5JA7A

Human cathepsin k mutant c25s in complex with the allosteric effector nsc94914
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
222
structure length
222
Chain Sequence
b'IPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSSWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title An allosteric site enables fine-tuning of cathepsin K by diverse effectors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 5ja7A00
1YK8A 2YJ8A 3IUTA 1AYUA 1KHPA 1NB3A 1PXVA 4AXLA 4PI3A 4CDDB 1GECE 3I06A 8PCHA 2R6NA 2G8EA 5EGWA 2BDLA 2JQGR 2B1MA 4ZUXU 1QXPA 1TL9A 2G7YA 2HH5A 3TNXA 1NQCA 2IBIA 2PREA 1GMYA 2CB5A 3BWKA 5CVOB 2XU5A 2DJGB 3IOQA 1Y4HA 4PP2E 1PPPA 1BQIA 2DC8A 1AU4A 3V6CA 1QDQA 1DF0A 4XUIA 2OZ2A 2E03A 3IV2A 4XR7A 3MHHA 1EWPA 1CV8A 1U9VA 4W4UA 3I3TA 2YJCA 3S3QA 2E02A 3OISA 3LFYA 2DCBA 3GCBA 4RY2A 3H7DA 2P86A 1CPJA 1CTEA 1PPNA 4W5CA 4DMYA 1DEUA 1BP4A 3AI8A 3MORA 1STFE 1NLJA 2YJBA 3LXSA 2HHNA 1YALA 2AYNA 3H89A 3P5XA 4W5BA 3WXFA 1KHQA 4Q8HA 3K8UA 2WBFX 2DC6A 1ME4A 3WXGA 5F02A 1FH0A 3QJ3A 1S4VA 1THEA 2R9NA 3H8CA 5JA7A 1MIRA 5EF4A 4G54A 1O0EA 2NQAA 5CHVA 4QBBA 4Q8GA 3O0UA 3KFQA 4YYQA 2FO5A 1MEGA 1VSNA 2NQDB 1X9YA 1YT7A 3PBHA 2E00A 2AS8A 3RVWA 1PBHA 2PBHA 2ACTA 4CDFB 3KWBX 4YYVA 1U5IA 2P7UA 1AU2A 9PAPA 1GLOA 4X6JA 3BOWA 3QSDA 2HXZA 4K7CA 1U9XA 3K24A 2BDZA 1K3BB 3KX1A 3IMAA 2GHUA 2VHSA 3PNRA 4I04A 3BPMA 3P5WA 3C9EA 2AYOA 3M99A 1CSBB 1AECA 1PPOA 3BCNA 2F7DA 5CVMA 2R9OA 1BGOA 2NQIA 2AUZA 2YJ2A 2R9FA 4YYWA 4P6EA 4BS5A 2G8JA 2FRAA 2Y6EA 3KKUA 4I05A 2AU1A 2ARYA 2Y5BA 4YYSA 4QRVA 1MDWA 3P5UA 3HHAA 1XKGA 2XU1A 4CDEB 1EWOA 1AIMA 2XU4A 1ITOA 2VHFA 1YK7A 2CIOA 3F75A 3BC3A 2DC7A 1NL6A 4X6HA 1Q6KA 4WA6A 1CQDA 2R9CA 1PE6A 4KLBA 2C0YA 5J94A 4BQVA 2IPPB 6PADA 1A6RA 2G6DA 2FT2A 3N3KA 4CZWA 2DCCA 2DZZA 5JH3A 1JQPA 1MEMA 4HWYA 2B1NA 1BY8A 1GCBA 3OVZA 1CJLA 3P5VA 3KWZA 4N4ZA 1HUCB 3CBKA 1CVZA 4BSQA 3H6SA 1AU0A 4FK5A 3OVXA 4BPVA 1PCIA 3CH2X 2GFOA 2JQFR 1PIPA 3HD3A 1VJVA 4FJCA 3OF8A 1IWDA 2R9MA 3B79A 2DJFB 3HHIA 3MHSA 1KFUL 3HWNA 1ZIVA 1TU6A 4DMXA 4BS6A 2AVWA 2YJ9A 1CS8A 3IHPA 2XU3A 1F2CA 1PADA 1ATKA 4QRXA 1POPA 4YVAA 4N8WA 3F5VA 1AYWA 4OELA 1ME3A 4YYRA 4YYUA 1F2AA 3BPFA 3ZUAA 2O6XA 1QOLA 2AIMA 2AUXA 4FIPA 4X6IA 3USVA 3OF9A 2DZYA 1F29A 3CH3X 4YV8A 2H7JA 3V6EA 3RVXA 2DCDA 3E1ZB 1EWLA 3D6SA 4N79A 3U8EA 2PADA 2OULA 1QMYA 1NB5A 4QRGA 3PW3A 3K9MA 2E01A 1AU3A 3S3RA 4PP1A 4MZSA 2ATOA 4MSXA 1ZCMA 2HD5A 1KFXL 2FUDA 1SP4B 5FPWA 2FQ9A 3IEJA 3WXEA 3NHEA 3N3GA 1U9QX 2OP3A 2FYEA 3KSEA 3ERVA 2PNSA 3MTNA 3N4CA 1EWMA 3QT4A 1ICFA 1KXRA 3CBJA 3KW9A 1U9WA 1AYVA 1NPZA 5A24A 1Y08A 1MS6A 4QH6A 1PPDA 3H8BA 4AXMA 3PDFA 1F2BA 2NQGA 5PADA 2F1GA 1MHWA 2DCAA 3O1GA 1YVBA 1M6DA 1SNKA 3RVVA 7PCKA 5K16A 2FTDA 4PADA 4CDCB 4I07A 2DC9A 1TLOA 5CVNB 1EF7A 2P0RA 4MZOA 4P6GA 1CB5A 3DF0A 5CHTA 2FRQA 4OEMA
