1BGOA

Crystal structure of cysteine protease human cathepsin k in complex with a covalent peptidomimetic inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATHEPSIN K
publication title Use of X-Ray Co-Crystal Structures and Molecular Modeling to Design Potent and Selective Non-Peptide Inhibitors of Cathepsin K
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 1998-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1bgoA00
1F2BA 1FH0A 1EWLA 2NQAA 4RY2A 1TLOA 3WXEA 2R9MA 3QSDA 2G6DA 3H6SA 1CQDA 1F2AA 3I3TA 1A6RA 2DC9A 3LFYA 3E1ZB 4YVAA 3KKUA 5FPWA 3OVXA 4AXLA 2YJ8A 1ICFA 2IPPB 1AYVA 3H8CA 1YK7A 1DEUA 4YYSA 3KWBX 2Y6EA 2GHUA 2DZYA 1ATKA 5CVOB 1TU6A 2FO5A 5EF4A 4YYWA 2AUXA 3CH3X 2G7YA 2G8EA 7PCKA 3OF8A 4YYQA 2IBIA 1CS8A 5CVMA 2P0RA 4MSXA 2FUDA 4CDDB 1YK8A 4CZWA 2AS8A 1NB3A 2PREA 3LXSA 2DCAA 4YV8A 3OF9A 5JA7A 2VHSA 5EGWA 1GECE 2YJ2A 3S3RA 3DF0A 3WXGA 1BQIA 2FTDA 3IHPA 5K16A 3OISA 4YYVA 4PI3A 1X9YA 3TNXA 5PADA 4YYRA 2E02A 1AECA 2XU4A 2ARYA 3RVXA 3BPMA 1O0EA 2FYEA 2HXZA 4OELA 1U5IA 5F02A 1DF0A 2AU1A 2F7DA 1CB5A 1CPJA 2R9NA 2NQGA 4FK5A 3N4CA 4MZSA 1YT7A 2DJGB 1NQCA 1Y08A 1Q6KA 2FT2A 1BGOA 4BS5A 4BPVA 3V6CA 3HHAA 2ATOA 2GFOA 1GLOA 2VHFA 2NQDB 3S3QA 1ME4A 1CJLA 4BS6A 2DZZA 2FRQA 3KX1A 4Q8GA 4Q8HA 3KW9A 4MZOA 3K24A 4XUIA 1MIRA 2E03A 1GMYA 3OVZA 3N3KA 1THEA 3HWNA 2DC7A 2YJBA 1KXRA 2G8JA 3I06A 2DCCA 3HHIA 4CDFB 1KHPA 3F5VA 3QT4A 4G54A 3BWKA 3WXFA 4QH6A 1CV8A 3H89A 2R9FA 4BSQA 1U9WA 4QRXA 3ERVA 3P5WA 2H7JA 1VSNA 3CBJA 1AYWA 4CDCB 2NQIA 3P5XA 1PPOA 2HD5A 5JH3A 1QOLA 3USVA 1SP4B 4DMXA 3IUTA 8PCHA 1HUCB 2FQ9A 1CTEA 1MHWA 3U8EA 1AIMA 1VJVA 1YALA 1PPPA 1S4VA 2BDLA 3PNRA 3H7DA 1PCIA 1EWOA 3F75A 3RVVA 2ACTA 1PPNA 4CDEB 2YJ9A 2XU5A 4X6HA 4P6EA 2R9CA 4W5BA 1STFE 3MHSA 3PBHA 4FJCA 1GCBA 1MS6A 2CB5A 1U9XA 2DC8A 2R6NA 2AYOA 2HHNA 1CSBB 4BQVA 3KFQA 2DCBA 2XU1A 2Y5BA 3BCNA 5CVNB 4HWYA 1K3BB 1QXPA 2CIOA 1F29A 9PAPA 4N79A 4KLBA 1ZCMA 4QBBA 3NHEA 1NL6A 3HD3A 3GCBA 3IEJA 4N8WA 4P6GA 1ZIVA 5A24A 1PXVA 2BDZA 3IV2A 5CHTA 4AXMA 1Y4HA 1TL9A 4I04A 2C0YA 4FIPA 1JQPA 1KHQA 2OULA 1QDQA 4YYUA 3M99A 1NLJA 1SNKA 2HH5A 1AU4A 1ITOA 1PPDA 4XR7A 1U9QX 3K8UA 2JQGR 4K7CA 3IMAA 1AU3A 1F2CA 2AUZA 3N3GA 1AU0A 2WBFX 3BC3A 3B79A 3D6SA 3QJ3A 2PADA 1NPZA 3O0UA 3ZUAA 1MDWA 3C9EA 4PP1A 2E00A 2OP3A 3KWZA 6PADA 1AYUA 4QRVA 2JQFR 3V6EA 5J94A 2E01A 2P86A 1CVZA 3BPFA 1PBHA 3IOQA 3KSEA 2DC6A 1NB5A 1EWMA 1POPA 1AU2A 1EWPA 4WA6A 2OZ2A 4PP2E 3MORA 3H8BA 5CHVA 3P5UA 3P5VA 4W4UA 2FRAA 1MEGA 3PW3A 2PBHA 1KFXL 1ME3A 1PE6A 2DJFB 4QRGA 4ZUXU 4W5CA 3BOWA 1M6DA 2B1NA 1PADA 4X6IA 2PNSA 2R9OA 2XU3A 2O6XA 4OEMA 4N4ZA 2F1GA 1BP4A 1PIPA 2YJCA 1EF7A 3AI8A 2AYNA 2DCDA 1MEMA 2P7UA 4I07A 4I05A 2B1MA 1IWDA 3MHHA 3K9MA 1KFUL 2AVWA 1QMYA 3MTNA 4DMYA 1YVBA 1XKGA 3CBKA 3O1GA 4PADA 3RVWA 4X6JA 3PDFA 1U9VA 1BY8A 3CH2X 2AIMA
