4N79A

Structure of cathepsin k-dermatan sulfate complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin K
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n79A00
4YYWA 2G7YA 1ME4A 2DZYA 1PADA 5JH3A 5J94A 2YJCA 4FIPA 3CBJA 4XR7A 1MEGA 1ZIVA 1NLJA 2R9CA 4ZUXU 3MTNA 1QDQA 1ITOA 3WXEA 1VJVA 4CDFB 2PNSA 3D6SA 3KWBX 1PPNA 3H8BA 2ACTA 1YK7A 1EF7A 4RY2A 2XU3A 4QRXA 1BY8A 3GCBA 1CB5A 2Y5BA 3LXSA 2GHUA 3ERVA 1GCBA 3S3RA 4P6EA 1QOLA 3BPFA 1M6DA 4HWYA 3NHEA 4FJCA 4N8WA 2O6XA 1TU6A 3PW3A 2GFOA 3V6EA 2FRAA 4YVAA 2PADA 2DC6A 3IV2A 2XU1A 2R6NA 5CVNB 1THEA 2H7JA 1PE6A 2CB5A 3IEJA 3KSEA 3H8CA 5K16A 3O0UA 1ATKA 1CQDA 1A6RA 2DC7A 3BC3A 1CSBB 2WBFX 4CDDB 3P5XA 1CS8A 3WXFA 1KXRA 1CJLA 3I06A 3HHAA 2OULA 3P5VA 1STFE 3OF8A 3P5UA 1MEMA 5F02A 4KLBA 4YV8A 1F2CA 3MORA 1QMYA 4YYRA 3QT4A 2R9FA 2NQIA 3DF0A 3IOQA 1U5IA 1KFUL 3BOWA 3F5VA 2B1MA 3K8UA 4XUIA 2AVWA 4W5CA 1O0EA 2DJFB 4PADA 4N4ZA 1YVBA 4BS6A 2PBHA 3OVZA 4X6JA 3BPMA 2VHFA 1DF0A 3QJ3A 2R9NA 1DEUA 2P86A 3CH2X 2DJGB 4I07A 3LFYA 3E1ZB 2FO5A 3PBHA 1S4VA 3ZUAA 2FRQA 3PDFA 2DZZA 1F29A 1EWLA 2AS8A 4YYSA 4PI3A 1NL6A 3OISA 5CHTA 4YYQA 1X9YA 2NQDB 4YYVA 1BQIA 4QRGA 2AIMA 9PAPA 1CTEA 4Q8GA 1EWMA 2HXZA 1POPA 4W4UA 1AIMA 8PCHA 4YYUA 1JQPA 3V6CA 2HD5A 2YJBA 1F2BA 3MHSA 4BQVA 4BPVA 2ATOA 3BCNA 1MS6A 5FPWA 1YALA 3N3GA 4X6IA 1PPDA 4QBBA 1MDWA 2XU5A 1YT7A 1CVZA 1PPOA 1EWPA 1ME3A 2XU4A 1MHWA 3CH3X 5JA7A 2E02A 3RVVA 2F7DA 2JQGR 1U9QX 3IMAA 1CV8A 1U9VA 4AXLA 1Y4HA 4FK5A 3AI8A 1NB5A 1XKGA 3HHIA 1QXPA 4BSQA 1CPJA 1U9WA 4QRVA 4DMXA 4I05A 1AU0A 3PNRA 1FH0A 1EWOA 2IPPB 2DCDA 4Q8HA 2BDZA 3B79A 3HD3A 1AU2A 3S3QA 2YJ8A 2B1NA 1ICFA 3H6SA 3RVXA 3H7DA 3KWZA 2E01A 4N79A 1AECA 4PP2E 3N3KA 2G8JA 4QH6A 1PXVA 2HHNA 2YJ2A 1GMYA 6PADA 3RVWA 2NQGA 1GECE 2FQ9A 5EGWA 3F75A 2HH5A 2DCAA 2E03A 3OF9A 3KX1A 2AU1A 2P0RA 1TL9A 3BWKA 1VSNA 1Y08A 2BDLA 2VHSA 3O1GA 5PADA 1SNKA 5A24A 4I04A 1Q6KA 2FYEA 1NPZA 2AUZA 1PBHA 2FUDA 3U8EA 2C0YA 3KFQA 4OEMA 2PREA 5CHVA 4G54A 4MSXA 1AU4A 2NQAA 3TNXA 4MZSA 2CIOA 1ZCMA 3MHHA 2F1GA 2IBIA 2DCBA 2R9MA 2AUXA 1AU3A 3M99A 1BP4A 1YK8A 1KFXL 3H89A 1PCIA 5CVMA 3HWNA 1PPPA 1K3BB 2G8EA 4AXMA 2E00A 2FT2A 1NQCA 2Y6EA 2AYNA 4DMYA 2P7UA 1KHPA 3IUTA 