chains in the Genus database with same CATH superfamily
1YK8A 2YJ8A 3IUTA 1AYUA 1KHPA 1NB3A 1PXVA 4AXLA 4PI3A 4MI7A 4CDDB 3PRMA 1GECE 3I06A 8PCHA 2R6NA 2G8EA 5EGWA 2BDLA 2JQGR 2B1MA 4HXDB 4ZUXU 1QXPA 1TL9A 2G7YA 2HH5A 3TNXA 1NQCA 2IBIA 2PREA 1GMYA 2CB5A 3BWKA 5CVOB 2XU5A 2DJGB 3IOQA 1Y4HA 4PP2E 1PPPA 1BQIA 2DC8A 1AU4A 4IP3A 3V6CA 4BOQA 1QDQA 5E6JA 1DF0A 4XUIA 3BBAA 2OZ2A 2E03A 3IV2A 3OQCA 3MJ5A 3IFUA 4XR7A 3MHHA 1EWPA 1CV8A 4XZXA 3E9SA 1U9VA 4W4UA 3I3TA 2YJCA 3S3QA 2E02A 3OISA 3LFYA 2DCBA 3GCBA 4RY2A 3H7DA 2P86A 1CPJA 4OVZA 1CTEA 4A5UA 1PPNA 3MTVA 4MM3B 4REZA 4W5CA 4DMYA 1DEUA 3AI8A 1BP4A 4M0WA 3MORA 1STFE 5EZQA 4BOSA 1NLJA 2YJBA 3LXSA 2HHNA 1YALA 2AYNA 3H89A 3P5XA 4W5BA 3WXFA 1KHQA 3ZNHA 4RF0A 4Q8HA 3W30A 3K8UA 2WBFX 2DC6A 1ME4A 3MP2A 3WXGA 5F02A 1FH0A 3QJ3A 5JZEA 1S4VA 2Z84A 1THEA 2R9NA 3H8CA 5JA7A 1MIRA 5EF4A 4G54A 1O0EA 2NQAA 5CHVA 4OVZB 4QBBA 4Q8GA 3O0UA 4ZTBA 3KFQA 4YYQA 2FO5A 1MEGA 1VSNA 2NQDB 1X9YA 1YT7A 3PBHA 2E00A 2AS8A 3RVWA 1PBHA 2PBHA 3O65A 2ACTA 4RF1A 4CDFB 3KWBX 4YYVA 1U5IA 2P7UA 1AU2A 9PAPA 1GLOA 4X6JA 3BOWA 3QSDA 2HXZA 4K7CA 3BY4A 1U9XA 3K24A 2BDZA 3BB7A 1K3BB 3KX1A 4BOUA 3IMAA 2GHUA 2VHSA 3PNRA 4P16A 4I04A 3BPMA 3P5WA 3RNVA 3C9EA 2AGAA 2AYOA 3M99A 1CSBB 1AECA 1PPOA 3BCNA 2F7DA 4BOZA 5CVMA 2R9OA 1BGOA 2NQIA 2AUZA 2YJ2A 2R9FA 4YYWA 4P6EA 4BS5A 2G8JA 2FRAA 2Y6EA 3KKUA 4I05A 2AU1A 2ARYA 2Y5BA 4YYSA 4QRVA 1MDWA 3P5UA 4D8IA 3HHAA 4D8EA 1XKGA 2XU1A 4CDEB 1EWOA 1AIMA 2XU4A 1ITOA 2VHFA 3PT2A 1YK7A 2CIOA 3F75A 3BC3A 2DC7A 1NL6A 4X6HA 2DOSA 1Q6KA 1DKIA 4WA6A 1CQDA 2R9CA 1PE6A 4KLBA 2C0YA 5J94A 4BQVA 3TRKA 2IPPB 6PADA 1A6RA 2G6DA 2FT2A 3N3KA 4CZWA 2DCCA 2BTWA 2DZZA 5JH3A 1JQPA 1MEMA 4HWYA 2B1NA 1BY8A 1GCBA 3OVZA 1CJLA 3P5VA 3KWZA 4N4ZA 1HUCB 3CBKA 1CVZA 4BSQA 3H6SA 1AU0A 4FK5A 3OVXA 4BPVA 1PCIA 3CH2X 2GFOA 4GUAA 2JQFR 4OW0A 1PIPA 3HD3A 1VJVA 4FJCA 3OF8A 1IWDA 2BU3A 1YZBA 2R9MA 3B79A 2DJFB 2JRIA 3HHIA 3MHSA 1KFUL 3HWNA 1ZIVA 1UKFA 5KO3A 2BTWB 1TU6A 4DMXA 4BS6A 2AVWA 4RKXA 2YJ9A 4WURA 1CS8A 3IHPA 2XU3A 1F2CA 1PADA 1ATKA 2JTCA 1POPA 3PSEA 4QRXA 4YVAA 4N8WA 3F5VA 1AYWA 4OELA 1ME3A 4YYRA 4YYUA 1F2AA 3BPFA 3ZUAA 2O6XA 1QOLA 2AIMA 2AUXA 4FIPA 