4N79A

Structure of cathepsin k-dermatan sulfate complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
b'APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n79A00
3OF8A 1ME4A 3GCBA 2R9OA 5EF4A 4QRVA 1A6RA 1F2CA 2PREA 1PIPA 4I07A 1KXRA 3HD3A 3QJ3A 2FTDA 3WXEA 3KSEA 3E1ZB 2XU4A 1AECA 2ARYA 2B1MA 1CQDA 2O6XA 5JA7A 1PE6A 3RVXA 3U8EA 2AS8A 2E03A 2FRAA 1NB5A 5PADA 1TLOA 1PPDA 1IWDA 1AU2A 3S3RA 2P7UA 1ATKA 3K24A 3BC3A 1YK8A 4YV8A 2DJGB 2PADA 1PPNA 3N3KA 1Y4HA 4P6GA 1F2BA 1X9YA 1CTEA 1MIRA 1FH0A 5A24A 1GCBA 3KKUA 1STFE 5CVMA 4DMYA 3CBKA 2R9CA 3N4CA 3B79A 3OVZA 1S4VA 1GECE 1MHWA 4W5CA 2IBIA 4CDFB 3M99A 9PAPA 1KFUL 2DC8A 1JQPA 3F5VA 2IPPB 4QRXA 4XR7A 1NL6A 4QBBA 3H7DA 4I05A 2AYOA 1YT7A 4Q8HA 4BPVA 1BQIA 4G54A 3RVVA 1TU6A 2R9FA 2H7JA 2HH5A 2ATOA 1BY8A 3IEJA 2DC9A 4KLBA 2G7YA 2Y5BA 4MSXA 3N3GA 1MEMA 2ACTA 1U5IA 4QRGA 2GHUA 2R9MA 2OZ2A 4BQVA 4N4ZA 3OISA 1CPJA 3O1GA 2JQGR 2DCBA 1KFXL 1SP4B 4AXLA 1U9WA 1NPZA 2C0YA 4PADA 1MDWA 3PBHA 1ICFA 1EWLA 2DZYA 2CIOA 3BOWA 3H89A 3BPMA 2DCAA 3LFYA 1QMYA 3WXGA 3KWBX 1VJVA 1O0EA 2AUZA 2Y6EA 3CBJA 4CDEB 5JH3A 4MZOA 3MORA 3OVXA 1PPPA 3K9MA 4N8WA 1M6DA 3PNRA 2HXZA 3ERVA 3BCNA 5CHVA 6PADA 2DC6A 3S3QA 1YK7A 2FQ9A 2YJ2A 2DZZA 4AXMA 2VHSA 2YJ9A 3I06A 2E01A 2GFOA 1CV8A 4CZWA 2R9NA 2NQGA 1U9VA 3IOQA 3IUTA 2F7DA 3HHAA 1HUCB 4FIPA 1PADA 4YYUA 2HD5A 4ZUXU 4FK5A 1YALA 1EF7A 2FUDA 3AI8A 2FYEA 2DC7A 2NQAA 4YYSA 2DJFB 4BSQA 3V6EA 4PI3A 2VHFA 3KFQA 3CH2X 1DF0A 1SNKA 3MHSA 4CDDB 1CB5A 4CDCB 2DCDA 2G6DA 2WBFX 4I04A 2NQDB 2F1GA 1KHPA 4YYQA 1AYUA 1CS8A 2AVWA 1NQCA 3KX1A 3PDFA 3WXFA 4X6HA 4X6JA 3H6SA 2BDLA 3PW3A 2XU1A 2FO5A 5EGWA 1F29A 1ME3A 2E00A 3IHPA 1ZIVA 1U9XA 1Q6KA 1K3BB 1MS6A 4N79A 4PP2E 4QH6A 1VSNA 4WA6A 3KW9A 2YJBA 4P6EA 2JQFR 3IV2A 2G8JA 5CVOB 2PNSA 1BGOA 3P5XA 1CSBB 5J94A 2AUXA 4Q8GA 3DF0A 4X6IA 1QOLA 3HHIA 1BP4A 4OEMA 1GLOA 3BPFA 3ZUAA 1Y08A 2YJ8A 3IMAA 1U9QX 4DMXA 2BDZA 2XU3A 2DCCA 2G8EA 2P86A 4YYVA 3H8CA 3OF9A 3C9EA 4BS6A 2FT2A 4HWYA 3HWNA 1QDQA 2AU1A 4K7CA 3I3TA 3MTNA 4RY2A 3RVWA 1AU0A 1CJLA 3QT4A 5F02A 3BWKA 1THEA 4W4UA 1AYVA 4PP1A 1AIMA 1EWOA 3P5WA 5K16A 4MZSA 5FPWA 3NHEA 2P0RA 2OULA 4BS5A 1AYWA 3MHHA 5CHTA 1TL9A 3K8UA 3V6CA 1EWMA 2NQIA 1MEGA 3USVA 1GMYA 1QXPA 2AYNA 2YJCA 1NB3A 3QSDA 3F75A 1EWPA 1KHQA 2OP3A 1NLJA 2CB5A 4FJCA 4XUIA 1PPOA 2AIMA 1POPA 3O0UA 4YYRA 8PCHA 1PCIA 1XKGA 2B1NA 1F2AA 3TNXA 3CH3X 1DEUA 3P5VA 7PCKA 3P5UA 2HHNA 1ITOA 3KWZA 3LXSA 4OELA 1PBHA 4W5BA 1ZCMA 5CVNB 2FRQA 4YYWA 3D6SA 3H8BA 1PXVA 1AU3A 1CVZA 1AU4A 2E02A 1YVBA 4YVAA 2R6NA 2PBHA 2XU5A