4PP1A 2YJ9A 1MIRA 4CDEB 2OP3A 3K9MA 4X6HA 3K24A 3KKUA 4WA6A 3CBKA 5CVOB 7PCKA 1AYUA 1AYVA 1NB3A 4P6GA 1TLOA 2DCCA 3IHPA 3N4CA 2ARYA 3C9EA 4BS5A 4CZWA 4K7CA 3WXGA 3P5WA 2FTDA 4W5BA 1IWDA 1F2AA 2AYOA 1BGOA 1KHQA 3OVXA 2OZ2A 1GLOA 3QSDA 5EF4A 2DC9A 4OELA 1SP4B 1HUCB 3I3TA 1AYWA 2G6DA 3USVA 2DC8A 2R9OA 3KW9A 1PIPA 2JQFR 4MZOA 1U9XA 4CDCB
chains in the Genus database with same CATH superfamily
4YYWA 2G7YA 1ME4A 2DZYA 1PADA 5JH3A 5J94A 2JRIA 2YJCA 3W31A 4FIPA 3CBJA 4XR7A 1MEGA 1ZIVA 1NLJA 2R9CA 4ZUXU 3MTNA 1QDQA 4M0WA 1ITOA 3TMPA 3WXEA 1VJVA 4CDFB 2PNSA 3D6SA 3KWBX 1PPNA 3H8BA 2ACTA 1YK7A 1EF7A 4RY2A 2AGAA 2XU3A 4QRXA 1BY8A 3GCBA 1CB5A 2Y5BA 3LXSA 2GHUA 3PRPA 3ERVA 1GCBA 3S3RA 4P6EA 4PT5A 1QOLA 3BPFA 1M6DA 4HWYA 3NHEA 4FJCA 4N8WA 2O6XA 1TU6A 3PW3A 2GFOA 3V6EA 2FRAA 4YVAA 2PADA 2DC6A 3IV2A 2XU1A 2R6NA 5CVNB 1THEA 2H7JA 4ZTBA 1PE6A 2CB5A 3IEJA 3KSEA 3H8CA 5K16A 3O0UA 1ATKA 1CQDA 1A6RA 2DC7A 3BC3A 2HWKA 1CSBB 2WBFX 4CDDB 4BOPA 3P5XA 5EZQA 1CS8A 3WXFA 1KXRA 1CJLA 3I06A 3HHAA 2OULA 3P5VA 1STFE 3OF8A 3P5UA 4D8EA 3RNVA 1MEMA 5F02A 4KLBA 4YV8A 1F2CA 3MORA 1QMYA 4YYRA 2BTWB 3QT4A 2R9FA 2NQIA 3DF0A 3IOQA 1U5IA 1KFUL 5KO3A 4BOQA 3O65A 3BOWA 2FE8A 3F5VA 2B1MA 4IUMA 4MI7A 1DKIA 3K8UA 4XUIA 2AVWA 4W5CA 1O0EA 2DJFB 4PADA 2JTCA 4N4ZA 1YVBA 4BS6A 2PBHA 3OVZA 4X6JA 3BPMA 2VHFA 1DF0A 3QJ3A 2R9NA 3PSEA 1DEUA 2P86A 3CH2X 2DJGB 4I07A 3LFYA 3PHXA 3E1ZB 2FO5A 3PBHA 1S4VA 4OVZB 3ZUAA 2FRQA 3PDFA 2DZZA 1F29A 4RF1A 1EWLA 2AS8A 4YYSA 4PI3A 1NL6A 3PHUA 3OISA 5CHTA 4YYQA 1X9YA 2NQDB 4YYVA 2J7QA 1BQIA 4QRGA 2AIMA 9PAPA 1CTEA 4OVZA 4Q8GA 1EWMA 2HXZA 4REZA 1POPA 4W4UA 1AIMA 8PCHA 4YYUA 1JQPA 3V6CA 4XZXA 3OQCA 2HD5A 2YJBA 1F2BA 3MHSA 4BQVA 4BPVA 2ATOA 3BCNA 1MS6A 5FPWA 1YALA 3N3GA 4X6IA 1PPDA 4QBBA 1MDWA 2XU5A 5EZSA 3C0RA 1YT7A 3B21A 1CVZA 1PPOA 1EWPA 1ME3A 2XU4A 1MHWA 3CH3X 5JA7A 2E02A 3RVVA 2F7DA 2JQGR 1U9QX 3IMAA 1CV8A 1U9VA 4AXLA 1Y4HA 4FK5A 3AI8A 1NB5A 1XKGA 3HHIA 1QXPA 4BSQA 2J7QC 1CPJA 1U9WA 3BB7A 4QRVA 4BOUA 4DMXA 4I05A 1AU0A 3PNRA 1FH0A 1EWOA 2IPPB 2DCDA 4Q8HA 2BDZA 3B79A 3HD3A 3IFUA 1AU2A 3S3QA 2YJ8A 4RNAA 3W30A 2B1NA 4WURA 1ICFA 3H6SA 3RVXA 3MTVA 3H7DA 3KWZA 4P16A 2E01A 4N79A 