4X6IA 3USVA 3OF9A 2DZYA 1F29A 3CH3X 4YV8A 2H7JA 3PHWA 3V6EA 3RVXA 2DCDA 3E1ZB 1EWLA 3D6SA 3PHXA 4N79A 3U8EA 4R3DA 2PADA 2FE8A 2OULA 1QMYA 1NB5A 4D8BA 4QRGA 3PW3A 3K9MA 2E01A 2HWKA 1AU3A 3S3RA 4PP1A 4MZSA 2ATOA 4MSXA 4PT5A 1ZCMA 2HD5A 1KFXL 2FUDA 1SP4B 5FPWA 2FQ9A 3IEJA 3WXEA 3NHEA 3N3GA 1U9QX 2OP3A 2FYEA 3KSEA 3ERVA 2PNSA 3MTNA 3N4CA 1EWMA 3QT4A 1ICFA 1KXRA 3B21A 3CBJA 3C0RA 3KW9A 4IUMA 1U9WA 1AYVA 3PRPA 1NPZA 5A24A 4BOPA 1Y08A 4RNAA 1MS6A 4QH6A 3TMPA 1PPDA 3H8BA 4AXMA 3PDFA 2J7QC 1F2BA 2NQGA 5PADA 2F1GA 1MHWA 2DCAA 5EZSA 3O1GA 1YVBA 3W31A 1M6DA 1SNKA 1PVJA 3RVVA 7PCKA 5K16A 2J7QA 2FTDA 4PADA 2UZJA 4CDCB 3PHUA 4I07A 2DC9A 1TLOA 5CVNB 1EF7A 2P0RA 4MZOA 4P6GA 1CB5A 3DF0A 5CHTA 2FRQA 4OEMA
chains in the Genus database with same CATH topology
1YK8A 2YJ8A 3IUTA 1AYUA 1KHPA 1NB3A 1PXVA 4AXLA 4PI3A 4CDDB 1GECE 3I06A 8PCHA 2R6NA 2G8EA 5EGWA 4GUZA 2BDLA 2JQGR 2B1MA 4ZUXU 1QXPA 1TL9A 2G7YA 2HH5A 3TNXA 1NQCA 2IBIA 2PREA 1GMYA 2CB5A 3BWKA 5CVOB 2XU5A 2DJGB 3IOQA 1Y4HA 4PP2E 1PPPA 1BQIA 2DC8A 1AU4A 4NV8A 3V6CA 3D9WA 1QDQA 1DF0A 4XUIA 2OZ2A 2E03A 3IV2A 4XR7A 2VFBA 3MHHA 1EWPA 1CV8A 1U9VA 4W4UA 3I3TA 2YJCA 3S3QA 2E02A 3OISA 3LFYA 2DCBA 3GCBA 4RY2A 3H7DA 2P86A 1CPJA 1CTEA 1PPNA 4W5CA 4DMYA 1DEUA 1BP4A 3AI8A 3MORA 1STFE 1NLJA 2YJBA 3LXSA 2HHNA 1YALA 2AYNA 3H89A 3P5XA 4W5BA 3WXFA 1KHQA 4Q8HA 3K8UA 2WBFX 2DC6A 1ME4A 3WXGA 5F02A 1FH0A 3QJ3A 1S4VA 1THEA 2R9NA 3H8CA 5JA7A 1MIRA 5EF4A 1W6FA 4G54A 1O0EA 2NQAA 5CHVA 4QBBA 4Q8GA 3O0UA 3KFQA 4YYQA 2FO5A 1MEGA 1VSNA 2NQDB 1X9YA 1E2TA 1YT7A 3PBHA 2E00A 2AS8A 3RVWA 1PBHA 2PBHA 4B55A 2ACTA 4CDFB 3KWBX 4YYVA 1U5IA 2P7UA 1AU2A 9PAPA 1GLOA 4X6JA 3BOWA 3QSDA 2HXZA 4K7CA 1U9XA 3K24A 2BDZA 1K3BB 3KX1A 3IMAA 2GHUA 2VHSA 3PNRA 4I04A 3BPMA 3P5WA 3C9EA 2AYOA 3M99A 1CSBB 1AECA 1PPOA 3BCNA 2F7DA 5CVMA 2R9OA 1BGOA 2NQIA 2AUZA 2YJ2A 2R9FA 4YYWA 4P6EA 4BS5A 2G8JA 2FRAA 2Y6EA 3KKUA 4I05A 2AU1A 2ARYA 2Y5BA 4YYSA 4QRVA 1MDWA 3P5UA 3HHAA 1XKGA 2XU1A 4CDEB 1EWOA 1AIMA 2XU4A 1ITOA 2VHFA 2BSZA 1YK7A 2CIOA 3F75A 3BC3A 2DC7A 1NL6A 4X6HA 1Q6KA 4WA6A 1CQDA 2R9CA 1PE6A 4KLBA 2C0YA 5J94A 4BQVA 2IPPB 6PADA 1A6RA 2G6DA 2FT2A 3N3KA 4CZWA 2DCCA 2DZZA 5JH3A 1JQPA 1MEMA 4HWYA 2B1NA 1BY8A 1GCBA 3LTWA 3OVZA 1CJLA 3P5VA 3KWZA 4N4ZA 1HUCB 3CBKA 1CVZA 4BSQA 3H6SA 1AU0A 4FK5A 3OVXA 4BPVA 1PCIA 3CH2X 2GFOA 2JQFR 1PIPA 3HD3A 1VJVA 4FJCA 3OF8A 1IWDA 2R9MA 1W5RA 3B79A 2DJFB 3HHIA 3MHSA 1KFUL 3HWNA 1ZIVA 1TU6A 4DMXA 4BS6A 2AVWA 2YJ9A 1CS8A 3IHPA 2XU3A 1F2CA 1PADA 