8PCHA

Crystal structure of porcine cathepsin h determined at 2.1 angstrom resolution: location of the mini-chain c-terminal carboxyl group defines cathepsin h aminopeptidase function
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
220
structure length
220
Chain Sequence
YPPSMDWRKKGNFVSPVKNQGSCGSCWTFSTTGALESAVAIATGKMLSLAEQQLVDCAQNFNNHGCQGGLPSQAFEYIRYNKGIMGEDTYPYKGQDDHCKFQPDKAIAFVKDVANITMNDEEAMVEAVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATHEPSIN H
publication title Crystal structure of porcine cathepsin H determined at 2.1 A resolution: location of the mini-chain C-terminal carboxyl group defines cathepsin H aminopeptidase function.
pubmed doi rcsb
total genus 57
structure length 220
sequence length 220
ec nomenclature ec 3.4.22.16: Cathepsin H.
pdb deposition date 1997-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 8pchA00
4I07A 4DMXA 2R9NA 1PCIA 1PE6A 1VSNA 3OISA 5F02A 1QDQA 1POPA 2G8EA 3BWKA 4FIPA 4N4ZA 2YJ9A 4X6IA 1CJLA 2DCAA 3HHAA 3I06A 2YJCA 4YYQA 3AI8A 1GECE 2P86A 1O0EA 1PADA 3P5XA 3N4CA 4BS5A 3TNXA 3HHIA 1AU0A 4MZOA 3KW9A 3MHSA 3K9MA 4I05A 1EWOA 1S4VA 2P7UA 2FO5A 2VHSA 1DEUA 5K16A 4Q8GA 2AUZA 2YJ2A 3PDFA 2NQAA 2DC9A 2FYEA 4BSQA 1ZIVA 4YYUA 4YYRA 2ATOA 1U9VA 1U9QX 1BP4A 3H7DA 3WXEA 1IWDA 4BQVA 4PP2E 4CDFB 4PP1A 3U8EA 3WXFA 4DMYA 1YK7A 2PBHA 1CV8A 8PCHA 3V6EA 3GCBA 1NB3A 2OP3A 5CHTA 4MSXA 1GMYA 2JQFR 1Q6KA 4QH6A 3E1ZB 3OVZA 1F29A 1QMYA 1YVBA 4X6HA 1YK8A 3MHHA 2H7JA 1U9XA 1CS8A 4KLBA 1STFE 1EWLA 2YJ8A 3IUTA 3O0UA 3S3QA 2B1MA 3PBHA 3H89A 3KFQA 2IPPB 4WA6A 5EGWA 1F2AA 4W4UA 1THEA 2FQ9A 2FT2A 3O1GA 1NPZA 2DCBA 2NQGA 2R9CA 1ITOA 1DF0A 1KFXL 3H6SA 2AVWA 4YYSA 2ARYA 4W5BA 5CHVA 2JQGR 1AIMA 1MS6A 2OULA 2PREA 5A24A 2G7YA 1MEGA 1QXPA 2F1GA 3KX1A 2VHFA 4QBBA 1PPNA 4FK5A 3H8CA 3RVWA 2AYNA 1KHPA 1JQPA 4CZWA 2F7DA 3BPMA 1ME4A 5JH3A 3ZUAA 4XUIA 3CH3X 3KKUA 2XU4A 5FPWA 3KSEA 2B1NA 3IV2A 2AUXA 3KWZA 3OF9A 3P5VA 4XR7A 2G6DA 1AYUA 2IBIA 1F2CA 4RY2A 2R9MA 2PADA 2HD5A 3PNRA 2ACTA 1SP4B 2CIOA 5CVNB 4AXLA 4CDEB 1MEMA 1XKGA 1KXRA 3KWBX 2CB5A 1Y4HA 1GLOA 4N8WA 6PADA 4AXMA 9PAPA 1CSBB 2NQDB 2E03A 2DCCA 2E00A 1CTEA 1CB5A 3MTNA 4PI3A 1CVZA 1GCBA 4ZUXU 3IMAA 5EF4A 2GFOA 3OF8A 1ME3A 1QOLA 3BC3A 4X6JA 1PPOA 2DCDA 4K7CA 2OZ2A 2R9OA 1TL9A 3CBKA 2HH5A 1ICFA 2C0YA 1AU4A 1HUCB 1NLJA 2R9FA 2AU1A 1TU6A 3RVVA 2DZYA 3M99A 1CQDA 3QT4A 4CDDB 3DF0A 5PADA 1AECA 1K3BB 4CDCB 1A6RA 4P6EA 3BCNA 2FRQA 2GHUA 3D6SA 2DC8A 4QRVA 2Y6EA 2DZZA 1NQCA 3QSDA 2BDZA 2WBFX 2XU5A 3RVXA 1ZCMA 1M6DA 3PW3A 3K24A 4W5CA 1PPPA 2XU3A 