chains in the Genus database with same CATH superfamily
1F2BA 1FH0A 1EWLA 2NQAA 4RY2A 1TLOA 3WXEA 3W31A 2R9MA 3QSDA 2G6DA 3ZNHA 3H6SA 1CQDA 1YZBA 2JTCA 1F2AA 3I3TA 1A6RA 4RF1A 2DC9A 3LFYA 3E1ZB 4YVAA 3KKUA 5FPWA 3OVXA 4AXLA 2YJ8A 3E9SA 1ICFA 5EZQA 4M0WA 4P16A 2IPPB 1AYVA 3H8CA 1YK7A 1DEUA 4YYSA 3KWBX 2Y6EA 2GHUA 4REZA 2DZYA 4ZTBA 1ATKA 5CVOB 1TU6A 2FO5A 5EF4A 4YYWA 2AUXA 3CH3X 2G7YA 2G8EA 7PCKA 3OF8A 4YYQA 2IBIA 1CS8A 5CVMA 2P0RA 4MSXA 2FUDA 4CDDB 1YK8A 4CZWA 2AS8A 1NB3A 2PREA 3LXSA 2DCAA 4YV8A 3OF9A 5JA7A 2VHSA 5EGWA 1GECE 2YJ2A 3S3RA 3DF0A 3WXGA 1BQIA 2JRIA 2FTDA 3IHPA 5K16A 4BOSA 3OISA 4D8BA 4YYVA 1X9YA 4PI3A 3TNXA 5PADA 4BOQA 4YYRA 2E02A 1AECA 2XU4A 3O65A 2ARYA 3RVXA 3BPMA 1O0EA 2FYEA 2HXZA 4OELA 1U5IA 5KO3A 5F02A 4BOUA 1DF0A 2AU1A 2F7DA 1CB5A 1CPJA 2R9NA 2NQGA 4FK5A 3N4CA 4MZSA 1YT7A 2DJGB 1NQCA 1Y08A 1Q6KA 2FT2A 1BGOA 4BS5A 4BPVA 3V6CA 3HHAA 2ATOA 2GFOA 1GLOA 2VHFA 2NQDB 3MTVA 3S3QA 4PT5A 3RNVA 1ME4A 2J7QA 1CJLA 4BS6A 2DZZA 2FRQA 3KX1A 2BTWB 4Q8GA 4Q8HA 3KW9A 4MZOA 3K24A 4HXDB 4XUIA 1MIRA 2E03A 1GMYA 3OVZA 3N3KA 2AGAA 3OQCA 1THEA 3HWNA 2DC7A 2YJBA 1KXRA 2G8JA 5EZSA 3I06A 4BOPA 3C0RA 2DCCA 3HHIA 4CDFB 1KHPA 3BBAA 3F5VA 4OVZA 2BU3A 3QT4A 4G54A 3BWKA 3PHWA 3WXFA 4QH6A 1CV8A 3H89A 2R9FA 4BSQA 1U9WA 4QRXA 3ERVA 3P5WA 2H7JA 1VSNA 3CBJA 1AYWA 4CDCB 2NQIA 3P5XA 1PPOA 2HD5A 5JH3A 4MI7A 1QOLA 4RKXA 3USVA 1SP4B 4DMXA 3IUTA 8PCHA 1HUCB 2FQ9A 1CTEA 1MHWA 3U8EA 1AIMA 1VJVA 1YALA 1PPPA 1S4VA 2BDLA 5E6JA 3PNRA 3H7DA 1PCIA 1EWOA 3F75A 3RVVA 2ACTA 1PPNA 4CDEB 2YJ9A 2XU5A 4X6HA 4P6EA 2R9CA 4W5BA 1STFE 3MHSA 3PBHA 3BY4A 4FJCA 1GCBA 1MS6A 2CB5A 1U9XA 2DC8A 2R6NA 2AYOA 2HHNA 1CSBB 4XZXA 4BQVA 1DKIA 3KFQA 2DCBA 2XU1A 3B21A 2Y5BA 3BCNA 5CVNB 4HWYA 1K3BB 1QXPA 4MM3B 2CIOA 1F29A 9PAPA 4N79A 4KLBA 1ZCMA 2HWKA 4QBBA 3NHEA 1NL6A 3HD3A 4IUMA 3GCBA 3IEJA 4N8WA 4P6GA 1ZIVA 3MP2A 5A24A 1PXVA 2BDZA 3IV2A 3PSEA 3PT2A 3MJ5A 3PHUA 5CHTA 4AXMA 1Y4HA 1TL9A 4I04A 2C0YA 4FIPA 4IP3A 3PHXA 1JQPA 1KHQA 2OULA 1QDQA 4YYUA 3M99A 1NLJA 1SNKA 2HH5A 1AU4A 1ITOA 3TRKA 1PPDA 4XR7A 1U9QX 3K8UA 2JQGR 4K7CA 3IMAA 1AU3A 1F2CA 2AUZA 3N3GA 3IFUA 1AU0A 2WBFX 1UKFA 3BC3A 3BB7A 3B79A 3D6SA 