1ATKA 4QRXA 1POPA 4YVAA 4N8WA 4C5PA 3F5VA 1AYWA 4OELA 1ME3A 4BGFA 4YYRA 4YYUA 1F2AA 3BPFA 3ZUAA 2O6XA 1QOLA 2AIMA 2AUXA 4FIPA 4X6IA 3USVA 1GX3A 3OF9A 2DZYA 1F29A 3CH3X 4YV8A 2H7JA 3V6EA 3RVXA 2DCDA 3E1ZB 1EWLA 3D6SA 4N79A 3U8EA 2PADA 2OULA 1QMYA 2VFCA 1NB5A 4QRGA 3PW3A 3K9MA 2E01A 1AU3A 3S3RA 4PP1A 4MZSA 4MSXA 2ATOA 1ZCMA 2HD5A 1KFXL 2FUDA 1SP4B 5FPWA 2FQ9A 1W4TA 3IEJA 3WXEA 3NHEA 3N3GA 1U9QX 2OP3A 2FYEA 3KSEA 3ERVA 2PNSA 3MTNA 3N4CA 1EWMA 3QT4A 1ICFA 1KXRA 3CBJA 3KW9A 1U9WA 1AYVA 1NPZA 5A24A 4NV7A 1Y08A 1MS6A 4QH6A 1PPDA 3H8BA 4AXMA 3PDFA 1F2BA 2NQGA 5PADA 2F1GA 1MHWA 2DCAA 3O1GA 1YVBA 1M6DA 1SNKA 3RVVA 7PCKA 5K16A 2FTDA 4PADA 4CDCB 4I07A 2DC9A 1TLOA 5CVNB 1EF7A 2P0RA 4MZOA 4P6GA 1CB5A 3DF0A 5CHTA 2FRQA 4OEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YK8 A;  2YJ8 A;  3IUT A;  1AYU A;  1KHP A;  1NB3 A;  1PXV A;  4AXL A;  4PI3 A;  4CDD B;  1GEC E;  3I06 A;  8PCH A;  2R6N A;  2G8E A;  5EGW A;  2BDL A;  2JQG R;  2B1M A;  4ZUX U;  1QXP A;  1TL9 A;  2G7Y A;  2HH5 A;  3TNX A;  1NQC A;  2IBI A;  2PRE A;  1GMY A;  2CB5 A;  3BWK A;  5CVO B;  2XU5 A;  2DJG B;  3IOQ A;  1Y4H A;  4PP2 E;  1PPP A;  1BQI A;  2DC8 A;  1AU4 A;  3V6C A;  1QDQ A;  1DF0 A;  4XUI A;  2OZ2 A;  2E03 A;  3IV2 A;  4XR7 A;  3MHH A;  1EWP A;  1CV8 A;  1U9V A;  4W4U A;  3I3T A;  2YJC A;  3S3Q A;  2E02 A;  3OIS A;  3LFY A;  2DCB A;  3GCB A;  4RY2 A;  3H7D A;  2P86 A;  1CPJ A;  1CTE A;  1PPN A;  4W5C A;  4DMY A;  1DEU A;  1BP4 A;  3AI8 A;  3MOR A;  1STF E;  1NLJ A;  2YJB A;  3LXS A;  2HHN A;  1YAL A;  2AYN A;  3H89 A;  3P5X A;  4W5B A;  3WXF A;  1KHQ A;  4Q8H A;  3K8U A;  2WBF X;  2DC6 A;  1ME4 A;  3WXG A;  5F02 A;  1FH0 A;  3QJ3 A;  1S4V A;  1THE A;  2R9N A;  3H8C A;  5JA7 A;  1MIR A;  5EF4 A;  4G54 A;  1O0E A;  2NQA A;  5CHV A;  4QBB A;  4Q8G A;  3O0U A;  3KFQ A;  4YYQ A;  2FO5 A;  1MEG A;  1VSN A;  2NQD B;  1X9Y A;  1YT7 A;  3PBH A;  2E00 A;  2AS8 A;  3RVW A;  1PBH A;  2PBH A;  2ACT A;  4CDF B;  3KWB X;  4YYV A;  1U5I A;  2P7U A;  1AU2 A;  9PAP A;  1GLO A;  4X6J A;  3BOW A;  3QSD A;  2HXZ A;  4K7C A;  1U9X A;  3K24 A;  2BDZ A;  1K3B B;  3KX1 A;  3IMA A;  2GHU A;  2VHS A;  3PNR A;  4I04 A;  3BPM A;  3P5W A;  3C9E A;  2AYO A;  3M99 A;  1CSB B;  1AEC A;  1PPO A;  3BCN A;  2F7D A;  5CVM A;  2R9O A;  1BGO A;  2NQI A;  2AUZ A;  2YJ2 A;  2R9F A;  4YYW A;  4P6E A;  4BS5 A;  2G8J A;  2FRA A;  2Y6E A;  3KKU A;  4I05 A;  2AU1 A;  2ARY A;  2Y5B A;  4YYS A;  4QRV A;  1MDW A;  3P5U A;  3HHA