4FJCA 1AYWA 3C9EA 3HWNA 3QJ3A 1YT7A 1AU3A 3H8BA 1PBHA 5CVOB 1TLOA 2XU1A 5J94A 3HD3A 1BQIA 4BS6A 1X9YA 1PPDA 2BDLA 2E01A 3ERVA 2Y5BA 3K8UA 1NB5A 1PXVA 1BGOA 1MHWA 3N3GA 1BY8A 2FTDA 3CH2X 3IOQA 2E02A 1KFUL 1KHQA 2AIMA 3N3KA 1AU2A 3LXSA 3NHEA 3USVA 4YYWA 1Y08A 1EWMA 3LFYA 3F75A 4I04A 3F5VA 2NQIA 4YV8A 3B79A 1PIPA 1EWPA 2DC7A 2O6XA 4MZSA 4G54A 1VJVA 1AYVA 1F2BA 2AS8A 4QRXA 3OVXA 4Q8HA 2G8JA 3I3TA 2FUDA 4QRGA 3P5UA 4OELA 5CVMA 1ATKA 4OEMA 2R6NA 2HHNA 3S3RA 4BPVA 2PNSA 4HWYA 1FH0A 1NL6A 3WXGA 2HXZA 2P0RA 7PCKA 2YJBA 4YVAA 3BPFA 4P6GA 3MORA 2AYOA 1YALA 1SNKA 1CPJA 4PADA 3P5WA 3CBJA 3IEJA 4YYVA 2DC6A 1U9WA 1EF7A 1MIRA 3V6CA 1U5IA 2DJFB 5JA7A 1MDWA 2DJGB 3BOWA 2FRAA 3IHPA 4N79A
chains in the Genus database with same CATH superfamily
4I07A 4DMXA 2R9NA 1PCIA 1PE6A 1VSNA 3OISA 5F02A 1QDQA 1POPA 2G8EA 3BWKA 4FIPA 4N4ZA 2YJ9A 4X6IA 1CJLA 2DCAA 3HHAA 3I06A 1YZBA 2YJCA 4YYQA 3AI8A 1GECE 4MI7A 2P86A 1O0EA 1PADA 3P5XA 3N4CA 4BS5A 3PRMA 3TNXA 3HHIA 1AU0A 4MZOA 3KW9A 3RNVA 3MHSA 3K9MA 4I05A 1EWOA 1S4VA 2P7UA 2FO5A 2VHSA 1DEUA 4BOPA 5K16A 4Q8GA 4BOUA 2AUZA 2YJ2A 3PDFA 2NQAA 2DC9A 3BB7A 2FYEA 4BSQA 2BU3A 1ZIVA 4YYUA 4YYRA 2ATOA 1U9VA 1U9QX 1BP4A 3H7DA 3PSEA 1UKFA 3WXEA 4A5UA 1IWDA 4BQVA 4PP2E 4CDFB 4PP1A 3U8EA 3WXFA 4DMYA 4D8EA 4BOSA 1YK7A 2PBHA 1CV8A 8PCHA 3TMPA 3V6EA 3GCBA 1NB3A 2OP3A 5CHTA 4MSXA 1GMYA 2JQFR 1Q6KA 4QH6A 3E1ZB 2UZJA 3OVZA 1F29A 1QMYA 1YVBA 4X6HA 1YK8A 4BOQA 3MHHA 2H7JA 1U9XA 1CS8A 4KLBA 1STFE 1EWLA 2YJ8A 3IUTA 3O0UA 3ZNHA 3S3QA 2B1MA 3PBHA 3H89A 3KFQA 2IPPB 2BTWB 4XZXA 4WA6A 5EGWA 1F2AA 4W4UA 5JZEA 2FE8A 1THEA 2FQ9A 2FT2A 3O1GA 4RKXA 1NPZA 2DCBA 2NQGA 2R9CA 1ITOA 4OVZA 1DF0A 2J7QC 5EZSA 1KFXL 3H6SA 3PT2A 2AVWA 4YYSA 2ARYA 4W5BA 5CHVA 2JQGR 1AIMA 1MS6A 2OULA 2PREA 5A24A 2G7YA 1MEGA 1QXPA 2F1GA 5EZQA 3KX1A 2VHFA 4QBBA 1PPNA 4FK5A 3H8CA 3RVWA 2AYNA 1KHPA 1JQPA 4CZWA 2F7DA 5E6JA 5KO3A 4RF1A 3BPMA 1ME4A 5JH3A 3ZUAA 4XUIA 3CH3X 3KKUA 2XU4A 4RF0A 3O65A 5FPWA 3E9SA 3KSEA 2B1NA 3MP2A 3IV2A 3MJ5A 4BOZA 2AUXA 3KWZA 3OF9A 3P5VA 4XR7A 2G6DA 1AYUA 2IBIA 1F2CA 4RY2A 2R9MA 2PADA 2HD5A 3PNRA 3W31A 2ACTA 1SP4B 2CIOA 5CVNB 4AXLA 4CDEB 1MEMA 2DOSA 1XKGA 1PVJA 1KXRA 3TRKA 3KWBX 2CB5A 1Y4HA 1GLOA 4N8WA 6PADA 4AXMA 9PAPA 3BY4A 1CSBB 2NQDB 2E03A 2DCCA 2E00A 1CTEA 1CB5A 3MTNA 4PI3A 1CVZA 1GCBA 4ZUXU 3IMAA 3MTVA 5EF4A 2GFOA 3OF8A 1ME3A 1QOLA 2Z84A 3BC3A 4X6JA 1DKIA 4OW0A 2AGAA 3PHWA 1PPOA 2DCDA 4K7CA 2OZ2A 2R9OA 1TL9A 3CBKA 3OQCA 2HH5A 1ICFA 2C0YA 1AU4A 1HUCB 1NLJA 2R9FA 2AU1A 4WURA 1TU6A 3RVVA 2DZYA 3M99A 1CQDA 3QT4A 