3QJ3A 2PADA 1NPZA 3O0UA 3ZUAA 3TMPA 4A5UA 4D8EA 2FE8A 1MDWA 3C9EA 3PRMA 4PP1A 2E00A 2OP3A 3KWZA 6PADA 1AYUA 4QRVA 4WURA 2JQFR 3V6EA 3W30A 5J94A 2E01A 2P86A 1CVZA 2Z84A 3BPFA 1PBHA 4GUAA 3IOQA 3KSEA 2DC6A 1NB5A 3PRPA 1EWMA 1POPA 4R3DA 1AU2A 4OW0A 1EWPA 4WA6A 2OZ2A 4PP2E 3MORA 3H8BA 5CHVA 1PVJA 3P5UA 3P5VA 4W4UA 2FRAA 4OVZB 1MEGA 3PW3A 5JZEA 2PBHA 1KFXL 1ME3A 1PE6A 2DJFB 4QRGA 4ZUXU 4W5CA 3BOWA 1M6DA 2B1NA 2DOSA 2BTWA 1PADA 4X6IA 2PNSA 4BOZA 2R9OA 2XU3A 2O6XA 4OEMA 4N4ZA 2F1GA 1BP4A 2J7QC 1PIPA 2YJCA 1EF7A 4RNAA 3AI8A 2AYNA 2DCDA 1MEMA 4D8IA 2P7UA 4I07A 4I05A 2B1MA 1IWDA 2UZJA 3MHHA 3K9MA 1KFUL 2AVWA 1QMYA 3MTNA 4DMYA 3O1GA 1YVBA 1XKGA 3CBKA 4PADA 3RVWA 4X6JA 3PDFA 4RF0A 1U9VA 1BY8A 3CH2X 2AIMA
chains in the Genus database with same CATH topology
1F2BA 1FH0A 1EWLA 2NQAA 4RY2A 1TLOA 3WXEA 1W4TA 2R9MA 3QSDA 1E2TA 2G6DA 4C5PA 3H6SA 1CQDA 1F2AA 3I3TA 1A6RA 2DC9A 3LFYA 3E1ZB 4YVAA 3KKUA 5FPWA 3OVXA 4AXLA 2YJ8A 1ICFA 2IPPB 1AYVA 3H8CA 1YK7A 1DEUA 4YYSA 3KWBX 2Y6EA 2GHUA 2DZYA 1ATKA 5CVOB 1TU6A 2FO5A 5EF4A 4YYWA 2AUXA 3CH3X 2G7YA 2G8EA 1GX3A 7PCKA 3OF8A 4YYQA 2IBIA 1CS8A 5CVMA 2P0RA 4MSXA 2FUDA 4CDDB 1YK8A 4CZWA 2AS8A 1NB3A 2PREA 3LXSA 2DCAA 4YV8A 3OF9A 5JA7A 2VHSA 5EGWA 1GECE 4GUZA 2YJ2A 3S3RA 3DF0A 3WXGA 1BQIA 2FTDA 3IHPA 5K16A 3OISA 4YYVA 1X9YA 4PI3A 3TNXA 5PADA 4YYRA 2E02A 1AECA 2XU4A 2ARYA 3RVXA 3BPMA 1O0EA 2FYEA 2HXZA 4OELA 1U5IA 5F02A 1DF0A 2AU1A 2F7DA 1CB5A 1CPJA 2R9NA 2NQGA 4FK5A 3N4CA 4MZSA 1YT7A 2DJGB 1NQCA 1Y08A 1Q6KA 2FT2A 1BGOA 4BS5A 4BPVA 3V6CA 3HHAA 2ATOA 2GFOA 1GLOA 2VHFA 2NQDB 1W6FA 3S3QA 1ME4A 1CJLA 4BS6A 2DZZA 2FRQA 3KX1A 4Q8GA 2VFCA 4Q8HA 3KW9A 4MZOA 3K24A 4XUIA 1MIRA 2E03A 1GMYA 3OVZA 3N3KA 1THEA 3HWNA 2DC7A 2VFBA 2YJBA 1KXRA 2G8JA 3I06A 2DCCA 3HHIA 4CDFB 1KHPA 3F5VA 3QT4A 4G54A 3BWKA 3WXFA 4QH6A 1CV8A 3H89A 2R9FA 4BSQA 1U9WA 4QRXA 3ERVA 3P5WA 2H7JA 1VSNA 3CBJA 1AYWA 4BGFA 4CDCB 2NQIA 3P5XA 1PPOA 2HD5A 5JH3A 1QOLA 3USVA 1SP4B 4DMXA 3IUTA 8PCHA 1HUCB 2FQ9A 1CTEA 4NV8A 1MHWA 3U8EA 1AIMA 1VJVA 1YALA 1PPPA 1S4VA 2BDLA 3PNRA 3H7DA 1PCIA 1EWOA 3F75A 3RVVA 2ACTA 1PPNA 4CDEB 2YJ9A 2XU5A 4X6HA 4P6EA 2R9CA 4W5BA 1STFE 3MHSA 3PBHA 4FJCA 1GCBA 1MS6A 2CB5A 1U9XA 2DC8A 2R6NA 2AYOA 2HHNA 1CSBB 4BQVA 3KFQA 2DCBA 2XU1A 4B55A 2Y5BA 3BCNA 5CVNB 4HWYA 1K3BB 1QXPA 2CIOA 1F29A 9PAPA 4N79A 4KLBA 1ZCMA 1W5RA 4QBBA 3NHEA 1NL6A 3HD3A 3GCBA 3IEJA 4N8WA 4P6GA 1ZIVA 5A24A 1PXVA 2BDZA 3IV2A 5CHTA 4AXMA 1Y4HA 1TL9A 4I04A 2C0YA 4FIPA 1JQPA 1KHQA 2OULA 1QDQA 4YYUA 