1AECA 4PP2E 3PRMA 3N3KA 2G8JA 1PXVA 2HHNA 4MM3B 2YJ2A 4QH6A 1GMYA 6PADA 3RVWA 2NQGA 1GECE 2FQ9A 5EGWA 3F75A 2HH5A 2DCAA 4HXDB 3MJ5A 2E03A 3OF9A 3KX1A 2AU1A 2P0RA 2BU3A 1TL9A 1YZBA 3BWKA 1VSNA 2BTWA 4OW0A 1Y08A 2BDLA 4RKXA 1PVJA 2VHSA 4BOZA 3O1GA 5PADA 1SNKA 5A24A 4I04A 1Q6KA 2FYEA 1NPZA 2AUZA 1PBHA 2FUDA 3U8EA 2C0YA 3KFQA 4GUAA 4OEMA 2PREA 2Z84A 5CHVA 4RF0A 4G54A 4MSXA 1AU4A 2NQAA 3TNXA 4MZSA 2CIOA 1ZCMA 3MHHA 2F1GA 2IBIA 2DCBA 3ZNHA 2R9MA 2AUXA 3PT2A 1AU3A 3M99A 1BP4A 1YK8A 1KFXL 3H89A 1PCIA 5CVMA 3HWNA 1PPPA 3BY4A 3E9SA 1K3BB 2G8EA 4R3DA 4AXMA 2UZJA 2E00A 2FT2A 1NQCA 2Y6EA 2AYNA 3MP2A 4DMYA 2P7UA 1KHPA 3IUTA 4PP1A 2YJ9A 2DOSA 1MIRA 4IP3A 4CDEB 3TRKA 2OP3A 3K9MA 4X6HA 3K24A 3KKUA 4WA6A 3CBKA 5CVOB 7PCKA 1AYUA 1AYVA 4D8BA 1NB3A 4P6GA 1TLOA 2DCCA 4A5UA 3IHPA 3N4CA 2ARYA 4D8IA 3C9EA 4BS5A 4CZWA 4K7CA 3WXGA 3P5WA 2FTDA 4W5BA 1IWDA 1F2AA 2AYOA 1BGOA 1KHQA 3OVXA 2OZ2A 1GLOA 3BBAA 3QSDA 5EF4A 2DC9A 4OELA 1SP4B 1UKFA 5JZEA 5E6JA 4BOSA 1HUCB 3I3TA 1AYWA 2G6DA 3USVA 3PHWA 2DC8A 2R9OA 3KW9A 1PIPA 2JQFR 4MZOA 1U9XA 4CDCB
chains in the Genus database with same CATH topology
4YYWA 2G7YA 1ME4A 2DZYA 1PADA 5JH3A 5J94A 2YJCA 4FIPA 3CBJA 2VFBA 4XR7A 1MEGA 1ZIVA 1NLJA 2R9CA 4ZUXU 3MTNA 1QDQA 1ITOA 2BSZA 3WXEA 1VJVA 4CDFB 2PNSA 3D6SA 3KWBX 1PPNA 3H8BA 2ACTA 1YK7A 1EF7A 4RY2A 2XU3A 4QRXA 1BY8A 3GCBA 1CB5A 2Y5BA 3LXSA 2GHUA 3ERVA 1GCBA 3S3RA 4P6EA 1QOLA 3BPFA 1M6DA 4HWYA 3NHEA 4FJCA 4N8WA 2O6XA 1TU6A 3PW3A 2GFOA 3V6EA 2FRAA 4YVAA 2PADA 2DC6A 3IV2A 2XU1A 2R6NA 5CVNB 1THEA 2H7JA 1PE6A 2CB5A 3IEJA 3KSEA 3H8CA 5K16A 3O0UA 3D9WA 1ATKA 1CQDA 1A6RA 2DC7A 3BC3A 1CSBB 2WBFX 4NV7A 4CDDB 3P5XA 1CS8A 3WXFA 1KXRA 1CJLA 3I06A 3HHAA 2OULA 3P5VA 1STFE 3OF8A 3P5UA 1MEMA 5F02A 4KLBA 4YV8A 1F2CA 3MORA 1QMYA 4YYRA 3QT4A 2R9FA 2NQIA 3DF0A 3IOQA 1U5IA 1KFUL 1E2TA 3BOWA 3F5VA 2B1MA 3K8UA 4XUIA 2AVWA 4W5CA 1O0EA 2DJFB 4PADA 4N4ZA 1YVBA 4BS6A 2PBHA 3OVZA 4X6JA 3BPMA 2VHFA 1DF0A 3QJ3A 2R9NA 1DEUA 2P86A 3CH2X 2DJGB 4I07A 3LFYA 3E1ZB 2FO5A 3PBHA 1S4VA 3ZUAA 2FRQA 3PDFA 2DZZA 1F29A 1EWLA 2AS8A 4YYSA 4PI3A 1NL6A 4GUZA 3OISA 5CHTA 4YYQA 1X9YA 2NQDB 4YYVA 1BQIA 4QRGA 2AIMA 9PAPA 1CTEA 1W4TA 4Q8GA 1EWMA 2HXZA 