chains in the Genus database with same CATH superfamily
3OF8A 1ME4A 3GCBA 4OW0A 2R9OA 1PVJA 5EF4A 4QRVA 1A6RA 1F2CA 2PREA 1PIPA 4I07A 1KXRA 3OQCA 3HD3A 3QJ3A 4WURA 2FTDA 3WXEA 3KSEA 4BOPA 3E1ZB 4REZA 2XU4A 1AECA 2ARYA 2B1MA 1CQDA 2O6XA 5JA7A 1PE6A 3RVXA 3U8EA 2AS8A 2E03A 2FRAA 1NB5A 5PADA 1TLOA 2J7QC 1PPDA 1IWDA 1AU2A 3S3RA 2P7UA 1ATKA 3K24A 3BC3A 1YK8A 2J7QA 4YV8A 2DJGB 2PADA 1PPNA 3N3KA 1Y4HA 4P6GA 1F2BA 1X9YA 1CTEA 1MIRA 3W31A 1FH0A 5A24A 1GCBA 3KKUA 1STFE 5CVMA 4DMYA 3CBKA 2R9CA 3N4CA 3B79A 3MTVA 3OVZA 1S4VA 1GECE 1MHWA 4W5CA 2IBIA 4CDFB 3M99A 9PAPA 1KFUL 2DC8A 1JQPA 3F5VA 2IPPB 4QRXA 4P16A 4XR7A 1NL6A 4QBBA 3H7DA 4I05A 2AYOA 1YT7A 4Q8HA 4BPVA 1BQIA 4G54A 3RVVA 4BOZA 1TU6A 2R9FA 2H7JA 4MI7A 2HH5A 2ATOA 1BY8A 3IEJA 2DC9A 4KLBA 2G7YA 2Y5BA 4BOSA 4MSXA 3N3GA 4HXDB 1MEMA 2ACTA 1U5IA 4QRGA 2GHUA 2R9MA 2OZ2A 4BQVA 4N4ZA 3OISA 1CPJA 3O1GA 2JQGR 3O65A 2DCBA 1KFXL 1SP4B 4AXLA 1U9WA 1NPZA 2C0YA 4PADA 1MDWA 3PBHA 1ICFA 1EWLA 2DZYA 2CIOA 3BOWA 3H89A 3BPMA 2DCAA 3LFYA 1QMYA 3WXGA 3B21A 3KWBX 1VJVA 1O0EA 2AUZA 4XZXA 2Y6EA 4BOUA 3CBJA 4CDEB 5JH3A 3BY4A 4MZOA 3MORA 3OVXA 1PPPA 3K9MA 4N8WA 1M6DA 3PNRA 4ZTBA 2HXZA 1UKFA 3TRKA 3ERVA 3BCNA 5CHVA 6PADA 4RF0A 4IUMA 2DC6A 3S3QA 1YK7A 2FQ9A 4GUAA 2YJ2A 2DZZA 4AXMA 2VHSA 2YJ9A 3PRMA 4RF1A 4R3DA 3I06A 2E01A 2GFOA 1CV8A 4CZWA 2R9NA 2NQGA 1U9VA 3IOQA 3IUTA 2UZJA 2F7DA 3HHAA 1HUCB 4FIPA 4RKXA 1PADA 4YYUA 2HD5A 4ZUXU 3PRPA 4FK5A 3BB7A 1YALA 1EF7A 2FUDA 3AI8A 2FYEA 1YZBA 4MM3B 2DC7A 2NQAA 4D8EA 4YYSA 2DJFB 4BSQA 3V6EA 4PI3A 2VHFA 3KFQA 3CH2X 1DF0A 1SNKA 3MHSA 4CDDB 1CB5A 4CDCB 2DCDA 2G6DA 2WBFX 4I04A 2NQDB 2F1GA 1KHPA 2DOSA 4YYQA 1AYUA 1CS8A 2AVWA 1NQCA 3KX1A 3PDFA 3WXFA 4X6HA 4A5UA 4X6JA 3H6SA 2BDLA 2XU1A 3PW3A 2FO5A 3MJ5A 5EGWA 5E6JA 1F29A 1ME3A 3E9SA 4IP3A 2E00A 3IHPA 1ZIVA 1U9XA 1Q6KA 1K3BB 4PT5A 3BBAA 1MS6A 4N79A 1DKIA 4PP2E 4QH6A 1VSNA 4WA6A 3KW9A 5EZQA 2YJBA 4P6EA 3C0RA 2JQFR 3IV2A 3PHUA 2G8JA 3W30A 5CVOB 2PNSA 1BGOA 3P5XA 1CSBB 5J94A 2AUXA 4Q8GA 3DF0A 4X6IA 1QOLA 3HHIA 2FE8A 1BP4A 4OEMA 1GLOA 3BPFA 3ZUAA 1Y08A 2HWKA 2YJ8A 3IMAA 1U9QX 4DMXA 2BDZA 2XU3A 2DCCA 2G8EA 2P86A 4YYVA 3H8CA 4M0WA 3OF9A 3C9EA 4BS6A 2FT2A 2JRIA 4HWYA 3HWNA 1QDQA 3RNVA 2BU3A 4OVZA 2AU1A 4K7CA 2BTWA 3I3TA 5EZSA 3MTNA 4RY2A 3RVWA 1AU0A 3IFUA 3PSEA 1CJLA 3QT4A 2AGAA 3BWKA 5F02A 1THEA 4W4UA 3TMPA 1AYVA 4PP1A 1AIMA 1EWOA 3P5WA 5JZEA 