3M99A 1NLJA 1SNKA 2HH5A 1AU4A 1ITOA 1PPDA 4XR7A 1U9QX 3K8UA 2JQGR 4K7CA 3IMAA 1AU3A 1F2CA 2AUZA 3N3GA 1AU0A 2WBFX 3BC3A 3B79A 3D6SA 3QJ3A 2PADA 1NPZA 3O0UA 3ZUAA 1MDWA 3C9EA 4PP1A 2E00A 2OP3A 3KWZA 6PADA 1AYUA 4QRVA 2JQFR 3V6EA 5J94A 2E01A 2P86A 1CVZA 3BPFA 1PBHA 3IOQA 3KSEA 2DC6A 1NB5A 4NV7A 1EWMA 1POPA 1AU2A 1EWPA 4WA6A 2OZ2A 4PP2E 3MORA 3H8BA 5CHVA 3P5UA 3LTWA 3P5VA 4W4UA 2FRAA 2BSZA 1MEGA 3PW3A 2PBHA 1KFXL 1ME3A 1PE6A 2DJFB 4QRGA 4ZUXU 4W5CA 3BOWA 1M6DA 2B1NA 1PADA 4X6IA 2PNSA 2R9OA 2XU3A 2O6XA 4OEMA 4N4ZA 3D9WA 2F1GA 1BP4A 1PIPA 2YJCA 1EF7A 3AI8A 2AYNA 2DCDA 1MEMA 2P7UA 4I07A 4I05A 2B1MA 1IWDA 3MHHA 3K9MA 1KFUL 2AVWA 1QMYA 3MTNA 4DMYA 1YVBA 1XKGA 3CBKA 3O1GA 4PADA 3RVWA 4X6JA 3PDFA 1U9VA 1BY8A 3CH2X 2AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2B A;  1FH0 A;  1EWL A;  2NQA A;  4RY2 A;  1TLO A;  3WXE A;  2R9M A;  3QSD A;  2G6D A;  3H6S A;  1CQD A;  1F2A A;  3I3T A;  1A6R A;  2DC9 A;  3LFY A;  3E1Z B;  4YVA A;  3KKU A;  5FPW A;  3OVX A;  4AXL A;  2YJ8 A;  1ICF A;  2IPP B;  1AYV A;  3H8C A;  1YK7 A;  1DEU A;  4YYS A;  3KWB X;  2Y6E A;  2GHU A;  2DZY A;  1ATK A;  5CVO B;  1TU6 A;  2FO5 A;  5EF4 A;  4YYW A;  2AUX A;  3CH3 X;  2G7Y A;  2G8E A;  7PCK A;  3OF8 A;  4YYQ A;  2IBI A;  1CS8 A;  5CVM A;  2P0R A;  4MSX A;  2FUD A;  4CDD B;  1YK8 A;  4CZW A;  2AS8 A;  1NB3 A;  2PRE A;  3LXS A;  2DCA A;  4YV8 A;  3OF9 A;  5JA7 A;  2VHS A;  5EGW A;  1GEC E;  2YJ2 A;  3S3R A;  3DF0 A;  3WXG A;  1BQI A;  2FTD A;  3IHP A;  5K16 A;  3OIS A;  4YYV A;  4PI3 A;  1X9Y A;  3TNX A;  5PAD A;  4YYR A;  2E02 A;  1AEC A;  2XU4 A;  2ARY A;  3RVX A;  3BPM A;  1O0E A;  2FYE A;  2HXZ A;  4OEL A;  1U5I A;  5F02 A;  1DF0 A;  2AU1 A;  2F7D A;  1CB5 A;  1CPJ A;  2R9N A;  2NQG A;  4FK5 A;  3N4C A;  4MZS A;  1YT7 A;  2DJG B;  1NQC A;  1Y08 A;  1Q6K A;  2FT2 A;  1BGO A;  4BS5 A;  4BPV A;  3V6C A;  3HHA A;  2ATO A;  2GFO A;  1GLO A;  2VHF A;  2NQD B;  3S3Q A;  1ME4 A;  1CJL A;  4BS6 A;  2DZZ A;  2FRQ A;  3KX1 A;  4Q8G A;  4Q8H A;  3KW9 A;  4MZO A;  3K24 A;  4XUI A;  1MIR A;  2E03 A;  1GMY A;  3OVZ A;  3N3K A;  1THE A;  3HWN A;  2DC7 A;  2YJB A;  1KXR A;  2G8J A;  3I06 A;  2DCC A;  3HHI A;  4CDF B;  1KHP A;  3F5V A;  3QT4 A;  4G54 A;  3BWK A;  3WXF A;  4QH6 A;  1CV8 A;  3H89 A;  2R9F A;  4BSQ A;  1U9W A;  4QRX A;  3ERV A;  3P5W A;  2H7J A;  1VSN A;  3CBJ A;  1AYW A;  4CDC B;  2NQI A;  3P5X A;  1PPO A;  2HD5 A;  5JH3 A;  1QOL A;  3USV A;  1SP4 B;  4DMX A;  3IUT A;  8PCH