3LTWA 1POPA 4W4UA 1AIMA 8PCHA 4YYUA 1JQPA 3V6CA 2HD5A 2YJBA 1F2BA 3MHSA 4BQVA 4BPVA 2ATOA 3BCNA 1MS6A 5FPWA 1YALA 3N3GA 4X6IA 1PPDA 4QBBA 1MDWA 2XU5A 1YT7A 4B55A 4C5PA 1CVZA 1PPOA 1EWPA 1ME3A 2XU4A 1MHWA 3CH3X 5JA7A 2E02A 3RVVA 2F7DA 2JQGR 1U9QX 3IMAA 1CV8A 1U9VA 4AXLA 1Y4HA 4FK5A 3AI8A 1GX3A 1NB5A 1XKGA 3HHIA 1QXPA 4BSQA 1CPJA 1U9WA 4QRVA 4DMXA 4I05A 1AU0A 3PNRA 1FH0A 1EWOA 2IPPB 2DCDA 4Q8HA 2BDZA 3B79A 3HD3A 1AU2A 3S3QA 2YJ8A 2B1NA 1ICFA 3H6SA 3RVXA 3H7DA 3KWZA 2E01A 4BGFA 4N79A 1AECA 2VFCA 4PP2E 3N3KA 2G8JA 1PXVA 2HHNA 4QH6A 2YJ2A 1GMYA 6PADA 3RVWA 2NQGA 1GECE 2FQ9A 5EGWA 3F75A 2HH5A 2DCAA 2E03A 3OF9A 3KX1A 2AU1A 2P0RA 1TL9A 3BWKA 1VSNA 1Y08A 2BDLA 2VHSA 3O1GA 5PADA 1W6FA 1SNKA 5A24A 4I04A 1Q6KA 2FYEA 1NPZA 2AUZA 1PBHA 2FUDA 3U8EA 2C0YA 3KFQA 4OEMA 2PREA 5CHVA 4G54A 4MSXA 1AU4A 2NQAA 3TNXA 4MZSA 2CIOA 1ZCMA 3MHHA 2F1GA 2IBIA 2DCBA 2R9MA 2AUXA 1AU3A 3M99A 1BP4A 1YK8A 1KFXL 3H89A 1PCIA 5CVMA 4NV8A 3HWNA 1PPPA 1K3BB 2G8EA 4AXMA 2E00A 2FT2A 1NQCA 2Y6EA 2AYNA 4DMYA 2P7UA 1KHPA 3IUTA 4PP1A 2YJ9A 1MIRA 4CDEB 2OP3A 3K9MA 4X6HA 3K24A 3KKUA 4WA6A 3CBKA 5CVOB 7PCKA 1AYUA 1AYVA 1NB3A 4P6GA 1TLOA 2DCCA 3IHPA 3N4CA 2ARYA 3C9EA 4BS5A 4CZWA 4K7CA 3WXGA 3P5WA 2FTDA 4W5BA 1IWDA 1F2AA 2AYOA 1BGOA 1KHQA 3OVXA 2OZ2A 1GLOA 3QSDA 5EF4A 2DC9A 4OELA 1SP4B 1HUCB 3I3TA 1AYWA 2G6DA 3USVA 2DC8A 2R9OA 3KW9A 1W5RA 1PIPA 2JQFR 4MZOA 1U9XA 4CDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYW A;  2G7Y A;  1ME4 A;  2DZY A;  1PAD A;  5JH3 A;  5J94 A;  2YJC A;  4FIP A;  3CBJ A;  4XR7 A;  1MEG A;  1ZIV A;  1NLJ A;  2R9C A;  4ZUX U;  3MTN A;  1QDQ A;  1ITO A;  3WXE A;  1VJV A;  4CDF B;  2PNS A;  3D6S A;  3KWB X;  1PPN A;  3H8B A;  2ACT A;  1YK7 A;  1EF7 A;  4RY2 A;  2XU3 A;  4QRX A;  1BY8 A;  3GCB A;  1CB5 A;  2Y5B A;  3LXS A;  2GHU A;  3ERV A;  1GCB A;  3S3R A;  4P6E A;  1QOL A;  3BPF A;  1M6D A;  4HWY A;  3NHE A;  4FJC A;  4N8W A;  2O6X A;  1TU6 A;  3PW3 A;  2GFO A;  3V6E A;  2FRA A;  4YVA A;  2PAD A;  2DC6 A;  3IV2 A;  2XU1 A;  2R6N A;  5CVN B;  1THE A;  2H7J A;  1PE6 A;  2CB5 A;  3IEJ A;  3KSE A;  3H8C A;  5K16 A;  3O0U A;  1ATK A;  1CQD A;  1A6R A;  2DC7 A;  3BC3 A;  1CSB B;  