GUA A;  2YJ8 A;  2DC6 A;  3I06 A;  3QT4 A;  3H6S A;  2FT2 A;  1QXP A;  3S3Q A;  7PCK A;  1PE6 A;  2G7Y A;  4I04 A;  4PP2 E;  1F2C A;  2J7Q A;  6PAD A;  3GCB A;  2IBI A;  2GHU A;  3H8B A;  4N79 A;  3H89 A;  3PBH A;  1BGO A;  4X6H A;  3CBJ A;  4PAD A;  2XU5 A;  3MTV A;  4ZTB A;  1F2A A;  1MDW A;  1ATK A;  2B1N A;  3PNR A;  2DJG B;  3KKU A;  2VHF A;  9PAP A;  3IOQ A;  3KWZ A;  3RNV A;  2DC7 A;  3MOR A;  1MEG A;  1AU4 A;  1O0E A;  3H7D A;  1YAL A;  2P0R A;  2R9F A;  1PCI A;  3MJ5 A;  3WXE A;  4BOZ A;  3BPF A;  3HHA A;  3BPM A;  2PRE A;  4MZO A;  3KW9 A;  4RY2 A;  2E01 A;  2E02 A;  2ARY A;  4BPV A;  1Y08 A;  3RVW A;  1POP A;  4QRG A;  4BSQ A;  3V6C A;  4CDD B;  3S3R A;  2PAD A;  1BY8 A;  1CSB B;  1PPD A;  3ZUA A;  3B79 A;  2HD5 A;  2HH5 A;  1EWM A;  2G8J A;  3N3K A;  1ZIV A;  1KXR A;  2B1M A;  2NQI A;  1AYW A;  2AS8 A;  2OZ2 A;  4K7C A;  2E03 A;  4X6I A;  1MEM A;  3PW3 A;  4DMY A;  3E1Z B;  1EWL A;  3CH3 X;  3NHE A;  2GFO A;  1NQC A;  3LXS A;  4KLB A;  4XZX A;  1NB5 A;  2P7U A;  3BBA A;  3O0U A;  1QDQ A;  2YJB A;  2DCB A;  4CDF B;  3MHH A;  2AVW A;  3TRK A;  1SP4 B;  3BOW A;  1CQD A;  3BWK A;  3PSE A;  2IPP B;  1AEC A;  3N3G A;  4PI3 A;  4QRX A;  1S4V A;  2NQA A;  2XU4 A;  1CVZ A;  1BQI A;  1PVJ A;  4MSX A;  1PIP A;  4REZ A;  3WXG A;  2FUD A;  3M99 A;  1YK8 A;  4YVA A;  4BS6 A;  1QMY A;  4YYR A;  2JRI A;  1GCB A;  1U5I A;  5PAD A;  1AU2 A;  3K9M A;  1NB3 A;  2H7J A;  1GEC E;  2FE8 A;  2E00 A;  4Q8H A;  4OEM A;  4A5U A;  1GLO A;  4FK5 A;  3IHP A;  3OF9 A;  3V6E A;  1X9Y A;  2DOS A;  1EF7 A;  5EF4 A;  1ICF A;  1MS6 A;  4WUR A;  1U9W A;  2FTD A;  3AI8 A;  4I07 A;  2HHN A;  2XU1 A;  3BB7 A;  4RKX A;  2BTW B;  1CTE A;  2WBF X;  3BC3 A;  2FQ9 A;  3IEJ A;  2PBH A;  5CVN B;  3P5X A;  4XR7 A;  5EZQ A;  3KX1 A;  3PHU A;  3IV2 A;  2FRQ A;  3ERV A;  2BU3 A;  3PT2 A;  1NLJ A;  2Z84 A;  3DF0 A;  5JA7 A;  2AUX A;  3C9E A;  2P86 A;  4YYW A;  4QRV A;  1BP4 A;  1VSN A;  4BQV A;  4ZUX U;  8PCH A;  1F2B A;  3C0R A;  2AGA A;  2G6D A;  5CHT A;  2DCD A;  4RNA A;  2UZJ A;  1ZCM A;  4D8I A;  1YK7 A;  1EWP A;  1MHW A;  4CDE B;  4D8B A;  3K24 A;  2BDL A;  4D8E A;  1TU6 A;  3P5V A;  2DZZ A;  4YYQ A;  3CH2 X;  5CHV A;  1DF0 A;  2YJ9 A;  1CPJ A;  3IUT A;  3KFQ A;  1Y4H A;  4P16 A;  5EGW A;  3HHI A;  1AIM A;  1QOL A;  1DKI A;  2CIO A;  1VJV A;  3W30 A;  5KO3 A;  3K8U A;  4X6J A;  1KHQ A;  1TLO