4CDDB 3DF0A 5PADA 1AECA 1K3BB 4CDCB 1A6RA 2HWKA 2BTWA 4P6EA 3BCNA 2FRQA 4GUAA 2GHUA 3D6SA 2DC8A 4QRVA 2Y6EA 2DZZA 1NQCA 3QSDA 2BDZA 2WBFX 2XU5A 3RVXA 1ZCMA 1M6DA 3PW3A 3K24A 4W5CA 1PPPA 2XU3A 4FJCA 1AYWA 3C9EA 2JRIA 4M0WA 3HWNA 3QJ3A 1YT7A 1AU3A 3H8BA 1PBHA 3PHXA 5CVOB 1TLOA 3PHUA 4IP3A 2XU1A 5J94A 3HD3A 1BQIA 4BS6A 1X9YA 1PPDA 2BDLA 2E01A 3ERVA 2Y5BA 3K8UA 1NB5A 1PXVA 1BGOA 1MHWA 3N3GA 1BY8A 2FTDA 4REZA 3CH2X 3IOQA 2E02A 1KFUL 1KHQA 2AIMA 3N3KA 3IFUA 4RNAA 1AU2A 3LXSA 3NHEA 3USVA 4YYWA 1Y08A 1EWMA 3LFYA 3F75A 4I04A 3F5VA 2JTCA 2NQIA 3BBAA 4YV8A 3B79A 1PIPA 1EWPA 4MM3B 2DC7A 2O6XA 4MZSA 4G54A 1VJVA 1AYVA 1F2BA 2AS8A 4QRXA 4D8IA 3OVXA 2J7QA 3W30A 2G8JA 4PT5A 4Q8HA 3B21A 3I3TA 4HXDB 2FUDA 4QRGA 3P5UA 4OELA 5CVMA 1ATKA 4OEMA 3C0RA 2R6NA 2HHNA 3S3RA 4BPVA 2PNSA 4HWYA 1FH0A 1NL6A 3WXGA 4ZTBA 2HXZA 2P0RA 3PRPA 7PCKA 2YJBA 4YVAA 3BPFA 4P6GA 3MORA 2AYOA 1YALA 1SNKA 1CPJA 4PADA 3P5WA 4R3DA 3CBJA 3IEJA 4OVZB 4YYVA 2DC6A 1U9WA 1EF7A 4IUMA 1MIRA 3V6CA 1U5IA 2DJFB 4P16A 5JA7A 1MDWA 2DJGB 3BOWA 2FRAA 3IHPA 4D8BA 4N79A
chains in the Genus database with same CATH topology
4I07A 4DMXA 2R9NA 1PCIA 1PE6A 1VSNA 3OISA 5F02A 1QDQA 1POPA 2G8EA 3BWKA 4FIPA 4N4ZA 2YJ9A 4X6IA 1CJLA 2DCAA 3HHAA 3I06A 1GX3A 2YJCA 4YYQA 3AI8A 1GECE 2P86A 1O0EA 1PADA 3P5XA 3N4CA 4BS5A 3TNXA 3HHIA 1AU0A 4MZOA 3KW9A 3MHSA 3K9MA 4I05A 1EWOA 1S4VA 2P7UA 2FO5A 2VHSA 1DEUA 5K16A 4Q8GA 2AUZA 2YJ2A 3PDFA 2NQAA 2DC9A 2FYEA 4BSQA 1ZIVA 4YYUA 4YYRA 2ATOA 1U9VA 1U9QX 1BP4A 3H7DA 3WXEA 1IWDA 4BQVA 4PP2E 4CDFB 4PP1A 3U8EA 3WXFA 4DMYA 1YK7A 2PBHA 1CV8A 8PCHA 3V6EA 3GCBA 1NB3A 2OP3A 5CHTA 4MSXA 1GMYA 2JQFR 1Q6KA 4QH6A 3E1ZB 3OVZA 1F29A 1QMYA 1YVBA 4X6HA 1YK8A 3MHHA 2H7JA 1U9XA 1CS8A 4KLBA 1STFE 1EWLA 2YJ8A 3IUTA 3O0UA 3S3QA 2B1MA 3PBHA 3H89A 3KFQA 2IPPB 4GUZA 4WA6A 5EGWA 1F2AA 4W4UA 1THEA 2FQ9A 2FT2A 3O1GA 1NPZA 2DCBA 2NQGA 2R9CA 1ITOA 1DF0A 1KFXL 3H6SA 2AVWA 4YYSA 2ARYA 4W5BA 5CHVA 2JQGR 1AIMA 1MS6A 2OULA 2PREA 5A24A 2G7YA 1MEGA 1QXPA 4BGFA 2F1GA 3KX1A 2VHFA 4QBBA 1PPNA 4FK5A 3H8CA 3RVWA 2AYNA 1KHPA 1JQPA 4CZWA 2F7DA 3BPMA 1ME4A 5JH3A 3ZUAA 4XUIA 3CH3X 3KKUA 2XU4A 1W6FA 5FPWA 3KSEA 2B1NA 3IV2A 2AUXA 3KWZA 3OF9A 3P5VA 4XR7A 2G6DA 1AYUA 2IBIA 1F2CA 4RY2A 2R9MA 2PADA 2HD5A 3PNRA 2ACTA 1SP4B 2CIOA 5CVNB 4AXLA 4CDEB 1MEMA 1XKGA 4B55A 1KXRA 3KWBX 2CB5A 1Y4HA 1GLOA 4N8WA 6PADA 4AXMA 9PAPA 1CSBB 2NQDB 2E03A 2DCCA 2E00A 1CTEA 1CB5A 3MTNA 4PI3A 1CVZA 1GCBA 4ZUXU 3IMAA 5EF4A 2GFOA 3OF8A 1ME3A 1QOLA 3BC3A 4X6JA 1PPOA 2DCDA 4K7CA 2OZ2A 3D9WA 2R9OA 1TL9A 1E2TA 3CBKA 2HH5A 