2WBF X;  4CDD B;  3P5X A;  1CS8 A;  3WXF A;  1KXR A;  1CJL A;  3I06 A;  3HHA A;  2OUL A;  3P5V A;  1STF E;  3OF8 A;  3P5U A;  1MEM A;  5F02 A;  4KLB A;  4YV8 A;  1F2C A;  3MOR A;  1QMY A;  4YYR A;  3QT4 A;  2R9F A;  2NQI A;  3DF0 A;  3IOQ A;  1U5I A;  1KFU L;  3BOW A;  3F5V A;  2B1M A;  3K8U A;  4XUI A;  2AVW A;  4W5C A;  1O0E A;  2DJF B;  4PAD A;  4N4Z A;  1YVB A;  4BS6 A;  2PBH A;  3OVZ A;  4X6J A;  3BPM A;  2VHF A;  1DF0 A;  3QJ3 A;  2R9N A;  1DEU A;  2P86 A;  3CH2 X;  2DJG B;  4I07 A;  3LFY A;  3E1Z B;  2FO5 A;  3PBH A;  1S4V A;  3ZUA A;  2FRQ A;  3PDF A;  2DZZ A;  1F29 A;  1EWL A;  2AS8 A;  4YYS A;  4PI3 A;  1NL6 A;  3OIS A;  5CHT A;  4YYQ A;  1X9Y A;  2NQD B;  4YYV A;  1BQI A;  4QRG A;  2AIM A;  9PAP A;  1CTE A;  4Q8G A;  1EWM A;  2HXZ A;  1POP A;  4W4U A;  1AIM A;  8PCH A;  4YYU A;  1JQP A;  3V6C A;  2HD5 A;  2YJB A;  1F2B A;  3MHS A;  4BQV A;  4BPV A;  2ATO A;  3BCN A;  1MS6 A;  5FPW A;  1YAL A;  3N3G A;  4X6I A;  1PPD A;  4QBB A;  1MDW A;  2XU5 A;  1YT7 A;  1CVZ A;  1PPO A;  1EWP A;  1ME3 A;  2XU4 A;  1MHW A;  3CH3 X;  5JA7 A;  2E02 A;  3RVV A;  2F7D A;  2JQG R;  1U9Q X;  3IMA A;  1CV8 A;  1U9V A;  4AXL A;  1Y4H A;  4FK5 A;  3AI8 A;  1NB5 A;  1XKG A;  3HHI A;  1QXP A;  4BSQ A;  1CPJ A;  1U9W A;  4QRV A;  4DMX A;  4I05 A;  1AU0 A;  3PNR A;  1FH0 A;  1EWO A;  2IPP B;  2DCD A;  4Q8H A;  2BDZ A;  3B79 A;  3HD3 A;  1AU2 A;  3S3Q A;  2YJ8 A;  2B1N A;  1ICF A;  3H6S A;  3RVX A;  3H7D A;  3KWZ A;  2E01 A;  4N79 A;  1AEC A;  4PP2 E;  3N3K A;  2G8J A;  4QH6 A;  1PXV A;  2HHN A;  2YJ2 A;  1GMY A;  6PAD A;  3RVW A;  2NQG A;  1GEC E;  2FQ9 A;  5EGW A;  3F75 A;  2HH5 A;  2DCA A;  2E03 A;  3OF9 A;  3KX1 A;  2AU1 A;  2P0R A;  1TL9 A;  3BWK A;  1VSN A;  1Y08 A;  2BDL A;  2VHS A;  3O1G A;  5PAD A;  1SNK A;  5A24 A;  4I04 A;  1Q6K A;  2FYE A;  1NPZ A;  2AUZ A;  1PBH A;  2FUD A;  3U8E A;  2C0Y A;  3KFQ A;  4OEM A;  2PRE A;  5CHV A;  4G54 A;  4MSX A;  1AU4 A;  2NQA A;  3TNX A;  4MZS A;  2CIO A;  1ZCM A;  3MHH A;  2F1G A;  2IBI A;  2DCB A;  2R9M A;  2AUX A;  1AU3 A;  3M99 A;  1BP4 A;  1YK8 A;  1KFX L;  3H89 A;  1PCI A;  5CVM A;  3HWN A;  1PPP A;  1K3B B;  2G8E A;  