A;  1XKG A;  2XU1 A;  4CDE B;  1EWO A;  1AIM A;  2XU4 A;  1ITO A;  2VHF A;  1YK7 A;  2CIO A;  3F75 A;  3BC3 A;  2DC7 A;  1NL6 A;  4X6H A;  1Q6K A;  4WA6 A;  1CQD A;  2R9C A;  1PE6 A;  4KLB A;  2C0Y A;  5J94 A;  4BQV A;  2IPP B;  6PAD A;  1A6R A;  2G6D A;  2FT2 A;  3N3K A;  4CZW A;  2DCC A;  2DZZ A;  5JH3 A;  1JQP A;  1MEM A;  4HWY A;  2B1N A;  1BY8 A;  1GCB A;  3OVZ A;  1CJL A;  3P5V A;  3KWZ A;  4N4Z A;  1HUC B;  3CBK A;  1CVZ A;  4BSQ A;  3H6S A;  1AU0 A;  4FK5 A;  3OVX A;  4BPV A;  1PCI A;  3CH2 X;  2GFO A;  2JQF R;  1PIP A;  3HD3 A;  1VJV A;  4FJC A;  3OF8 A;  1IWD A;  2R9M A;  3B79 A;  2DJF B;  3HHI A;  3MHS A;  1KFU L;  3HWN A;  1ZIV A;  1TU6 A;  4DMX A;  4BS6 A;  2AVW A;  2YJ9 A;  1CS8 A;  3IHP A;  2XU3 A;  1F2C A;  1PAD A;  1ATK A;  4QRX A;  1POP A;  4YVA A;  4N8W A;  3F5V A;  1AYW A;  4OEL A;  1ME3 A;  4YYR A;  4YYU A;  1F2A A;  3BPF A;  3ZUA A;  2O6X A;  1QOL A;  2AIM A;  2AUX A;  4FIP A;  4X6I A;  3USV A;  3OF9 A;  2DZY A;  1F29 A;  3CH3 X;  4YV8 A;  2H7J A;  3V6E A;  3RVX A;  2DCD A;  3E1Z B;  1EWL A;  3D6S A;  4N79 A;  3U8E A;  2PAD A;  2OUL A;  1QMY A;  1NB5 A;  4QRG A;  3PW3 A;  3K9M A;  2E01 A;  1AU3 A;  3S3R A;  4PP1 A;  4MZS A;  2ATO A;  4MSX A;  1ZCM A;  2HD5 A;  1KFX L;  2FUD A;  1SP4 B;  5FPW A;  2FQ9 A;  3IEJ A;  3WXE A;  3NHE A;  3N3G A;  1U9Q X;  2OP3 A;  2FYE A;  3KSE A;  3ERV A;  2PNS A;  3MTN A;  3N4C A;  1EWM A;  3QT4 A;  1ICF A;  1KXR A;  3CBJ A;  3KW9 A;  1U9W A;  1AYV A;  1NPZ A;  5A24 A;  1Y08 A;  1MS6 A;  4QH6 A;  1PPD A;  3H8B A;  4AXM A;  3PDF A;  1F2B A;  2NQG A;  5PAD A;  2F1G A;  1MHW A;  2DCA A;  3O1G A;  1YVB A;  1M6D A;  1SNK A;  3RVV A;  7PCK A;  5K16 A;  2FTD A;  4PAD A;  4CDC B;  4I07 A;  2DC9 A;  1TLO A;  5CVN B;  1EF7 A;  2P0R A;  4MZO A;  4P6G A;  1CB5 A;  3DF0 A;  5CHT A;  2FRQ A;  4OEM A; 
#chains in the Genus database with same CATH topology
 1YK8 A;  2YJ8 A;  3IUT A;  1AYU A;  1KHP A;  1NB3 A;  1PXV A;  4AXL A;  4PI3 A;  4MI7 A;  4CDD B;  3PRM A;  1GEC E;  3I06 A;  8PCH A;  2R6N A;  2G8E A;  5EGW A;  2BDL A;  2JQG R;  2B1M A;  4HXD B;  4ZUX U;  1QXP A;  1TL9 A;  2G7Y A;  2HH5 A;  3TNX A;  1NQC A;  2IBI A;  2PRE A;  1GMY A;  2CB5 A;  3BWK A;  5CVO B;  2XU5 A;  2DJG B;  3IOQ A;  1Y4H A;  4PP2 E;  1PPP A;  1BQI A;  2DC8 A;  1AU4 A;  4IP3 A;  3V6C A;  4BOQ A;  1QDQ A;  5E6J A;  1DF0 A;  4XUI A;  3BBA A;  2OZ2 A;  2E03 A;  3IV2 A;  3OQC A;  3MJ5 A;  3IFU A;  4XR7 A;  3MHH A;  1EWP A;  1CV8 A;  