1ICFA 2C0YA 1AU4A 1HUCB 1NLJA 2R9FA 2AU1A 1TU6A 3RVVA 2DZYA 3M99A 1CQDA 3QT4A 4CDDB 3DF0A 5PADA 1AECA 1K3BB 4CDCB 1A6RA 4P6EA 3BCNA 2FRQA 2GHUA 3D6SA 2DC8A 4QRVA 2Y6EA 2DZZA 1NQCA 3QSDA 2BDZA 2WBFX 2XU5A 3RVXA 1ZCMA 1M6DA 3PW3A 3K24A 4W5CA 1PPPA 2XU3A 4FJCA 1W5RA 1AYWA 3C9EA 3HWNA 3QJ3A 1YT7A 1AU3A 3H8BA 1PBHA 5CVOB 1TLOA 2XU1A 5J94A 3HD3A 1BQIA 4BS6A 1X9YA 1PPDA 2BDLA 2E01A 3ERVA 1W4TA 2Y5BA 3K8UA 1NB5A 1PXVA 1BGOA 1MHWA 3N3GA 1BY8A 2FTDA 3CH2X 3IOQA 2E02A 1KFUL 1KHQA 2AIMA 3N3KA 1AU2A 3LTWA 3LXSA 3NHEA 3USVA 4YYWA 2VFCA 1Y08A 2VFBA 1EWMA 3LFYA 3F75A 4I04A 3F5VA 2NQIA 4YV8A 3B79A 1PIPA 1EWPA 2DC7A 2O6XA 4MZSA 4G54A 1VJVA 1AYVA 1F2BA 2AS8A 4QRXA 3OVXA 4Q8HA 2G8JA 3I3TA 4NV8A 2FUDA 4QRGA 3P5UA 4OELA 5CVMA 1ATKA 4OEMA 4C5PA 2R6NA 2HHNA 3S3RA 4BPVA 2PNSA 4HWYA 1FH0A 1NL6A 3WXGA 2HXZA 2P0RA 7PCKA 2YJBA 4YVAA 3BPFA 4P6GA 3MORA 4NV7A 2AYOA 1YALA 1SNKA 1CPJA 4PADA 2BSZA 3P5WA 3CBJA 3IEJA 4YYVA 2DC6A 1U9WA 1EF7A 1MIRA 3V6CA 1U5IA 2DJFB 5JA7A 1MDWA 2DJGB 3BOWA 2FRAA 3IHPA 4N79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I07 A;  4DMX A;  2R9N A;  1PCI A;  1PE6 A;  1VSN A;  3OIS A;  5F02 A;  1QDQ A;  1POP A;  2G8E A;  3BWK A;  4FIP A;  4N4Z A;  2YJ9 A;  4X6I A;  1CJL A;  2DCA A;  3HHA A;  3I06 A;  2YJC A;  4YYQ A;  3AI8 A;  1GEC E;  2P86 A;  1O0E A;  1PAD A;  3P5X A;  3N4C A;  4BS5 A;  3TNX A;  3HHI A;  1AU0 A;  4MZO A;  3KW9 A;  3MHS A;  3K9M A;  4I05 A;  1EWO A;  1S4V A;  2P7U A;  2FO5 A;  2VHS A;  1DEU A;  5K16 A;  4Q8G A;  2AUZ A;  2YJ2 A;  3PDF A;  2NQA A;  2DC9 A;  2FYE A;  4BSQ A;  1ZIV A;  4YYU A;  4YYR A;  2ATO A;  1U9V A;  1U9Q X;  1BP4 A;  3H7D A;  3WXE A;  1IWD A;  4BQV A;  4PP2 E;  4CDF B;  4PP1 A;  3U8E A;  3WXF A;  4DMY A;  1YK7 A;  2PBH A;  1CV8 A;  8PCH A;  3V6E A;  3GCB A;  1NB3 A;  2OP3 A;  5CHT A;  4MSX A;  1GMY A;  2JQF R;  1Q6K A;  4QH6 A;  3E1Z B;  3OVZ A;  1F29 A;  1QMY A;  1YVB A;  4X6H A;  1YK8 A;  3MHH A;  2H7J A;  1U9X A;  1CS8 A;  4KLB A;  1STF E;  1EWL A;  2YJ8 A;  3IUT A;  3O0U A;  3S3Q A;  2B1M A;  3PBH A;  3H89 A;  3KFQ A;  2IPP B;  4WA6 A;  5EGW A;  1F2A A;  4W4U A;  1THE A;  2FQ9 A;  2FT2 A;  3O1G A;  1NPZ A;  2DCB A;  2NQG A;  2R9C A;  1ITO A;  1DF0 A;  1KFX L;  3H6S A;  2AVW A;  4YYS A;  2ARY A;  4W5B A;  5CHV A;  2JQG R;  1AIM A;  1MS6 A;  2OUL A;  2PRE A;  5A24 A;  2G7Y A;  1MEG A;  1QXP A;  2F1G A;  3KX1 A;  2VHF A;  4QBB A;  1PPN A;  4FK5 A;  3H8C A;  3RVW A;  2AYN A;  1KHP A;  1JQP A;  4CZW A;  2F7D A;  3BPM A;  1ME4 A;  5JH3 A;  3ZUA A;  4XUI A;  3CH3 