5K16A 4MZSA 5FPWA 3NHEA 2P0RA 2OULA 3MP2A 3ZNHA 1AYWA 3MHHA 4BS5A 5CHTA 4D8IA 1TL9A 3K8UA 3V6CA 1EWMA 2NQIA 1MEGA 3USVA 1GMYA 1QXPA 2AYNA 2YJCA 1NB3A 3QSDA 4D8BA 4BOQA 3F75A 1EWPA 1KHQA 2OP3A 1NLJA 2CB5A 4FJCA 4XUIA 1PPOA 2JTCA 2AIMA 3PHWA 1POPA 3O0UA 4YYRA 8PCHA 1PCIA 1XKGA 2B1NA 1F2AA 3PT2A 4RNAA 3TNXA 3CH3X 1DEUA 3P5VA 7PCKA 3P5UA 2HHNA 1ITOA 3KWZA 3LXSA 4OELA 1PBHA 4W5BA 1ZCMA 5CVNB 2FRQA 4YYWA 3D6SA 3H8BA 1PXVA 1AU3A 5KO3A 1CVZA 1AU4A 2E02A 1YVBA 4OVZB 2Z84A 2R6NA 3PHXA 2PBHA 2BTWB 4YVAA 2XU5A
chains in the Genus database with same CATH topology
3OF8A 1ME4A 3GCBA 2R9OA 5EF4A 4QRVA 1A6RA 1F2CA 2PREA 1PIPA 4I07A 1KXRA 3HD3A 3QJ3A 2FTDA 3WXEA 3KSEA 3E1ZB 2XU4A 1AECA 2ARYA 2B1MA 1CQDA 2O6XA 4NV8A 5JA7A 1PE6A 3RVXA 3U8EA 2AS8A 2E03A 2FRAA 1NB5A 5PADA 1TLOA 1PPDA 1IWDA 1AU2A 3S3RA 2P7UA 1ATKA 3K24A 3BC3A 1YK8A 4YV8A 2DJGB 2PADA 1PPNA 3N3KA 1Y4HA 4B55A 4P6GA 1F2BA 1X9YA 1CTEA 1MIRA 1FH0A 5A24A 1GCBA 3KKUA 1STFE 5CVMA 4DMYA 3CBKA 3D9WA 2R9CA 3N4CA 3B79A 3OVZA 1S4VA 1GECE 1MHWA 4W5CA 2IBIA 4CDFB 3M99A 9PAPA 1KFUL 2DC8A 1JQPA 3F5VA 2IPPB 4QRXA 4XR7A 1NL6A 4GUZA 4QBBA 3H7DA 4I05A 2AYOA 1YT7A 4Q8HA 4BPVA 1BQIA 4G54A 3RVVA 1TU6A 2R9FA 1W6FA 2H7JA 2HH5A 2ATOA 1BY8A 3IEJA 2DC9A 4KLBA 2G7YA 2Y5BA 4MSXA 3N3GA 1W4TA 1MEMA 2ACTA 1U5IA 4QRGA 2GHUA 2R9MA 2OZ2A 4BQVA 4N4ZA 3OISA 1CPJA 3O1GA 2JQGR 2DCBA 1KFXL 1SP4B 4AXLA 1U9WA 1NPZA 2C0YA 4PADA 1MDWA 3PBHA 1ICFA 1EWLA 2DZYA 2CIOA 3BOWA 3H89A 3BPMA 2DCAA 3LFYA 1QMYA 3WXGA 3KWBX 1VJVA 1O0EA 2AUZA 2Y6EA 3CBJA 4CDEB 5JH3A 4MZOA 3MORA 3OVXA 1PPPA 3K9MA 4N8WA 1M6DA 3PNRA 2HXZA 3ERVA 3LTWA 3BCNA 5CHVA 6PADA 2DC6A 3S3QA 1YK7A 2FQ9A 2YJ2A 2DZZA 4AXMA 2VHSA 2YJ9A 3I06A 2E01A 2VFCA 2GFOA 1CV8A 4CZWA 2R9NA 2NQGA 1U9VA 3IOQA 3IUTA 2F7DA 3HHAA 1HUCB 4FIPA 1PADA 4YYUA 2HD5A 4ZUXU 4FK5A 2VFBA 2BSZA 1YALA 1EF7A 2FUDA 3AI8A 2FYEA 2DC7A 2NQAA 4YYSA 2DJFB 4BSQA 3V6EA 4PI3A 2VHFA 3KFQA 3CH2X 1DF0A 1SNKA 3MHSA 4CDDB 1CB5A 4CDCB 2DCDA 2G6DA 2WBFX 4I04A 2NQDB 2F1GA 1KHPA 4YYQA 1W5RA 1AYUA 1CS8A 2AVWA 1NQCA 3KX1A 3PDFA 3WXFA 4X6HA 4X6JA 3H6SA 2BDLA 3PW3A 2XU1A 2FO5A 5EGWA 1F29A 1ME3A 4BGFA 2E00A 3IHPA 1ZIVA 1U9XA 1Q6KA 1K3BB 1MS6A 4N79A 4PP2E 4QH6A 1VSNA 4WA6A 3KW9A 2YJBA 4P6EA 2JQFR 3IV2A 2G8JA 5CVOB 2PNSA 1BGOA 3P5XA 1CSBB 5J94A 2AUXA 4Q8GA 3DF0A 4X6IA 1E2TA 1QOLA 3HHIA 1BP4A 4OEMA 1GLOA 3BPFA 3ZUAA 1Y08A 1GX3A 2YJ8A 3IMAA 1U9QX 4DMXA 2BDZA 2XU3A 2DCCA 2G8EA 2P86A 4YYVA 3H8CA 3OF9A 3C9EA 4BS6A 2FT2A 