4XZX A;  3E9S A;  1U9V A;  4W4U A;  3I3T A;  2YJC A;  3S3Q A;  2E02 A;  3OIS A;  3LFY A;  2DCB A;  3GCB A;  4RY2 A;  3H7D A;  2P86 A;  1CPJ A;  4OVZ A;  1CTE A;  4A5U A;  1PPN A;  3MTV A;  4MM3 B;  4REZ A;  4W5C A;  4DMY A;  1DEU A;  3AI8 A;  1BP4 A;  4M0W A;  3MOR A;  1STF E;  5EZQ A;  4BOS A;  1NLJ A;  2YJB A;  3LXS A;  2HHN A;  1YAL A;  2AYN A;  3H89 A;  3P5X A;  4W5B A;  3WXF A;  1KHQ A;  3ZNH A;  4RF0 A;  4Q8H A;  3W30 A;  3K8U A;  2WBF X;  2DC6 A;  1ME4 A;  3MP2 A;  3WXG A;  5F02 A;  1FH0 A;  3QJ3 A;  5JZE A;  1S4V A;  2Z84 A;  1THE A;  2R9N A;  3H8C A;  5JA7 A;  1MIR A;  5EF4 A;  4G54 A;  1O0E A;  2NQA A;  5CHV A;  4OVZ B;  4QBB A;  4Q8G A;  3O0U A;  4ZTB A;  3KFQ A;  4YYQ A;  2FO5 A;  1MEG A;  1VSN A;  2NQD B;  1X9Y A;  1YT7 A;  3PBH A;  2E00 A;  2AS8 A;  3RVW A;  1PBH A;  2PBH A;  3O65 A;  2ACT A;  4RF1 A;  4CDF B;  3KWB X;  4YYV A;  1U5I A;  2P7U A;  1AU2 A;  9PAP A;  1GLO A;  4X6J A;  3BOW A;  3QSD A;  2HXZ A;  4K7C A;  3BY4 A;  1U9X A;  3K24 A;  2BDZ A;  3BB7 A;  1K3B B;  3KX1 A;  4BOU A;  3IMA A;  2GHU A;  2VHS A;  3PNR A;  4P16 A;  4I04 A;  3BPM A;  3P5W A;  3RNV A;  3C9E A;  2AGA A;  2AYO A;  3M99 A;  1CSB B;  1AEC A;  1PPO A;  3BCN A;  2F7D A;  4BOZ A;  5CVM A;  2R9O A;  1BGO A;  2NQI A;  2AUZ A;  2YJ2 A;  2R9F A;  4YYW A;  4P6E A;  4BS5 A;  2G8J A;  2FRA A;  2Y6E A;  3KKU A;  4I05 A;  2AU1 A;  2ARY A;  2Y5B A;  4YYS A;  4QRV A;  1MDW A;  3P5U A;  4D8I A;  3HHA A;  4D8E A;  1XKG A;  2XU1 A;  4CDE B;  1EWO A;  1AIM A;  2XU4 A;  1ITO A;  2VHF A;  3PT2 A;  1YK7 A;  2CIO A;  3F75 A;  3BC3 A;  2DC7 A;  1NL6 A;  4X6H A;  2DOS A;  1Q6K A;  1DKI A;  4WA6 A;  1CQD A;  2R9C A;  1PE6 A;  4KLB A;  2C0Y A;  5J94 A;  4BQV A;  3TRK A;  2IPP B;  6PAD A;  1A6R A;  2G6D A;  2FT2 A;  3N3K A;  4CZW A;  2DCC A;  2BTW A;  2DZZ A;  5JH3 A;  1JQP A;  1MEM A;  4HWY A;  2B1N A;  1BY8 A;  1GCB A;  3OVZ A;  1CJL A;  3P5V A;  3KWZ A;  4N4Z A;  1HUC B;  3CBK A;  1CVZ A;  4BSQ A;  3H6S A;  1AU0 A;  4FK5 A;  3OVX A;  4BPV A;  1PCI A;  3CH2 X;  2GFO A;  4GUA A;  2JQF R;  4OW0 A;  1PIP A;  3HD3 A;  1VJV A;  4FJC A;  3OF8 A;  1IWD A;  2BU3 A;  1YZB A;  2R9M A;  3B79 A;  2DJF B;  2JRI A;  3HHI A;  3MHS A;  1KFU L;  3HWN A;  1ZIV A;  1UKF A;  5KO3 A;  2BTW B;  1TU6 A;  4DMX A;  4BS6 A;  2AVW A;  4RKX A;  2YJ9 A;  4WUR A;  1CS8 A;  3IHP A;  2XU3 A;  1F2C A;  1PAD A;  1ATK A;  2JTC A;  1POP A;  3PSE A;  4QRX A;  4YVA A;  4N8W A;  3F5V A;  1AYW A;  4OEL A;  1ME3 A;  