4AXM A;  2E00 A;  2FT2 A;  1NQC A;  2Y6E A;  2AYN A;  4DMY A;  2P7U A;  1KHP A;  3IUT A;  4PP1 A;  2YJ9 A;  1MIR A;  4CDE B;  2OP3 A;  3K9M A;  4X6H A;  3K24 A;  3KKU A;  4WA6 A;  3CBK A;  5CVO B;  7PCK A;  1AYU A;  1AYV A;  1NB3 A;  4P6G A;  1TLO A;  2DCC A;  3IHP A;  3N4C A;  2ARY A;  3C9E A;  4BS5 A;  4CZW A;  4K7C A;  3WXG A;  3P5W A;  2FTD A;  4W5B A;  1IWD A;  1F2A A;  2AYO A;  1BGO A;  1KHQ A;  3OVX A;  2OZ2 A;  1GLO A;  3QSD A;  5EF4 A;  2DC9 A;  4OEL A;  1SP4 B;  1HUC B;  3I3T A;  1AYW A;  2G6D A;  3USV A;  2DC8 A;  2R9O A;  3KW9 A;  1PIP A;  2JQF R;  4MZO A;  1U9X A;  4CDC B; 
#chains in the Genus database with same CATH topology
 4YYW A;  2G7Y A;  1ME4 A;  2DZY A;  1PAD A;  5JH3 A;  5J94 A;  2JRI A;  2YJC A;  3W31 A;  4FIP A;  3CBJ A;  4XR7 A;  1MEG A;  1ZIV A;  1NLJ A;  2R9C A;  4ZUX U;  3MTN A;  1QDQ A;  4M0W A;  1ITO A;  3TMP A;  3WXE A;  1VJV A;  4CDF B;  2PNS A;  3D6S A;  3KWB X;  1PPN A;  3H8B A;  2ACT A;  1YK7 A;  1EF7 A;  4RY2 A;  2AGA A;  2XU3 A;  4QRX A;  1BY8 A;  3GCB A;  1CB5 A;  2Y5B A;  3LXS A;  2GHU A;  3PRP A;  3ERV A;  1GCB A;  3S3R A;  4P6E A;  4PT5 A;  1QOL A;  3BPF A;  1M6D A;  4HWY A;  3NHE A;  4FJC A;  4N8W A;  2O6X A;  1TU6 A;  3PW3 A;  2GFO A;  3V6E A;  2FRA A;  4YVA A;  2PAD A;  2DC6 A;  3IV2 A;  2XU1 A;  2R6N A;  5CVN B;  1THE A;  2H7J A;  4ZTB A;  1PE6 A;  2CB5 A;  3IEJ A;  3KSE A;  3H8C A;  5K16 A;  3O0U A;  1ATK A;  1CQD A;  1A6R A;  2DC7 A;  3BC3 A;  2HWK A;  1CSB B;  2WBF X;  4CDD B;  4BOP A;  3P5X A;  5EZQ A;  1CS8 A;  3WXF A;  1KXR A;  1CJL A;  3I06 A;  3HHA A;  2OUL A;  3P5V A;  1STF E;  3OF8 A;  3P5U A;  4D8E A;  3RNV A;  1MEM A;  5F02 A;  4KLB A;  4YV8 A;  1F2C A;  3MOR A;  1QMY A;  4YYR A;  2BTW B;  3QT4 A;  2R9F A;  2NQI A;  3DF0 A;  3IOQ A;  1U5I A;  1KFU L;  5KO3 A;  4BOQ A;  3O65 A;  3BOW A;  2FE8 A;  3F5V A;  2B1M A;  4IUM A;  4MI7 A;  1DKI A;  3K8U A;  4XUI A;  2AVW A;  4W5C A;  1O0E A;  2DJF B;  4PAD A;  2JTC A;  4N4Z A;  1YVB A;  4BS6 A;  2PBH A;  3OVZ A;  4X6J A;  3BPM A;  2VHF A;  1DF0 A;  3QJ3 A;  2R9N A;  3PSE A;  1DEU A;  2P86 A;  3CH2 X;  2DJG B;  4I07 A;  3LFY A;  3PHX A;  3E1Z B;  2FO5 A;  