A;  4IP3 A;  3OVZ A;  4MM3 B;  1F29 A;  2Y6E A;  2PNS A;  1PBH A;  1U9X A;  4QH6 A;  2DCC A;  2FRA A;  1CJL A;  3PRM A;  3LFY A;  3P5W A;  2AYN A;  3HD3 A;  1PPO A;  4P6E A;  5F02 A;  1U9Q X;  1DEU A;  1ME3 A;  2DC8 A;  1NL6 A;  4CZW A;  1PXV A;  1THE A;  4YV8 A;  3O65 A;  3PHX A;  1ME4 A;  2G8E A;  3IFU A;  4W5B A;  1KHP A;  3RVV A;  5JH3 A;  1EWO A;  3P5U A;  1Q6K A;  1JQP A;  5FPW A;  3OQC A;  4YYV A;  4Q8G A;  1A6R A;  3E9S A;  4DMX A;  5A24 A;  1IWD A;  3MTN A;  3ZNH A;  2R9C A;  2DCA A;  5K16 A;  2C0Y A;  4OVZ B;  3B21 A;  2YJ2 A;  1XKG A;  2J7Q C;  1GMY A;  4MI7 A;  3QJ3 A;  3PDF A;  4P6G A;  3D6S A;  4N4Z A;  2F1G A;  4FJC A;  1YT7 A;  4R3D A;  2JTC A;  1STF E;  3IMA A;  3WXF A;  2VHS A;  1AYU A;  3OF8 A;  5CVM A;  3N4C A;  2HXZ A;  3TNX A;  5J94 A;  5CVO B;  5E6J A;  2Y5B A;  5JZE A;  2FYE A;  4OVZ A;  1M6D A;  3PRP A;  2ATO A;  3I3T A;  4BOQ A;  4AXM A;  1UKF A;  4BOU A;  4YYS A;  1FH0 A;  4N8W A;  1AU0 A;  3OVX A;  3W31 A;  2DZY A; 
#chains in the Genus database with same CATH homology
 2BDZ A;  1AYV A;  1NPZ A;  4NV8 A;  3KSE A;  3KWB X;  2DC9 A;  1CS8 A;  4I05 A;  2R9M A;  1CV8 A;  4YYU A;  3O1G A;  3MHS A;  2XU3 A;  1KFX L;  2AUZ A;  1U9V A;  4HWY A;  1AU3 A;  1PPN A;  3RVX A;  2R9N A;  1YVB A;  1SNK A;  2OUL A;  3F5V A;  2CB5 A;  4WA6 A;  2DJF B;  3QSD A;  4CDC B;  2NQD B;  2YJC A;  4W4U A;  2AYO A;  2FO5 A;  2NQG A;  2F7D A;  4BS5 A;  1MIR A;  2OP3 A;  4G54 A;  1K3B B;  3OIS A;  2R6N A;  4AXL A;  3H8C A;  2O6X A;  4FIP A;  1CB5 A;  4BGF A;  3HWN A;  4MZS A;  4QBB A;  4OEL A;  1TL9 A;  2AU1 A;  3U8E A;  4XUI A;  1ITO A;  1W6F A;  2R9O A;  2AIM A;  1PAD A;  2JQF R;  4PP1 A;  2ACT A;  3BCN A;  4W5C A;  3F75 A;  3USV A;  1KFU L;  2JQG R;  3CBK A;  1PPP A;  1HUC B;  2YJ8 A;  2DC6 A;  3I06 A;  3QT4 A;  3H6S A;  2FT2 A;  3LTW A;  1QXP A;  3S3Q A;  7PCK A;  1PE6 A;  2G7Y A;  4I04 A;  4PP2 E;  1F2C A;  6PAD A;  3GCB A;  2IBI A;  2GHU A;  3H8B A;  4N79 A;  3H89 A;  3PBH A;  1BGO A;  4X6H A;  3CBJ A;  4PAD A;  2XU5 A;  2VFC A;  1F2A A;  1MDW A;  1ATK A;  2B1N A;  3PNR A;  2DJG B;  3KKU A;  2VHF A;  9PAP A;  3IOQ A;  3KWZ A;  2DC7 A;  3MOR A;  1MEG A;  1AU4 A;  1O0E A;  2P0R A;  1YAL A;  3H7D A;  2R9F A;  1PCI A;  3D9W A;  3WXE A;  3BPF A;  3HHA A;  3BPM A;  2PRE A;  4MZO A;  3KW9 A;  4RY2 A;  2E01 A;  2E02 A;  2ARY A;  4BPV A;  1Y08 A;  3RVW A;  1POP