4YYR A;  4YYU A;  1F2A A;  3BPF A;  3ZUA A;  2O6X A;  1QOL A;  2AIM A;  2AUX A;  4FIP A;  4X6I A;  3USV A;  3OF9 A;  2DZY A;  1F29 A;  3CH3 X;  4YV8 A;  2H7J A;  3PHW A;  3V6E A;  3RVX A;  2DCD A;  3E1Z B;  1EWL A;  3D6S A;  3PHX A;  4N79 A;  3U8E A;  4R3D A;  2PAD A;  2FE8 A;  2OUL A;  1QMY A;  1NB5 A;  4D8B A;  4QRG A;  3PW3 A;  3K9M A;  2E01 A;  2HWK A;  1AU3 A;  3S3R A;  4PP1 A;  4MZS A;  2ATO A;  4MSX A;  4PT5 A;  1ZCM A;  2HD5 A;  1KFX L;  2FUD A;  1SP4 B;  5FPW A;  2FQ9 A;  3IEJ A;  3WXE A;  3NHE A;  3N3G A;  1U9Q X;  2OP3 A;  2FYE A;  3KSE A;  3ERV A;  2PNS A;  3MTN A;  3N4C A;  1EWM A;  3QT4 A;  1ICF A;  1KXR A;  3B21 A;  3CBJ A;  3C0R A;  3KW9 A;  4IUM A;  1U9W A;  1AYV A;  3PRP A;  1NPZ A;  5A24 A;  4BOP A;  1Y08 A;  4RNA A;  1MS6 A;  4QH6 A;  3TMP A;  1PPD A;  3H8B A;  4AXM A;  3PDF A;  2J7Q C;  1F2B A;  2NQG A;  5PAD A;  2F1G A;  1MHW A;  2DCA A;  5EZS A;  3O1G A;  1YVB A;  3W31 A;  1M6D A;  1SNK A;  1PVJ A;  3RVV A;  7PCK A;  5K16 A;  2J7Q A;  2FTD A;  4PAD A;  2UZJ A;  4CDC B;  3PHU A;  4I07 A;  2DC9 A;  1TLO A;  5CVN B;  1EF7 A;  2P0R A;  4MZO A;  4P6G A;  1CB5 A;  3DF0 A;  5CHT A;  2FRQ A;  4OEM A; 
#chains in the Genus database with same CATH homology
 1YK8 A;  2YJ8 A;  3IUT A;  1AYU A;  1KHP A;  1NB3 A;  1PXV A;  4AXL A;  4PI3 A;  4CDD B;  1GEC E;  3I06 A;  8PCH A;  2R6N A;  2G8E A;  5EGW A;  4GUZ A;  2BDL A;  2JQG R;  2B1M A;  4ZUX U;  1QXP A;  1TL9 A;  2G7Y A;  2HH5 A;  3TNX A;  1NQC A;  2IBI A;  2PRE A;  1GMY A;  2CB5 A;  3BWK A;  5CVO B;  2XU5 A;  2DJG B;  3IOQ A;  1Y4H A;  4PP2 E;  1PPP A;  1BQI A;  2DC8 A;  1AU4 A;  4NV8 A;  3V6C A;  3D9W A;  1QDQ A;  1DF0 A;  4XUI A;  2OZ2 A;  2E03 A;  3IV2 A;  4XR7 A;  2VFB A;  3MHH A;  1EWP A;  1CV8 A;  1U9V A;  4W4U A;  3I3T A;  2YJC A;  3S3Q A;  2E02 A;  3OIS A;  3LFY A;  2DCB A;  3GCB A;  4RY2 A;  3H7D A;  2P86 A;  1CPJ A;  1CTE A;  1PPN A;  4W5C A;  4DMY A;  1DEU A;  1BP4 A;  3AI8 A;  3MOR A;  1STF E;  1NLJ A;  2YJB A;  3LXS A;  2HHN A;  1YAL A;  2AYN A;  3H89 A;  3P5X A;  4W5B A;  3WXF A;  1KHQ A;  4Q8H A;  3K8U A;  2WBF X;  2DC6 A;  1ME4 A;  3WXG A;  5F02 A;  1FH0 A;  3QJ3 A;  1S4V A;  1THE A;  2R9N A;  3H8C A;  5JA7 A;  1MIR A;  5EF4 A;  1W6F A;  4G54 A;  1O0E A;  2NQA A;  5CHV A;  4QBB A;  4Q8G A;  3O0U A;  3KFQ A;  4YYQ A;  2FO5 A;  1MEG A;  1VSN A;  2NQD B;  1X9Y A;  1E2T A;  1YT7 A;  3PBH A;  2E00 A;  2AS8 A;  3RVW A;  1PBH A;  2PBH A;  4B55 A;  2ACT A;  4CDF B;  3KWB