4HWYA 3HWNA 1QDQA 2AU1A 4NV7A 4K7CA 3I3TA 3MTNA 4RY2A 3RVWA 1AU0A 1CJLA 3QT4A 5F02A 3BWKA 1THEA 4W4UA 1AYVA 4PP1A 1AIMA 1EWOA 3P5WA 5K16A 4MZSA 5FPWA 3NHEA 2P0RA 2OULA 4BS5A 1AYWA 3MHHA 5CHTA 1TL9A 3K8UA 3V6CA 1EWMA 2NQIA 1MEGA 3USVA 1GMYA 1QXPA 2AYNA 2YJCA 1NB3A 3QSDA 3F75A 1EWPA 1KHQA 2OP3A 1NLJA 2CB5A 4FJCA 4XUIA 1PPOA 2AIMA 1POPA 3O0UA 4YYRA 8PCHA 1PCIA 1XKGA 2B1NA 1F2AA 3TNXA 3CH3X 1DEUA 3P5VA 7PCKA 3P5UA 2HHNA 1ITOA 3KWZA 3LXSA 4OELA 1PBHA 4W5BA 1ZCMA 5CVNB 2FRQA 4C5PA 3D6SA 3H8BA 4YYWA 1PXVA 1AU3A 1CVZA 1AU4A 2E02A 1YVBA 4YVAA 2R6NA 2PBHA 2XU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF8 A;  1ME4 A;  3GCB A;  2R9O A;  5EF4 A;  4QRV A;  1A6R A;  1F2C A;  2PRE A;  1PIP A;  4I07 A;  1KXR A;  3HD3 A;  3QJ3 A;  2FTD A;  3WXE A;  3KSE A;  3E1Z B;  2XU4 A;  1AEC A;  2ARY A;  2B1M A;  1CQD A;  2O6X A;  5JA7 A;  1PE6 A;  3RVX A;  3U8E A;  2AS8 A;  2E03 A;  2FRA A;  1NB5 A;  5PAD A;  1TLO A;  1PPD A;  1IWD A;  1AU2 A;  3S3R A;  2P7U A;  1ATK A;  3K24 A;  3BC3 A;  1YK8 A;  4YV8 A;  2DJG B;  2PAD A;  1PPN A;  3N3K A;  1Y4H A;  4P6G A;  1F2B A;  1X9Y A;  1CTE A;  1MIR A;  1FH0 A;  5A24 A;  1GCB A;  3KKU A;  1STF E;  5CVM A;  4DMY A;  3CBK A;  2R9C A;  3N4C A;  3B79 A;  3OVZ A;  1S4V A;  1GEC E;  1MHW A;  4W5C A;  2IBI A;  4CDF B;  3M99 A;  9PAP A;  1KFU L;  2DC8 A;  1JQP A;  3F5V A;  2IPP B;  4QRX A;  4XR7 A;  1NL6 A;  4QBB A;  3H7D A;  4I05 A;  2AYO A;  1YT7 A;  4Q8H A;  4BPV A;  1BQI A;  4G54 A;  3RVV A;  1TU6 A;  2R9F A;  2H7J A;  2HH5 A;  2ATO A;  1BY8 A;  3IEJ A;  2DC9 A;  4KLB A;  2G7Y A;  2Y5B A;  4MSX A;  3N3G A;  1MEM A;  2ACT A;  1U5I A;  4QRG A;  2GHU A;  2R9M A;  2OZ2 A;  4BQV A;  4N4Z A;  3OIS A;  1CPJ A;  3O1G A;  2JQG R;  2DCB A;  1KFX L;  1SP4 B;  4AXL A;  1U9W A;  1NPZ A;  2C0Y A;  4PAD A;  1MDW A;  3PBH A;  1ICF A;  1EWL A;  2DZY A;  2CIO A;  3BOW A;  3H89 A;  3BPM A;  2DCA A;  3LFY A;  1QMY A;  3WXG A;  3KWB X;  1VJV A;  1O0E A;  2AUZ A;  2Y6E A;  3CBJ A;  4CDE B;  5JH3 A;  4MZO A;  3MOR A;  3OVX A;  1PPP A;  3K9M A;  4N8W A;  1M6D A;  3PNR A;  2HXZ A;  3ERV A;  3BCN A;  5CHV A;  6PAD A;  2DC6 A;  3S3Q A;  1YK7 A;  2FQ9 A;  2YJ2 A;  2DZZ A;  4AXM A;  2VHS A;  2YJ9 A;  3I06 A;  2E01 A;  2GFO A;  1CV8 A;  4CZW A;  2R9N A;  2NQG A;  1U9V A;  3IOQ A;  3IUT A;  2F7D A;  3HHA A;  1HUC B;  4FIP A;  1PAD A;  4YYU A;  2HD5 A;  4ZUX U;  4FK5 A;  1YAL A;  1EF7 A;  2FUD A;  3AI8 A;  2FYE A;  2DC7 A;  