X;  3KKU A;  2XU4 A;  5FPW A;  3KSE A;  2B1N A;  3IV2 A;  2AUX A;  3KWZ A;  3OF9 A;  3P5V A;  4XR7 A;  2G6D A;  1AYU A;  2IBI A;  1F2C A;  4RY2 A;  2R9M A;  2PAD A;  2HD5 A;  3PNR A;  2ACT A;  1SP4 B;  2CIO A;  5CVN B;  4AXL A;  4CDE B;  1MEM A;  1XKG A;  1KXR A;  3KWB X;  2CB5 A;  1Y4H A;  1GLO A;  4N8W A;  6PAD A;  4AXM A;  9PAP A;  1CSB B;  2NQD B;  2E03 A;  2DCC A;  2E00 A;  1CTE A;  1CB5 A;  3MTN A;  4PI3 A;  1CVZ A;  1GCB A;  4ZUX U;  3IMA A;  5EF4 A;  2GFO A;  3OF8 A;  1ME3 A;  1QOL A;  3BC3 A;  4X6J A;  1PPO A;  2DCD A;  4K7C A;  2OZ2 A;  2R9O A;  1TL9 A;  3CBK A;  2HH5 A;  1ICF A;  2C0Y A;  1AU4 A;  1HUC B;  1NLJ A;  2R9F A;  2AU1 A;  1TU6 A;  3RVV A;  2DZY A;  3M99 A;  1CQD A;  3QT4 A;  4CDD B;  3DF0 A;  5PAD A;  1AEC A;  1K3B B;  4CDC B;  1A6R A;  4P6E A;  3BCN A;  2FRQ A;  2GHU A;  3D6S A;  2DC8 A;  4QRV A;  2Y6E A;  2DZZ A;  1NQC A;  3QSD A;  2BDZ A;  2WBF X;  2XU5 A;  3RVX A;  1ZCM A;  1M6D A;  3PW3 A;  3K24 A;  4W5C A;  1PPP A;  2XU3 A;  4FJC A;  1AYW A;  3C9E A;  3HWN A;  3QJ3 A;  1YT7 A;  1AU3 A;  3H8B A;  1PBH A;  5CVO B;  1TLO A;  2XU1 A;  5J94 A;  3HD3 A;  1BQI A;  4BS6 A;  1X9Y A;  1PPD A;  2BDL A;  2E01 A;  3ERV A;  2Y5B A;  3K8U A;  1NB5 A;  1PXV A;  1BGO A;  1MHW A;  3N3G A;  1BY8 A;  2FTD A;  3CH2 X;  3IOQ A;  2E02 A;  1KFU L;  1KHQ A;  2AIM A;  3N3K A;  1AU2 A;  3LXS A;  3NHE A;  3USV A;  4YYW A;  1Y08 A;  1EWM A;  3LFY A;  3F75 A;  4I04 A;  3F5V A;  2NQI A;  4YV8 A;  3B79 A;  1PIP A;  1EWP A;  2DC7 A;  2O6X A;  4MZS A;  4G54 A;  1VJV A;  1AYV A;  1F2B A;  2AS8 A;  4QRX A;  3OVX A;  4Q8H A;  2G8J A;  3I3T A;  2FUD A;  4QRG A;  3P5U A;  4OEL A;  5CVM A;  1ATK A;  4OEM A;  2R6N A;  2HHN A;  3S3R A;  4BPV A;  2PNS A;  4HWY A;  1FH0 A;  1NL6 A;  3WXG A;  2HXZ A;  2P0R A;  7PCK A;  2YJB A;  4YVA A;  3BPF A;  4P6G A;  3MOR A;  2AYO A;  1YAL A;  1SNK A;  1CPJ A;  4PAD A;  3P5W A;  3CBJ A;  3IEJ A;  4YYV A;  2DC6 A;  1U9W A;  1EF7 A;  1MIR A;  3V6C A;  1U5I A;  2DJF B;  5JA7 A;  1MDW A;  2DJG B;  3BOW A;  2FRA A;  3IHP A;  4N79 A; 
#chains in the Genus database with same CATH topology
 4I07 A;  4DMX A;  2R9N A;  1PCI A;  1PE6 A;  1VSN A;  3OIS A;  5F02 A;  1QDQ A;  1POP A;  2G8E A;  3BWK A;  4FIP A;  4N4Z A;  2YJ9 A;  4X6I A;  1CJL A;  2DCA A;  3HHA A;  3I06 A;  1YZB A;  2YJC A;  4YYQ A;  3AI8 A;  1GEC E;  4MI7 A;  2P86 A;  1O0E A;  1PAD A;  3P5X A;  3N4C A;  4BS5 A;  3PRM A;  3TNX A;  3HHI A;  1AU0 A;  4MZO A;  3KW9 A;  3RNV A;  3MHS A;  3K9M A;  4I05 A;  1EWO A;  1S4V A;  2P7U