A;  1HUC B;  2FQ9 A;  1CTE A;  1MHW A;  3U8E A;  1AIM A;  1VJV A;  1YAL A;  1PPP A;  1S4V A;  2BDL A;  3PNR A;  3H7D A;  1PCI A;  1EWO A;  3F75 A;  3RVV A;  2ACT A;  1PPN A;  4CDE B;  2YJ9 A;  2XU5 A;  4X6H A;  4P6E A;  2R9C A;  4W5B A;  1STF E;  3MHS A;  3PBH A;  4FJC A;  1GCB A;  1MS6 A;  2CB5 A;  1U9X A;  2DC8 A;  2R6N A;  2AYO A;  2HHN A;  1CSB B;  4BQV A;  3KFQ A;  2DCB A;  2XU1 A;  2Y5B A;  3BCN A;  5CVN B;  4HWY A;  1K3B B;  1QXP A;  2CIO A;  1F29 A;  9PAP A;  4N79 A;  4KLB A;  1ZCM A;  4QBB A;  3NHE A;  1NL6 A;  3HD3 A;  3GCB A;  3IEJ A;  4N8W A;  4P6G A;  1ZIV A;  5A24 A;  1PXV A;  2BDZ A;  3IV2 A;  5CHT A;  4AXM A;  1Y4H A;  1TL9 A;  4I04 A;  2C0Y A;  4FIP A;  1JQP A;  1KHQ A;  2OUL A;  1QDQ A;  4YYU A;  3M99 A;  1NLJ A;  1SNK A;  2HH5 A;  1AU4 A;  1ITO A;  1PPD A;  4XR7 A;  1U9Q X;  3K8U A;  2JQG R;  4K7C A;  3IMA A;  1AU3 A;  1F2C A;  2AUZ A;  3N3G A;  1AU0 A;  2WBF X;  3BC3 A;  3B79 A;  3D6S A;  3QJ3 A;  2PAD A;  1NPZ A;  3O0U A;  3ZUA A;  1MDW A;  3C9E A;  4PP1 A;  2E00 A;  2OP3 A;  3KWZ A;  6PAD A;  1AYU A;  4QRV A;  2JQF R;  3V6E A;  5J94 A;  2E01 A;  2P86 A;  1CVZ A;  3BPF A;  1PBH A;  3IOQ A;  3KSE A;  2DC6 A;  1NB5 A;  1EWM A;  1POP A;  1AU2 A;  1EWP A;  4WA6 A;  2OZ2 A;  4PP2 E;  3MOR A;  3H8B A;  5CHV A;  3P5U A;  3P5V A;  4W4U A;  2FRA A;  1MEG A;  3PW3 A;  2PBH A;  1KFX L;  1ME3 A;  1PE6 A;  2DJF B;  4QRG A;  4ZUX U;  4W5C A;  3BOW A;  1M6D A;  2B1N A;  1PAD A;  4X6I A;  2PNS A;  2R9O A;  2XU3 A;  2O6X A;  4OEM A;  4N4Z A;  2F1G A;  1BP4 A;  1PIP A;  2YJC A;  1EF7 A;  3AI8 A;  2AYN A;  2DCD A;  1MEM A;  2P7U A;  4I07 A;  4I05 A;  2B1M A;  1IWD A;  3MHH A;  3K9M A;  1KFU L;  2AVW A;  1QMY A;  3MTN A;  4DMY A;  1YVB A;  1XKG A;  3CBK A;  3O1G A;  4PAD A;  3RVW A;  4X6J A;  3PDF A;  1U9V A;  1BY8 A;  3CH2 X;  2AIM A; 
#chains in the Genus database with same CATH topology
 1F2B A;  1FH0 A;  1EWL A;  2NQA A;  4RY2 A;  1TLO A;  3WXE A;  3W31 A;  2R9M A;  3QSD A;  2G6D A;  3ZNH A;  3H6S A;  1CQD A;  1YZB A;  2JTC A;  1F2A A;  3I3T A;  1A6R A;  4RF1 A;  2DC9 A;  3LFY A;  3E1Z B;  4YVA A;  3KKU A;  5FPW A;  3OVX A;  4AXL A;  2YJ8 A;  3E9S A;  1ICF A;  5EZQ A;  4M0W A;  4P16 A;  2IPP B;  1AYV A;  3H8C A;  1YK7 A;  1DEU A;  4YYS A;  3KWB X;  2Y6E A;  2GHU A;  4REZ A;  2DZY A;  4ZTB A;  1ATK A;  5CVO B;  1TU6 A;  2FO5 A;  5EF4 A;  4YYW A;  2AUX A;  3CH3 X;  2G7Y A;  2G8E A;  7PCK A;  3OF8 A;  4YYQ A;  2IBI A;  1CS8 A;  5CVM A;  