2NQA A;  4YYS A;  2DJF B;  4BSQ A;  3V6E A;  4PI3 A;  2VHF A;  3KFQ A;  3CH2 X;  1DF0 A;  1SNK A;  3MHS A;  4CDD B;  1CB5 A;  4CDC B;  2DCD A;  2G6D A;  2WBF X;  4I04 A;  2NQD B;  2F1G A;  1KHP A;  4YYQ A;  1AYU A;  1CS8 A;  2AVW A;  1NQC A;  3KX1 A;  3PDF A;  3WXF A;  4X6H A;  4X6J A;  3H6S A;  2BDL A;  3PW3 A;  2XU1 A;  2FO5 A;  5EGW A;  1F29 A;  1ME3 A;  2E00 A;  3IHP A;  1ZIV A;  1U9X A;  1Q6K A;  1K3B B;  1MS6 A;  4N79 A;  4PP2 E;  4QH6 A;  1VSN A;  4WA6 A;  3KW9 A;  2YJB A;  4P6E A;  2JQF R;  3IV2 A;  2G8J A;  5CVO B;  2PNS A;  1BGO A;  3P5X A;  1CSB B;  5J94 A;  2AUX A;  4Q8G A;  3DF0 A;  4X6I A;  1QOL A;  3HHI A;  1BP4 A;  4OEM A;  1GLO A;  3BPF A;  3ZUA A;  1Y08 A;  2YJ8 A;  3IMA A;  1U9Q X;  4DMX A;  2BDZ A;  2XU3 A;  2DCC A;  2G8E A;  2P86 A;  4YYV A;  3H8C A;  3OF9 A;  3C9E A;  4BS6 A;  2FT2 A;  4HWY A;  3HWN A;  1QDQ A;  2AU1 A;  4K7C A;  3I3T A;  3MTN A;  4RY2 A;  3RVW A;  1AU0 A;  1CJL A;  3QT4 A;  5F02 A;  3BWK A;  1THE A;  4W4U A;  1AYV A;  4PP1 A;  1AIM A;  1EWO A;  3P5W A;  5K16 A;  4MZS A;  5FPW A;  3NHE A;  2P0R A;  2OUL A;  4BS5 A;  1AYW A;  3MHH A;  5CHT A;  1TL9 A;  3K8U A;  3V6C A;  1EWM A;  2NQI A;  1MEG A;  3USV A;  1GMY A;  1QXP A;  2AYN A;  2YJC A;  1NB3 A;  3QSD A;  3F75 A;  1EWP A;  1KHQ A;  2OP3 A;  1NLJ A;  2CB5 A;  4FJC A;  4XUI A;  1PPO A;  2AIM A;  1POP A;  3O0U A;  4YYR A;  8PCH A;  1PCI A;  1XKG A;  2B1N A;  1F2A A;  3TNX A;  3CH3 X;  1DEU A;  3P5V A;  7PCK A;  3P5U A;  2HHN A;  1ITO A;  3KWZ A;  3LXS A;  4OEL A;  1PBH A;  4W5B A;  1ZCM A;  5CVN B;  2FRQ A;  4YYW A;  3D6S A;  3H8B A;  1PXV A;  1AU3 A;  1CVZ A;  1AU4 A;  2E02 A;  1YVB A;  4YVA A;  2R6N A;  2PBH A;  2XU5 A; 
#chains in the Genus database with same CATH topology
 3OF8 A;  1ME4 A;  3GCB A;  4OW0 A;  2R9O A;  1PVJ A;  5EF4 A;  4QRV A;  1A6R A;  1F2C A;  2PRE A;  1PIP A;  4I07 A;  1KXR A;  3OQC A;  3HD3 A;  3QJ3 A;  4WUR A;  2FTD A;  3WXE A;  3KSE A;  4BOP A;  3E1Z B;  4REZ A;  2XU4 A;  1AEC A;  2ARY A;  2B1M A;  1CQD A;  2O6X A;  5JA7 A;  1PE6 A;  3RVX A;  3U8E A;  2AS8 A;  2E03 A;  2FRA A;  1NB5 A;  5PAD A;  1TLO A;  2J7Q C;  1PPD A;  1IWD A;  1AU2 A;  3S3R A;  2P7U A;  1ATK A;  3K24 A;  3BC3 A;  1YK8 A;  2J7Q A;  4YV8 A;  2DJG B;  2PAD A;  1PPN A;  3N3K A;  1Y4H A;  4P6G A;  1F2B A;  1X9Y A;  1CTE A;  1MIR A;  3W31 A;  1FH0 A;  5A24 A;  1GCB A;  3KKU A;  1STF E;  5CVM A;  4DMY A;  3CBK A;  2R9C A;  3N4C A;  