A;  2FO5 A;  2VHS A;  1DEU A;  4BOP A;  5K16 A;  4Q8G A;  4BOU A;  2AUZ A;  2YJ2 A;  3PDF A;  2NQA A;  2DC9 A;  3BB7 A;  2FYE A;  4BSQ A;  2BU3 A;  1ZIV A;  4YYU A;  4YYR A;  2ATO A;  1U9V A;  1U9Q X;  1BP4 A;  3H7D A;  3PSE A;  1UKF A;  3WXE A;  4A5U A;  1IWD A;  4BQV A;  4PP2 E;  4CDF B;  4PP1 A;  3U8E A;  3WXF A;  4DMY A;  4D8E A;  4BOS A;  1YK7 A;  2PBH A;  1CV8 A;  8PCH A;  3TMP A;  3V6E A;  3GCB A;  1NB3 A;  2OP3 A;  5CHT A;  4MSX A;  1GMY A;  2JQF R;  1Q6K A;  4QH6 A;  3E1Z B;  2UZJ A;  3OVZ A;  1F29 A;  1QMY A;  1YVB A;  4X6H A;  1YK8 A;  4BOQ A;  3MHH A;  2H7J A;  1U9X A;  1CS8 A;  4KLB A;  1STF E;  1EWL A;  2YJ8 A;  3IUT A;  3O0U A;  3ZNH A;  3S3Q A;  2B1M A;  3PBH A;  3H89 A;  3KFQ A;  2IPP B;  2BTW B;  4XZX A;  4WA6 A;  5EGW A;  1F2A A;  4W4U A;  5JZE A;  2FE8 A;  1THE A;  2FQ9 A;  2FT2 A;  3O1G A;  4RKX A;  1NPZ A;  2DCB A;  2NQG A;  2R9C A;  1ITO A;  4OVZ A;  1DF0 A;  2J7Q C;  5EZS A;  1KFX L;  3H6S A;  3PT2 A;  2AVW A;  4YYS A;  2ARY A;  4W5B A;  5CHV A;  2JQG R;  1AIM A;  1MS6 A;  2OUL A;  2PRE A;  5A24 A;  2G7Y A;  1MEG A;  1QXP A;  2F1G A;  5EZQ A;  3KX1 A;  2VHF A;  4QBB A;  1PPN A;  4FK5 A;  3H8C A;  3RVW A;  2AYN A;  1KHP A;  1JQP A;  4CZW A;  2F7D A;  5E6J A;  5KO3 A;  4RF1 A;  3BPM A;  1ME4 A;  5JH3 A;  3ZUA A;  4XUI A;  3CH3 X;  3KKU A;  2XU4 A;  4RF0 A;  3O65 A;  5FPW A;  3E9S A;  3KSE A;  2B1N A;  3MP2 A;  3IV2 A;  3MJ5 A;  4BOZ A;  2AUX A;  3KWZ A;  3OF9 A;  3P5V A;  4XR7 A;  2G6D A;  1AYU A;  2IBI A;  1F2C A;  4RY2 A;  2R9M A;  2PAD A;  2HD5 A;  3PNR A;  3W31 A;  2ACT A;  1SP4 B;  2CIO A;  5CVN B;  4AXL A;  4CDE B;  1MEM A;  2DOS A;  1XKG A;  1PVJ A;  1KXR A;  3TRK A;  3KWB X;  2CB5 A;  1Y4H A;  1GLO A;  4N8W A;  6PAD A;  4AXM A;  9PAP A;  3BY4 A;  1CSB B;  2NQD B;  2E03 A;  2DCC A;  2E00 A;  1CTE A;  1CB5 A;  3MTN A;  4PI3 A;  1CVZ A;  1GCB A;  4ZUX U;  3IMA A;  3MTV A;  5EF4 A;  2GFO A;  3OF8 A;  1ME3 A;  1QOL A;  2Z84 A;  3BC3 A;  4X6J A;  1DKI A;  4OW0 A;  2AGA A;  3PHW A;  1PPO A;  2DCD A;  4K7C A;  2OZ2 A;  2R9O A;  1TL9 A;  3CBK A;  3OQC A;  2HH5 A;  1ICF A;  2C0Y A;  1AU4 A;  1HUC B;  1NLJ A;  2R9F A;  2AU1 A;  4WUR A;  1TU6 A;  3RVV A;  2DZY A;  3M99 A;  1CQD A;  3QT4 A;  4CDD B;  3DF0 A;  5PAD A;  1AEC A;  1K3B B;  4CDC B;  1A6R A;  2HWK A;  2BTW A;  4P6E A;  3BCN A;  2FRQ A;  4GUA A;  2GHU A;  3D6S A;  2DC8 A;  4QRV A;  2Y6E A;  2DZZ A;  1NQC A;  3QSD A;  2BDZ A;  2WBF X;  2XU5 A;  3RVX A;  1ZCM A;  1M6D A;  3PW3 A;  3K24 A;  4W5C A;  1PPP A;  2XU3 A;  4FJC A;  1AYW A;  3C9E A;  2JRI A;  4M0W A;  3HWN A;  3QJ3 A;  1YT7 A;  1AU3 A;  3H8B A;  1PBH A;  3PHX A;  5CVO B;  1TLO A;  3PHU A;  4IP3 A;  2XU1 A;  5J94 A;  3HD3 A;  1BQI A;  4BS6 A;  1X9Y A;  1PPD A;  2BDL A;  2E01 A;  3ERV A;  2Y5B A;  3K8U A;  1NB5 A;  1PXV A;  1BGO A;  1MHW A;  3N3G A;  1BY8 A;  2FTD A;  4REZ A;  3CH2 X;  3IOQ A;  2E02 A;  1KFU L;  1KHQ A;  2AIM A;  3N3K A;  3IFU A;  4RNA A;  1AU2 A;  3LXS A;  3NHE A;  3USV A;  4YYW A;  1Y08 A;  1EWM A;  3LFY A;  3F75 A;  4I04 A;  3F5V A;  2JTC A;  2NQI A;  3BBA A;  4YV8 A;  3B79 A;  1PIP A;  1EWP A;  4MM3 B;  2DC7 A;  2O6X A;  4MZS A;  4G54 A;  1VJV A;  1AYV A;  1F2B A;  2AS8 A;  4QRX A;  4D8I A;  3OVX A;  2J7Q A;  3W30 A;  2G8J A;  4PT5 A;  4Q8H A;  3B21 A;  3I3T A;  4HXD B;  2FUD A;  4QRG A;  3P5U A;  4OEL A;  5CVM A;  1ATK A;  4OEM A;  3C0R A;  2R6N A;  2HHN A;  3S3R A;  4BPV A;  2PNS A;  4HWY A;  1FH0 A;  1NL6 A;  3WXG A;  4ZTB A;  2HXZ A;  2P0R A;  3PRP A;  7PCK A;  2YJB A;  4YVA A;  3BPF A;  4P6G A;  3MOR A;  2AYO A;  1YAL A;  1SNK A;  1CPJ A;  4PAD A;  3P5W A;  4R3D A;  3CBJ A;  3IEJ A;  4OVZ B;  4YYV A;  2DC6 A;  1U9W A;  1EF7 A;  4IUM A;  1MIR A;  3V6C A;  1U5I A;  2DJF B;  4P16 A;  5JA7 A;  1MDW A;  2DJG B;  3BOW A;  2FRA A;  3IHP A;  4D8B A;  4N79 A; 
#chains in the Genus database with same CATH homology
 4I07 A;  4DMX A;  2R9N A;  1PCI A;  1PE6 A;  1VSN A;  3OIS A;  5F02 A;  1QDQ A;  1POP A;  2G8E A;  3BWK A;  4FIP A;  4N4Z A;  2YJ9 A;  4X6I A;  1CJL A;  2DCA A;  3HHA A;  3I06 A;  1GX3 A;  2YJC A;  4YYQ A;  3AI8 A;  1GEC E;  2P86 A;  1O0E A;  1PAD A;  3P5X A;  3N4C A;  4BS5 A;  3TNX A;  3HHI A;  1AU0 A;  4MZO A;  3KW9 A;  3MHS A;  3K9M A;  4I05 A;  1EWO A;  1S4V A;  2P7U A;  2FO5 A;  2VHS A;  1DEU A;  5K16 A;  4Q8G A;  2AUZ A;  2YJ2 A;  3PDF A;  2NQA A;  2DC9 A;  2FYE A;  4BSQ A;  1ZIV A;  4YYU A;  4YYR A;  2ATO A;  1U9V A;  1U9Q X;  1BP4 A;  3H7D A;  3WXE A;  1IWD A;  4BQV A;  4PP2 E;  4CDF B;  4PP1 A;  3U8E A;  3WXF A;  4DMY A;  1YK7 A;  2PBH A;  1CV8 A;  8PCH A;  3V6E A;  3GCB A;  1NB3 A;  2OP3 A;  5CHT A;  4MSX A;  1GMY A;  2JQF R;  1Q6K A;  4QH6 A;  3E1Z B;  3OVZ A;  1F29 A;  1QMY A;  1YVB A;  4X6H A;  1YK8 A;  3MHH A;  2H7J A;  1U9X A;  1CS8 A;  4KLB A;  1STF E;  1EWL A;  2YJ8 A;  3IUT A;  3O0U A;  3S3Q A;  2B1M A;  3PBH A;  3H89 A;  3KFQ A;  2IPP B;  4GUZ A;  4WA6 A;  5EGW A;  1F2A A;  4W4U A;  1THE A;  2FQ9 A;  2FT2 A;  3O1G A;  1NPZ A;  2DCB A;  2NQG A;  2R9C A;  1ITO A;  1DF0 A;  1KFX L;  3H6S A;  2AVW A;  4YYS A;  