2P0R A;  4MSX A;  2FUD A;  4CDD B;  1YK8 A;  4CZW A;  2AS8 A;  1NB3 A;  2PRE A;  3LXS A;  2DCA A;  4YV8 A;  3OF9 A;  5JA7 A;  2VHS A;  5EGW A;  1GEC E;  2YJ2 A;  3S3R A;  3DF0 A;  3WXG A;  1BQI A;  2JRI A;  2FTD A;  3IHP A;  5K16 A;  4BOS A;  3OIS A;  4D8B A;  4YYV A;  1X9Y A;  4PI3 A;  3TNX A;  5PAD A;  4BOQ A;  4YYR A;  2E02 A;  1AEC A;  2XU4 A;  3O65 A;  2ARY A;  3RVX A;  3BPM A;  1O0E A;  2FYE A;  2HXZ A;  4OEL A;  1U5I A;  5KO3 A;  5F02 A;  4BOU A;  1DF0 A;  2AU1 A;  2F7D A;  1CB5 A;  1CPJ A;  2R9N A;  2NQG A;  4FK5 A;  3N4C A;  4MZS A;  1YT7 A;  2DJG B;  1NQC A;  1Y08 A;  1Q6K A;  2FT2 A;  1BGO A;  4BS5 A;  4BPV A;  3V6C A;  3HHA A;  2ATO A;  2GFO A;  1GLO A;  2VHF A;  2NQD B;  3MTV A;  3S3Q A;  4PT5 A;  3RNV A;  1ME4 A;  2J7Q A;  1CJL A;  4BS6 A;  2DZZ A;  2FRQ A;  3KX1 A;  2BTW B;  4Q8G A;  4Q8H A;  3KW9 A;  4MZO A;  3K24 A;  4HXD B;  4XUI A;  1MIR A;  2E03 A;  1GMY A;  3OVZ A;  3N3K A;  2AGA A;  3OQC A;  1THE A;  3HWN A;  2DC7 A;  2YJB A;  1KXR A;  2G8J A;  5EZS A;  3I06 A;  4BOP A;  3C0R A;  2DCC A;  3HHI A;  4CDF B;  1KHP A;  3BBA A;  3F5V A;  4OVZ A;  2BU3 A;  3QT4 A;  4G54 A;  3BWK A;  3PHW A;  3WXF A;  4QH6 A;  1CV8 A;  3H89 A;  2R9F A;  4BSQ A;  1U9W A;  4QRX A;  3ERV A;  3P5W A;  2H7J A;  1VSN A;  3CBJ A;  1AYW A;  4CDC B;  2NQI A;  3P5X A;  1PPO A;  2HD5 A;  5JH3 A;  4MI7 A;  1QOL A;  4RKX A;  3USV A;  1SP4 B;  4DMX A;  3IUT A;  8PCH A;  1HUC B;  2FQ9 A;  1CTE A;  1MHW A;  3U8E A;  1AIM A;  1VJV A;  1YAL A;  1PPP A;  1S4V A;  2BDL A;  5E6J A;  3PNR A;  3H7D A;  1PCI A;  1EWO A;  3F75 A;  3RVV A;  2ACT A;  1PPN A;  4CDE B;  2YJ9 A;  2XU5 A;  4X6H A;  4P6E A;  2R9C A;  4W5B A;  1STF E;  3MHS A;  3PBH A;  3BY4 A;  4FJC A;  1GCB A;  1MS6 A;  2CB5 A;  1U9X A;  2DC8 A;  2R6N A;  2AYO A;  2HHN A;  1CSB B;  4XZX A;  4BQV A;  1DKI A;  3KFQ A;  2DCB A;  2XU1 A;  3B21 A;  2Y5B A;  3BCN A;  5CVN B;  4HWY A;  1K3B B;  1QXP A;  4MM3 B;  2CIO A;  1F29 A;  9PAP A;  4N79 A;  4KLB A;  1ZCM A;  2HWK A;  4QBB A;  3NHE A;  1NL6 A;  3HD3 A;  4IUM A;  3GCB A;  3IEJ A;  4N8W A;  4P6G A;  1ZIV A;  3MP2 A;  5A24 A;  1PXV A;  2BDZ A;  3IV2 A;  3PSE A;  3PT2 A;  3MJ5 A;  3PHU A;  5CHT A;  4AXM A;  1Y4H A;  1TL9 A;  4I04 A;  2C0Y A;  4FIP A;  4IP3 A;  3PHX A;  1JQP A;  1KHQ A;  2OUL A;  1QDQ A;  4YYU A;  3M99 A;  1NLJ A;  1SNK A;  2HH5 A;  1AU4 A;  1ITO A;  3TRK A;  1PPD A;  4XR7 A;  1U9Q X;  3K8U A;  2JQG R;  4K7C A;  3IMA A;  1AU3 A;  1F2C A;  2AUZ A;  