3B79 A;  3MTV A;  3OVZ A;  1S4V A;  1GEC E;  1MHW A;  4W5C A;  2IBI A;  4CDF B;  3M99 A;  9PAP A;  1KFU L;  2DC8 A;  1JQP A;  3F5V A;  2IPP B;  4QRX A;  4P16 A;  4XR7 A;  1NL6 A;  4QBB A;  3H7D A;  4I05 A;  2AYO A;  1YT7 A;  4Q8H A;  4BPV A;  1BQI A;  4G54 A;  3RVV A;  4BOZ A;  1TU6 A;  2R9F A;  2H7J A;  4MI7 A;  2HH5 A;  2ATO A;  1BY8 A;  3IEJ A;  2DC9 A;  4KLB A;  2G7Y A;  2Y5B A;  4BOS A;  4MSX A;  3N3G A;  4HXD B;  1MEM A;  2ACT A;  1U5I A;  4QRG A;  2GHU A;  2R9M A;  2OZ2 A;  4BQV A;  4N4Z A;  3OIS A;  1CPJ A;  3O1G A;  2JQG R;  3O65 A;  2DCB A;  1KFX L;  1SP4 B;  4AXL A;  1U9W A;  1NPZ A;  2C0Y A;  4PAD A;  1MDW A;  3PBH A;  1ICF A;  1EWL A;  2DZY A;  2CIO A;  3BOW A;  3H89 A;  3BPM A;  2DCA A;  3LFY A;  1QMY A;  3WXG A;  3B21 A;  3KWB X;  1VJV A;  1O0E A;  2AUZ A;  4XZX A;  2Y6E A;  4BOU A;  3CBJ A;  4CDE B;  5JH3 A;  3BY4 A;  4MZO A;  3MOR A;  3OVX A;  1PPP A;  3K9M A;  4N8W A;  1M6D A;  3PNR A;  4ZTB A;  2HXZ A;  1UKF A;  3TRK A;  3ERV A;  3BCN A;  5CHV A;  6PAD A;  4RF0 A;  4IUM A;  2DC6 A;  3S3Q A;  1YK7 A;  2FQ9 A;  4GUA A;  2YJ2 A;  2DZZ A;  4AXM A;  2VHS A;  2YJ9 A;  3PRM A;  4RF1 A;  4R3D A;  3I06 A;  2E01 A;  2GFO A;  1CV8 A;  4CZW A;  2R9N A;  2NQG A;  1U9V A;  3IOQ A;  3IUT A;  2UZJ A;  2F7D A;  3HHA A;  1HUC B;  4FIP A;  4RKX A;  1PAD A;  4YYU A;  2HD5 A;  4ZUX U;  3PRP A;  4FK5 A;  3BB7 A;  1YAL A;  1EF7 A;  2FUD A;  3AI8 A;  2FYE A;  1YZB A;  4MM3 B;  2DC7 A;  2NQA A;  4D8E A;  4YYS A;  2DJF B;  4BSQ A;  3V6E A;  4PI3 A;  2VHF A;  3KFQ A;  3CH2 X;  1DF0 A;  1SNK A;  3MHS A;  4CDD B;  1CB5 A;  4CDC B;  2DCD A;  2G6D A;  2WBF X;  4I04 A;  2NQD B;  2F1G A;  1KHP A;  2DOS A;  4YYQ A;  1AYU A;  1CS8 A;  2AVW A;  1NQC A;  3KX1 A;  3PDF A;  3WXF A;  4X6H A;  4A5U A;  4X6J A;  3H6S A;  2BDL A;  2XU1 A;  3PW3 A;  2FO5 A;  3MJ5 A;  5EGW A;  5E6J A;  1F29 A;  1ME3 A;  3E9S A;  4IP3 A;  2E00 A;  3IHP A;  1ZIV A;  1U9X A;  1Q6K A;  1K3B B;  4PT5 A;  3BBA A;  1MS6 A;  4N79 A;  1DKI A;  4PP2 E;  4QH6 A;  1VSN A;  4WA6 A;  3KW9 A;  5EZQ A;  2YJB A;  4P6E A;  3C0R A;  2JQF R;  3IV2 A;  3PHU A;  2G8J A;  3W30 A;  5CVO B;  2PNS A;  1BGO A;  3P5X A;  1CSB B;  5J94 A;  2AUX A;  4Q8G A;  3DF0 A;  4X6I A;  1QOL A;  3HHI A;  2FE8 A;  1BP4 A;  4OEM A;  1GLO A;  3BPF A;  3ZUA A;  1Y08 A;  2HWK A;  2YJ8 A;  3IMA A;  1U9Q X;  4DMX A;  2BDZ A;  2XU3 A;  2DCC A;  2G8E A;  2P86 A;  4YYV A;  3H8C A;  4M0W A;  3OF9 A;  3C9E