3PBH A;  1S4V A;  4OVZ B;  3ZUA A;  2FRQ A;  3PDF A;  2DZZ A;  1F29 A;  4RF1 A;  1EWL A;  2AS8 A;  4YYS A;  4PI3 A;  1NL6 A;  3PHU A;  3OIS A;  5CHT A;  4YYQ A;  1X9Y A;  2NQD B;  4YYV A;  2J7Q A;  1BQI A;  4QRG A;  2AIM A;  9PAP A;  1CTE A;  4OVZ A;  4Q8G A;  1EWM A;  2HXZ A;  4REZ A;  1POP A;  4W4U A;  1AIM A;  8PCH A;  4YYU A;  1JQP A;  3V6C A;  4XZX A;  3OQC A;  2HD5 A;  2YJB A;  1F2B A;  3MHS A;  4BQV A;  4BPV A;  2ATO A;  3BCN A;  1MS6 A;  5FPW A;  1YAL A;  3N3G A;  4X6I A;  1PPD A;  4QBB A;  1MDW A;  2XU5 A;  5EZS A;  3C0R A;  1YT7 A;  3B21 A;  1CVZ A;  1PPO A;  1EWP A;  1ME3 A;  2XU4 A;  1MHW A;  3CH3 X;  5JA7 A;  2E02 A;  3RVV A;  2F7D A;  2JQG R;  1U9Q X;  3IMA A;  1CV8 A;  1U9V A;  4AXL A;  1Y4H A;  4FK5 A;  3AI8 A;  1NB5 A;  1XKG A;  3HHI A;  1QXP A;  4BSQ A;  2J7Q C;  1CPJ A;  1U9W A;  3BB7 A;  4QRV A;  4BOU A;  4DMX A;  4I05 A;  1AU0 A;  3PNR A;  1FH0 A;  1EWO A;  2IPP B;  2DCD A;  4Q8H A;  2BDZ A;  3B79 A;  3HD3 A;  3IFU A;  1AU2 A;  3S3Q A;  2YJ8 A;  4RNA A;  3W30 A;  2B1N A;  4WUR A;  1ICF A;  3H6S A;  3RVX A;  3MTV A;  3H7D A;  3KWZ A;  4P16 A;  2E01 A;  4N79 A;  1AEC A;  4PP2 E;  3PRM A;  3N3K A;  2G8J A;  1PXV A;  2HHN A;  4MM3 B;  2YJ2 A;  4QH6 A;  1GMY A;  6PAD A;  3RVW A;  2NQG A;  1GEC E;  2FQ9 A;  5EGW A;  3F75 A;  2HH5 A;  2DCA A;  4HXD B;  3MJ5 A;  2E03 A;  3OF9 A;  3KX1 A;  2AU1 A;  2P0R A;  2BU3 A;  1TL9 A;  1YZB A;  3BWK A;  1VSN A;  2BTW A;  4OW0 A;  1Y08 A;  2BDL A;  4RKX A;  1PVJ A;  2VHS A;  4BOZ A;  3O1G A;  5PAD A;  1SNK A;  5A24 A;  4I04 A;  1Q6K A;  2FYE A;  1NPZ A;  2AUZ A;  1PBH A;  2FUD A;  3U8E A;  2C0Y A;  3KFQ A;  4GUA A;  4OEM A;  2PRE A;  2Z84 A;  5CHV A;  4RF0 A;  4G54 A;  4MSX A;  1AU4 A;  2NQA A;  3TNX A;  4MZS A;  2CIO A;  1ZCM A;  3MHH A;  2F1G A;  2IBI A;  2DCB A;  3ZNH A;  2R9M A;  2AUX A;  3PT2 A;  1AU3 A;  3M99 A;  1BP4 A;  1YK8 A;  1KFX L;  3H89 A;  1PCI A;  5CVM A;  3HWN A;  1PPP A;  3BY4 A;  3E9S A;  1K3B B;  2G8E A;  4R3D A;  4AXM A;  2UZJ A;  2E00 A;  2FT2 A;  1NQC A;  2Y6E A;  2AYN A;  3MP2 A;  4DMY A;  2P7U A;  1KHP A;  3IUT A;  4PP1 A;  2YJ9 A;  2DOS A;  1MIR A;  4IP3 A;  4CDE B;  3TRK A;  2OP3 