3N3G A;  3IFU A;  1AU0 A;  2WBF X;  1UKF A;  3BC3 A;  3BB7 A;  3B79 A;  3D6S A;  3QJ3 A;  2PAD A;  1NPZ A;  3O0U A;  3ZUA A;  3TMP A;  4A5U A;  4D8E A;  2FE8 A;  1MDW A;  3C9E A;  3PRM A;  4PP1 A;  2E00 A;  2OP3 A;  3KWZ A;  6PAD A;  1AYU A;  4QRV A;  4WUR A;  2JQF R;  3V6E A;  3W30 A;  5J94 A;  2E01 A;  2P86 A;  1CVZ A;  2Z84 A;  3BPF A;  1PBH A;  4GUA A;  3IOQ A;  3KSE A;  2DC6 A;  1NB5 A;  3PRP A;  1EWM A;  1POP A;  4R3D A;  1AU2 A;  4OW0 A;  1EWP A;  4WA6 A;  2OZ2 A;  4PP2 E;  3MOR A;  3H8B A;  5CHV A;  1PVJ A;  3P5U A;  3P5V A;  4W4U A;  2FRA A;  4OVZ B;  1MEG A;  3PW3 A;  5JZE A;  2PBH A;  1KFX L;  1ME3 A;  1PE6 A;  2DJF B;  4QRG A;  4ZUX U;  4W5C A;  3BOW A;  1M6D A;  2B1N A;  2DOS A;  2BTW A;  1PAD A;  4X6I A;  2PNS A;  4BOZ A;  2R9O A;  2XU3 A;  2O6X A;  4OEM A;  4N4Z A;  2F1G A;  1BP4 A;  2J7Q C;  1PIP A;  2YJC A;  1EF7 A;  4RNA A;  3AI8 A;  2AYN A;  2DCD A;  1MEM A;  4D8I A;  2P7U A;  4I07 A;  4I05 A;  2B1M A;  1IWD A;  2UZJ A;  3MHH A;  3K9M A;  1KFU L;  2AVW A;  1QMY A;  3MTN A;  4DMY A;  3O1G A;  1YVB A;  1XKG A;  3CBK A;  4PAD A;  3RVW A;  4X6J A;  3PDF A;  4RF0 A;  1U9V A;  1BY8 A;  3CH2 X;  2AIM A; 
#chains in the Genus database with same CATH homology
 1F2B A;  1FH0 A;  1EWL A;  2NQA A;  4RY2 A;  1TLO A;  3WXE A;  1W4T A;  2R9M A;  3QSD A;  1E2T A;  2G6D A;  4C5P A;  3H6S A;  1CQD A;  1F2A A;  3I3T A;  1A6R A;  2DC9 A;  3LFY A;  3E1Z B;  4YVA A;  3KKU A;  5FPW A;  3OVX A;  4AXL A;  2YJ8 A;  1ICF A;  2IPP B;  1AYV A;  3H8C A;  1YK7 A;  1DEU A;  4YYS A;  3KWB X;  2Y6E A;  2GHU A;  2DZY A;  1ATK A;  5CVO B;  1TU6 A;  2FO5 A;  5EF4 A;  4YYW A;  2AUX A;  3CH3 X;  2G7Y A;  2G8E A;  1GX3 A;  7PCK A;  3OF8 A;  4YYQ A;  2IBI A;  1CS8 A;  5CVM A;  2P0R A;  4MSX A;  2FUD A;  4CDD B;  1YK8 A;  4CZW A;  2AS8 A;  1NB3 A;  2PRE A;  3LXS A;  2DCA A;  4YV8 A;  3OF9 A;  5JA7 A;  2VHS A;  5EGW A;  1GEC E;  4GUZ A;  2YJ2 A;  3S3R A;  3DF0 A;  3WXG A;  1BQI A;  2FTD A;  3IHP A;  5K16 A;  3OIS A;  4YYV A;  1X9Y A;  4PI3 A;  3TNX A;  5PAD A;  4YYR A;  2E02 A;  1AEC A;  2XU4 A;  2ARY A;  3RVX A;  3BPM A;  1O0E A;  2FYE A;  2HXZ A;  4OEL A;  1U5I A;  5F02 A;  1DF0 A;  2AU1 A;  2F7D A;  1CB5 A;  1CPJ A;  2R9N A;  2NQG A;  4FK5 A;  3N4C A;  4MZS A;  1YT7 A;  2DJG B;  1NQC A;  1Y08 A;  1Q6K A;  2FT2 A;  1BGO A;  4BS5 A;  4BPV A;  3V6C A;  3HHA A;  2ATO A;  2GFO A;  1GLO A;  2VHF A;  2NQD B;  1W6F A;  3S3Q A;  1ME4 A;  1CJL A;  4BS6 A;  2DZZ A;  2FRQ A;  3KX1 A;  4Q8G A;  2VFC A;  4Q8H A;  3KW9 A;  4MZO A;  3K24 A;  4XUI A;  1MIR A;  2E03 A;  1GMY A;  3OVZ A;  3N3K A;  1THE A;  3HWN A;  2DC7 A;  2VFB A;  2YJB A;  1KXR A;  2G8J A;  3I06 A;  2DCC A;  3HHI A;  4CDF B;  1KHP A;  3F5V A;  3QT4 A;  4G54 A;  3BWK A;  3WXF A;  4QH6 A;  1CV8 A;  3H89 A;  2R9F A;  4BSQ A;  1U9W A;  4QRX A;  3ERV A;  3P5W A;  2H7J A;  1VSN A;  3CBJ A;  1AYW A;  4BGF A;  4CDC B;  2NQI A;  3P5X A;  1PPO A;  2HD5 A;  5JH3 A;  1QOL A;  3USV A;  1SP4 B;  4DMX A;  3IUT A;  8PCH A;  1HUC B;  2FQ9 A;  1CTE A;  4NV8 A;  1MHW A;  3U8E A;  1AIM A;  1VJV A;  1YAL A;  1PPP A;  1S4V A;  2BDL A;  3PNR A;  3H7D A;  1PCI A;  1EWO A;  3F75 A;  3RVV A;  2ACT A;  1PPN A;  4CDE B;  2YJ9 A;  2XU5 A;  4X6H A;  4P6E A;  2R9C A;  4W5B A;  1STF E;  3MHS A;  3PBH A;  4FJC A;  1GCB A;  1MS6 A;  2CB5 A;  1U9X A;  2DC8 A;  2R6N A;  2AYO A;  2HHN A;  1CSB B;  4BQV A;  3KFQ A;  2DCB A;  2XU1 A;  4B55 A;  2Y5B A;  3BCN A;  5CVN B;  4HWY A;  1K3B B;  1QXP A;  2CIO A;  1F29 A;  9PAP A;  4N79 A;  4KLB A;  1ZCM A;  1W5R A;  4QBB A;  3NHE A;  1NL6 A;  3HD3 A;  3GCB A;  3IEJ A;  4N8W A;  4P6G A;  1ZIV A;  5A24 A;  1PXV A;  2BDZ A;  3IV2 A;  5CHT A;  4AXM A;  1Y4H A;  1TL9 A;  4I04 A;  2C0Y A;  4FIP A;  1JQP A;  1KHQ A;  2OUL A;  1QDQ A;  4YYU A;  3M99 A;  1NLJ A;  1SNK A;  2HH5 A;  1AU4 A;  1ITO A;  1PPD A;  4XR7 A;  1U9Q X;  3K8U A;  2JQG R;  4K7C A;  3IMA A;  1AU3 A;  1F2C A;  2AUZ A;  3N3G A;  1AU0 A;  2WBF X;  3BC3 A;  3B79 A;  3D6S A;  3QJ3 A;  2PAD A;  1NPZ A;  3O0U A;  3ZUA A;  1MDW A;  3C9E A;  4PP1 A;  2E00 A;  2OP3 A;  3KWZ A;  6PAD A;  1AYU A;  4QRV A;  2JQF R;  3V6E A;  5J94 A;  2E01 A;  2P86 A;  1CVZ A;  3BPF A;  1PBH A;  3IOQ A;  3KSE A;  2DC6 A;  1NB5 A;  4NV7 A;  1EWM A;  1POP A;  1AU2 A;  1EWP A;  4WA6 A;  2OZ2 A;  4PP2 E;  3MOR A;  3H8B A;  5CHV A;  3P5U A;  3LTW A;  3P5V A;  4W4U A;  2FRA A;  2BSZ A;  1MEG A;  3PW3 A;  2PBH A;  1KFX L;  1ME3 A;  1PE6 A;  2DJF B;  4QRG A;  4ZUX U;  4W5C A;  3BOW A;  1M6D A;  2B1N A;  1PAD A;  4X6I A;  2PNS A;  2R9O A;  2XU3 A;  2O6X A;  4OEM A;  4N4Z A;  3D9W A;  2F1G A;  1BP4 A;  1PIP A;  2YJC A;  1EF7 A;  3AI8 A;  2AYN A;  2DCD A;  1MEM A;  2P7U A;  4I07 A;  4I05 A;  2B1M A;  1IWD A;  3MHH A;  3K9M A;  1KFU L;  2AVW A;  1QMY A;  3MTN A;  4DMY A;  1YVB A;  1XKG A;  3CBK A;  3O1G A;  4PAD A;  3RVW A;  4X6J A;  3PDF A;  1U9V A;  1BY8 A;  3CH2 X;  2AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...