A;  4BS6 A;  2FT2 A;  2JRI A;  4HWY A;  3HWN A;  1QDQ A;  3RNV A;  2BU3 A;  4OVZ A;  2AU1 A;  4K7C A;  2BTW A;  3I3T A;  5EZS A;  3MTN A;  4RY2 A;  3RVW A;  1AU0 A;  3IFU A;  3PSE A;  1CJL A;  3QT4 A;  2AGA A;  3BWK A;  5F02 A;  1THE A;  4W4U A;  3TMP A;  1AYV A;  4PP1 A;  1AIM A;  1EWO A;  3P5W A;  5JZE A;  5K16 A;  4MZS A;  5FPW A;  3NHE A;  2P0R A;  2OUL A;  3MP2 A;  3ZNH A;  1AYW A;  3MHH A;  4BS5 A;  5CHT A;  4D8I A;  1TL9 A;  3K8U A;  3V6C A;  1EWM A;  2NQI A;  1MEG A;  3USV A;  1GMY A;  1QXP A;  2AYN A;  2YJC A;  1NB3 A;  3QSD A;  4D8B A;  4BOQ A;  3F75 A;  1EWP A;  1KHQ A;  2OP3 A;  1NLJ A;  2CB5 A;  4FJC A;  4XUI A;  1PPO A;  2JTC A;  2AIM A;  3PHW A;  1POP A;  3O0U A;  4YYR A;  8PCH A;  1PCI A;  1XKG A;  2B1N A;  1F2A A;  3PT2 A;  4RNA A;  3TNX A;  3CH3 X;  1DEU A;  3P5V A;  7PCK A;  3P5U A;  2HHN A;  1ITO A;  3KWZ A;  3LXS A;  4OEL A;  1PBH A;  4W5B A;  1ZCM A;  5CVN B;  2FRQ A;  4YYW A;  3D6S A;  3H8B A;  1PXV A;  1AU3 A;  5KO3 A;  1CVZ A;  1AU4 A;  2E02 A;  1YVB A;  4OVZ B;  2Z84 A;  2R6N A;  3PHX A;  2PBH A;  2BTW B;  4YVA A;  2XU5 A; 
#chains in the Genus database with same CATH homology
 3OF8 A;  1ME4 A;  3GCB A;  2R9O A;  5EF4 A;  4QRV A;  1A6R A;  1F2C A;  2PRE A;  1PIP A;  4I07 A;  1KXR A;  3HD3 A;  3QJ3 A;  2FTD A;  3WXE A;  3KSE A;  3E1Z B;  2XU4 A;  1AEC A;  2ARY A;  2B1M A;  1CQD A;  2O6X A;  4NV8 A;  5JA7 A;  1PE6 A;  3RVX A;  3U8E A;  2AS8 A;  2E03 A;  2FRA A;  1NB5 A;  5PAD A;  1TLO A;  1PPD A;  1IWD A;  1AU2 A;  3S3R A;  2P7U A;  1ATK A;  3K24 A;  3BC3 A;  1YK8 A;  4YV8 A;  2DJG B;  2PAD A;  1PPN A;  3N3K A;  1Y4H A;  4B55 A;  4P6G A;  1F2B A;  1X9Y A;  1CTE A;  1MIR A;  1FH0 A;  5A24 A;  1GCB A;  3KKU A;  1STF E;  5CVM A;  4DMY A;  3CBK A;  3D9W A;  2R9C A;  3N4C A;  3B79 A;  3OVZ A;  1S4V A;  1GEC E;  1MHW A;  4W5C A;  2IBI A;  4CDF B;  3M99 A;  9PAP A;  1KFU L;  2DC8 A;  1JQP A;  3F5V A;  2IPP B;  4QRX A;  4XR7 A;  1NL6 A;  4GUZ A;  4QBB A;  3H7D A;  4I05 A;  2AYO A;  1YT7 A;  4Q8H A;  4BPV A;  1BQI A;  4G54 A;  3RVV A;  1TU6 A;  2R9F A;  1W6F A;  2H7J A;  2HH5 A;  2ATO A;  1BY8 A;  3IEJ A;  2DC9 A;  4KLB A;  2G7Y A;  2Y5B A;  4MSX A;  3N3G A;  1W4T A;  1MEM A;  2ACT A;  1U5I A;  4QRG A;  2GHU A;  2R9M A;  2OZ2 A;  4BQV A;  4N4Z A;  3OIS A;  1CPJ A;  3O1G A;  2JQG R;  2DCB A;  1KFX L;  1SP4 B;  4AXL A;  1U9W A;  1NPZ A;  2C0Y A;  4PAD A;  1MDW A;  3PBH A;  1ICF A;  1EWL A;  2DZY