X;  4YYV A;  1U5I A;  2P7U A;  1AU2 A;  9PAP A;  1GLO A;  4X6J A;  3BOW A;  3QSD A;  2HXZ A;  4K7C A;  1U9X A;  3K24 A;  2BDZ A;  1K3B B;  3KX1 A;  3IMA A;  2GHU A;  2VHS A;  3PNR A;  4I04 A;  3BPM A;  3P5W A;  3C9E A;  2AYO A;  3M99 A;  1CSB B;  1AEC A;  1PPO A;  3BCN A;  2F7D A;  5CVM A;  2R9O A;  1BGO A;  2NQI A;  2AUZ A;  2YJ2 A;  2R9F A;  4YYW A;  4P6E A;  4BS5 A;  2G8J A;  2FRA A;  2Y6E A;  3KKU A;  4I05 A;  2AU1 A;  2ARY A;  2Y5B A;  4YYS A;  4QRV A;  1MDW A;  3P5U A;  3HHA A;  1XKG A;  2XU1 A;  4CDE B;  1EWO A;  1AIM A;  2XU4 A;  1ITO A;  2VHF A;  2BSZ A;  1YK7 A;  2CIO A;  3F75 A;  3BC3 A;  2DC7 A;  1NL6 A;  4X6H A;  1Q6K A;  4WA6 A;  1CQD A;  2R9C A;  1PE6 A;  4KLB A;  2C0Y A;  5J94 A;  4BQV A;  2IPP B;  6PAD A;  1A6R A;  2G6D A;  2FT2 A;  3N3K A;  4CZW A;  2DCC A;  2DZZ A;  5JH3 A;  1JQP A;  1MEM A;  4HWY A;  2B1N A;  1BY8 A;  1GCB A;  3LTW A;  3OVZ A;  1CJL A;  3P5V A;  3KWZ A;  4N4Z A;  1HUC B;  3CBK A;  1CVZ A;  4BSQ A;  3H6S A;  1AU0 A;  4FK5 A;  3OVX A;  4BPV A;  1PCI A;  3CH2 X;  2GFO A;  2JQF R;  1PIP A;  3HD3 A;  1VJV A;  4FJC A;  3OF8 A;  1IWD A;  2R9M A;  1W5R A;  3B79 A;  2DJF B;  3HHI A;  3MHS A;  1KFU L;  3HWN A;  1ZIV A;  1TU6 A;  4DMX A;  4BS6 A;  2AVW A;  2YJ9 A;  1CS8 A;  3IHP A;  2XU3 A;  1F2C A;  1PAD A;  1ATK A;  4QRX A;  1POP A;  4YVA A;  4N8W A;  4C5P A;  3F5V A;  1AYW A;  4OEL A;  1ME3 A;  4BGF A;  4YYR A;  4YYU A;  1F2A A;  3BPF A;  3ZUA A;  2O6X A;  1QOL A;  2AIM A;  2AUX A;  4FIP A;  4X6I A;  3USV A;  1GX3 A;  3OF9 A;  2DZY A;  1F29 A;  3CH3 X;  4YV8 A;  2H7J A;  3V6E A;  3RVX A;  2DCD A;  3E1Z B;  1EWL A;  3D6S A;  4N79 A;  3U8E A;  2PAD A;  2OUL A;  1QMY A;  2VFC A;  1NB5 A;  4QRG A;  3PW3 A;  3K9M A;  2E01 A;  1AU3 A;  3S3R A;  4PP1 A;  4MZS A;  4MSX A;  2ATO A;  1ZCM A;  2HD5 A;  1KFX L;  2FUD A;  1SP4 B;  5FPW A;  2FQ9 A;  1W4T A;  3IEJ A;  3WXE A;  3NHE A;  3N3G A;  1U9Q X;  2OP3 A;  2FYE A;  3KSE A;  3ERV A;  2PNS A;  3MTN A;  3N4C A;  1EWM A;  3QT4 A;  1ICF A;  1KXR A;  3CBJ A;  3KW9 A;  1U9W A;  1AYV A;  1NPZ A;  5A24 A;  4NV7 A;  1Y08 A;  1MS6 A;  4QH6 A;  1PPD A;  3H8B A;  4AXM A;  3PDF A;  1F2B A;  2NQG A;  5PAD A;  2F1G A;  1MHW A;  2DCA A;  3O1G A;  1YVB A;  1M6D A;  1SNK A;  3RVV A;  7PCK A;  5K16 A;  2FTD A;  4PAD A;  4CDC B;  4I07 A;  2DC9 A;  1TLO A;  5CVN B;  1EF7 A;  2P0R A;  4MZO A;  4P6G A;  1CB5 A;  3DF0 A;  5CHT A;  2FRQ A;  4OEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...