A;  4QRG A;  4BSQ A;  3V6C A;  4CDD B;  3S3R A;  2PAD A;  1BY8 A;  1CSB B;  1PPD A;  3ZUA A;  3B79 A;  2HD5 A;  2HH5 A;  1EWM A;  2G8J A;  3N3K A;  1ZIV A;  1KXR A;  2B1M A;  2NQI A;  1AYW A;  2AS8 A;  4C5P A;  2OZ2 A;  4K7C A;  2E03 A;  4X6I A;  1MEM A;  3PW3 A;  4DMY A;  3E1Z B;  1EWL A;  3CH3 X;  3NHE A;  2GFO A;  1NQC A;  3LXS A;  4KLB A;  2VFB A;  1NB5 A;  2P7U A;  3O0U A;  1QDQ A;  2YJB A;  2DCB A;  4CDF B;  3MHH A;  2AVW A;  1SP4 B;  3BOW A;  1CQD A;  3BWK A;  2IPP B;  1AEC A;  3N3G A;  4PI3 A;  4QRX A;  1S4V A;  2NQA A;  2XU4 A;  1CVZ A;  1BQI A;  4MSX A;  1PIP A;  3WXG A;  2FUD A;  3M99 A;  1YK8 A;  4YVA A;  4BS6 A;  1QMY A;  4YYR A;  1GCB A;  1U5I A;  5PAD A;  1AU2 A;  3K9M A;  1NB3 A;  2H7J A;  1GEC E;  2E00 A;  4Q8H A;  4OEM A;  1GLO A;  4FK5 A;  3IHP A;  3OF9 A;  3V6E A;  1X9Y A;  1EF7 A;  5EF4 A;  1ICF A;  1MS6 A;  1U9W A;  2FTD A;  3AI8 A;  4I07 A;  2HHN A;  2XU1 A;  1CTE A;  2WBF X;  3BC3 A;  2FQ9 A;  4NV7 A;  3IEJ A;  2PBH A;  5CVN B;  3P5X A;  4XR7 A;  1GX3 A;  3KX1 A;  3IV2 A;  2FRQ A;  3ERV A;  1NLJ A;  3DF0 A;  5JA7 A;  2AUX A;  3C9E A;  2P86 A;  4YYW A;  4QRV A;  1BP4 A;  1VSN A;  4BQV A;  4ZUX U;  8PCH A;  1F2B A;  2G6D A;  5CHT A;  2DCD A;  1ZCM A;  1YK7 A;  1EWP A;  1MHW A;  4CDE B;  3K24 A;  2BDL A;  1TU6 A;  3P5V A;  2DZZ A;  4YYQ A;  3CH2 X;  5CHV A;  1DF0 A;  1E2T A;  2YJ9 A;  1CPJ A;  3IUT A;  3KFQ A;  1Y4H A;  5EGW A;  3HHI A;  1QOL A;  1AIM A;  2CIO A;  1VJV A;  3K8U A;  4X6J A;  1KHQ A;  1TLO A;  3OVZ A;  1F29 A;  2Y6E A;  2PNS A;  1PBH A;  1U9X A;  4QH6 A;  2DCC A;  2FRA A;  1CJL A;  3LFY A;  3P5W A;  2AYN A;  3HD3 A;  1PPO A;  4P6E A;  5F02 A;  1U9Q X;  1DEU A;  1ME3 A;  2DC8 A;  1NL6 A;  4CZW A;  1PXV A;  1THE A;  4YV8 A;  1ME4 A;  1W5R A;  2G8E A;  4W5B A;  1KHP A;  3RVV A;  5JH3 A;  1EWO A;  3P5U A;  1Q6K A;  1JQP A;  5FPW A;  4GUZ A;  4YYV A;  4B55 A;  4Q8G A;  1A6R A;  4DMX A;  5A24 A;  1IWD A;  3MTN A;  1W4T A;  2R9C A;  2DCA A;  5K16 A;  2C0Y A;  2YJ2 A;  1XKG A;  2BSZ A;  1GMY A;  3QJ3 A;  3PDF A;  4P6G A;  3D6S A;  4N4Z A;  2F1G A;  4FJC A;  1YT7 A;  1STF E;  3IMA A;  3WXF A;  2VHS A;  1AYU A;  3OF8 A;  5CVM A;  3N4C A;  2HXZ A;  3TNX A;  5J94 A;  5CVO B;  2Y5B A;  2FYE A;  1M6D A;  2ATO A;  3I3T A;  4AXM A;  4YYS A;  1FH0 A;  4N8W A;  1AU0 A;  3OVX A;  2DZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...