A;  2CIO A;  3BOW A;  3H89 A;  3BPM A;  2DCA A;  3LFY A;  1QMY A;  3WXG A;  3KWB X;  1VJV A;  1O0E A;  2AUZ A;  2Y6E A;  3CBJ A;  4CDE B;  5JH3 A;  4MZO A;  3MOR A;  3OVX A;  1PPP A;  3K9M A;  4N8W A;  1M6D A;  3PNR A;  2HXZ A;  3ERV A;  3LTW A;  3BCN A;  5CHV A;  6PAD A;  2DC6 A;  3S3Q A;  1YK7 A;  2FQ9 A;  2YJ2 A;  2DZZ A;  4AXM A;  2VHS A;  2YJ9 A;  3I06 A;  2E01 A;  2VFC A;  2GFO A;  1CV8 A;  4CZW A;  2R9N A;  2NQG A;  1U9V A;  3IOQ A;  3IUT A;  2F7D A;  3HHA A;  1HUC B;  4FIP A;  1PAD A;  4YYU A;  2HD5 A;  4ZUX U;  4FK5 A;  2VFB A;  2BSZ A;  1YAL A;  1EF7 A;  2FUD A;  3AI8 A;  2FYE A;  2DC7 A;  2NQA A;  4YYS A;  2DJF B;  4BSQ A;  3V6E A;  4PI3 A;  2VHF A;  3KFQ A;  3CH2 X;  1DF0 A;  1SNK A;  3MHS A;  4CDD B;  1CB5 A;  4CDC B;  2DCD A;  2G6D A;  2WBF X;  4I04 A;  2NQD B;  2F1G A;  1KHP A;  4YYQ A;  1W5R A;  1AYU A;  1CS8 A;  2AVW A;  1NQC A;  3KX1 A;  3PDF A;  3WXF A;  4X6H A;  4X6J A;  3H6S A;  2BDL A;  3PW3 A;  2XU1 A;  2FO5 A;  5EGW A;  1F29 A;  1ME3 A;  4BGF A;  2E00 A;  3IHP A;  1ZIV A;  1U9X A;  1Q6K A;  1K3B B;  1MS6 A;  4N79 A;  4PP2 E;  4QH6 A;  1VSN A;  4WA6 A;  3KW9 A;  2YJB A;  4P6E A;  2JQF R;  3IV2 A;  2G8J A;  5CVO B;  2PNS A;  1BGO A;  3P5X A;  1CSB B;  5J94 A;  2AUX A;  4Q8G A;  3DF0 A;  4X6I A;  1E2T A;  1QOL A;  3HHI A;  1BP4 A;  4OEM A;  1GLO A;  3BPF A;  3ZUA A;  1Y08 A;  1GX3 A;  2YJ8 A;  3IMA A;  1U9Q X;  4DMX A;  2BDZ A;  2XU3 A;  2DCC A;  2G8E A;  2P86 A;  4YYV A;  3H8C A;  3OF9 A;  3C9E A;  4BS6 A;  2FT2 A;  4HWY A;  3HWN A;  1QDQ A;  2AU1 A;  4NV7 A;  4K7C A;  3I3T A;  3MTN A;  4RY2 A;  3RVW A;  1AU0 A;  1CJL A;  3QT4 A;  5F02 A;  3BWK A;  1THE A;  4W4U A;  1AYV A;  4PP1 A;  1AIM A;  1EWO A;  3P5W A;  5K16 A;  4MZS A;  5FPW A;  3NHE A;  2P0R A;  2OUL A;  4BS5 A;  1AYW A;  3MHH A;  5CHT A;  1TL9 A;  3K8U A;  3V6C A;  1EWM A;  2NQI A;  1MEG A;  3USV A;  1GMY A;  1QXP A;  2AYN A;  2YJC A;  1NB3 A;  3QSD A;  3F75 A;  1EWP A;  1KHQ A;  2OP3 A;  1NLJ A;  2CB5 A;  4FJC A;  4XUI A;  1PPO A;  2AIM A;  1POP A;  3O0U A;  4YYR A;  8PCH A;  1PCI A;  1XKG A;  2B1N A;  1F2A A;  3TNX A;  3CH3 X;  1DEU A;  3P5V A;  7PCK A;  3P5U A;  2HHN A;  1ITO A;  3KWZ A;  3LXS A;  4OEL A;  1PBH A;  4W5B A;  1ZCM A;  5CVN B;  2FRQ A;  4C5P A;  3D6S A;  3H8B A;  4YYW A;  1PXV A;  1AU3 A;  1CVZ A;  1AU4 A;  2E02 A;  1YVB A;  4YVA A;  2R6N A;  2PBH A;  2XU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...