2ARY A;  4W5B A;  5CHV A;  2JQG R;  1AIM A;  1MS6 A;  2OUL A;  2PRE A;  5A24 A;  2G7Y A;  1MEG A;  1QXP A;  4BGF A;  2F1G A;  3KX1 A;  2VHF A;  4QBB A;  1PPN A;  4FK5 A;  3H8C A;  3RVW A;  2AYN A;  1KHP A;  1JQP A;  4CZW A;  2F7D A;  3BPM A;  1ME4 A;  5JH3 A;  3ZUA A;  4XUI A;  3CH3 X;  3KKU A;  2XU4 A;  1W6F A;  5FPW A;  3KSE A;  2B1N A;  3IV2 A;  2AUX A;  3KWZ A;  3OF9 A;  3P5V A;  4XR7 A;  2G6D A;  1AYU A;  2IBI A;  1F2C A;  4RY2 A;  2R9M A;  2PAD A;  2HD5 A;  3PNR A;  2ACT A;  1SP4 B;  2CIO A;  5CVN B;  4AXL A;  4CDE B;  1MEM A;  1XKG A;  4B55 A;  1KXR A;  3KWB X;  2CB5 A;  1Y4H A;  1GLO A;  4N8W A;  6PAD A;  4AXM A;  9PAP A;  1CSB B;  2NQD B;  2E03 A;  2DCC A;  2E00 A;  1CTE A;  1CB5 A;  3MTN A;  4PI3 A;  1CVZ A;  1GCB A;  4ZUX U;  3IMA A;  5EF4 A;  2GFO A;  3OF8 A;  1ME3 A;  1QOL A;  3BC3 A;  4X6J A;  1PPO A;  2DCD A;  4K7C A;  2OZ2 A;  3D9W A;  2R9O A;  1TL9 A;  1E2T A;  3CBK A;  2HH5 A;  1ICF A;  2C0Y A;  1AU4 A;  1HUC B;  1NLJ A;  2R9F A;  2AU1 A;  1TU6 A;  3RVV A;  2DZY A;  3M99 A;  1CQD A;  3QT4 A;  4CDD B;  3DF0 A;  5PAD A;  1AEC A;  1K3B B;  4CDC B;  1A6R A;  4P6E A;  3BCN A;  2FRQ A;  2GHU A;  3D6S A;  2DC8 A;  4QRV A;  2Y6E A;  2DZZ A;  1NQC A;  3QSD A;  2BDZ A;  2WBF X;  2XU5 A;  3RVX A;  1ZCM A;  1M6D A;  3PW3 A;  3K24 A;  4W5C A;  1PPP A;  2XU3 A;  4FJC A;  1W5R A;  1AYW A;  3C9E A;  3HWN A;  3QJ3 A;  1YT7 A;  1AU3 A;  3H8B A;  1PBH A;  5CVO B;  1TLO A;  2XU1 A;  5J94 A;  3HD3 A;  1BQI A;  4BS6 A;  1X9Y A;  1PPD A;  2BDL A;  2E01 A;  3ERV A;  1W4T A;  2Y5B A;  3K8U A;  1NB5 A;  1PXV A;  1BGO A;  1MHW A;  3N3G A;  1BY8 A;  2FTD A;  3CH2 X;  3IOQ A;  2E02 A;  1KFU L;  1KHQ A;  2AIM A;  3N3K A;  1AU2 A;  3LTW A;  3LXS A;  3NHE A;  3USV A;  4YYW A;  2VFC A;  1Y08 A;  2VFB A;  1EWM A;  3LFY A;  3F75 A;  4I04 A;  3F5V A;  2NQI A;  4YV8 A;  3B79 A;  1PIP A;  1EWP A;  2DC7 A;  2O6X A;  4MZS A;  4G54 A;  1VJV A;  1AYV A;  1F2B A;  2AS8 A;  4QRX A;  3OVX A;  4Q8H A;  2G8J A;  3I3T A;  4NV8 A;  2FUD A;  4QRG A;  3P5U A;  4OEL A;  5CVM A;  1ATK A;  4OEM A;  4C5P A;  2R6N A;  2HHN A;  3S3R A;  4BPV A;  2PNS A;  4HWY A;  1FH0 A;  1NL6 A;  3WXG A;  2HXZ A;  2P0R A;  7PCK A;  2YJB A;  4YVA A;  3BPF A;  4P6G A;  3MOR A;  4NV7 A;  2AYO A;  1YAL A;  1SNK A;  1CPJ A;  4PAD A;  2BSZ A;  3P5W A;  3CBJ A;  3IEJ A;  4YYV A;  2DC6 A;  1U9W A;  1EF7 A;  1MIR A;  3V6C A;  1U5I A;  2DJF B;  5JA7 A;  1MDW A;  2DJG B;  3BOW A;  2FRA A;  3IHP A;  4N79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...