A;  3K9M A;  4X6H A;  3K24 A;  3KKU A;  4WA6 A;  3CBK A;  5CVO B;  7PCK A;  1AYU A;  1AYV A;  4D8B A;  1NB3 A;  4P6G A;  1TLO A;  2DCC A;  4A5U A;  3IHP A;  3N4C A;  2ARY A;  4D8I A;  3C9E A;  4BS5 A;  4CZW A;  4K7C A;  3WXG A;  3P5W A;  2FTD A;  4W5B A;  1IWD A;  1F2A A;  2AYO A;  1BGO A;  1KHQ A;  3OVX A;  2OZ2 A;  1GLO A;  3BBA A;  3QSD A;  5EF4 A;  2DC9 A;  4OEL A;  1SP4 B;  1UKF A;  5JZE A;  5E6J A;  4BOS A;  1HUC B;  3I3T A;  1AYW A;  2G6D A;  3USV A;  3PHW A;  2DC8 A;  2R9O A;  3KW9 A;  1PIP A;  2JQF R;  4MZO A;  1U9X A;  4CDC B; 
#chains in the Genus database with same CATH homology
 4YYW A;  2G7Y A;  1ME4 A;  2DZY A;  1PAD A;  5JH3 A;  5J94 A;  2YJC A;  4FIP A;  3CBJ A;  2VFB A;  4XR7 A;  1MEG A;  1ZIV A;  1NLJ A;  2R9C A;  4ZUX U;  3MTN A;  1QDQ A;  1ITO A;  2BSZ A;  3WXE A;  1VJV A;  4CDF B;  2PNS A;  3D6S A;  3KWB X;  1PPN A;  3H8B A;  2ACT A;  1YK7 A;  1EF7 A;  4RY2 A;  2XU3 A;  4QRX A;  1BY8 A;  3GCB A;  1CB5 A;  2Y5B A;  3LXS A;  2GHU A;  3ERV A;  1GCB A;  3S3R A;  4P6E A;  1QOL A;  3BPF A;  1M6D A;  4HWY A;  3NHE A;  4FJC A;  4N8W A;  2O6X A;  1TU6 A;  3PW3 A;  2GFO A;  3V6E A;  2FRA A;  4YVA A;  2PAD A;  2DC6 A;  3IV2 A;  2XU1 A;  2R6N A;  5CVN B;  1THE A;  2H7J A;  1PE6 A;  2CB5 A;  3IEJ A;  3KSE A;  3H8C A;  5K16 A;  3O0U A;  3D9W A;  1ATK A;  1CQD A;  1A6R A;  2DC7 A;  3BC3 A;  1CSB B;  2WBF X;  4NV7 A;  4CDD B;  3P5X A;  1CS8 A;  3WXF A;  1KXR A;  1CJL A;  3I06 A;  3HHA A;  2OUL A;  3P5V A;  1STF E;  3OF8 A;  3P5U A;  1MEM A;  5F02 A;  4KLB A;  4YV8 A;  1F2C A;  3MOR A;  1QMY A;  4YYR A;  3QT4 A;  2R9F A;  2NQI A;  3DF0 A;  3IOQ A;  1U5I A;  1KFU L;  1E2T A;  3BOW A;  3F5V A;  2B1M A;  3K8U A;  4XUI A;  2AVW A;  4W5C A;  1O0E A;  2DJF B;  4PAD A;  4N4Z A;  1YVB A;  4BS6 A;  2PBH A;  3OVZ A;  4X6J A;  3BPM A;  2VHF A;  1DF0 A;  3QJ3 A;  2R9N A;  1DEU A;  2P86 A;  3CH2 X;  2DJG B;  4I07 A;  3LFY A;  3E1Z B;  2FO5 A;  3PBH A;  1S4V A;  3ZUA A;  2FRQ A;  3PDF A;  2DZZ A;  1F29 A;  1EWL A;  2AS8 A;  4YYS A;  4PI3 A;  1NL6 A;  4GUZ A;  3OIS A;  5CHT A;  4YYQ A;  1X9Y A;  2NQD B;  4YYV A;  1BQI A;  4QRG A;  2AIM A;  9PAP A;  1CTE A;  1W4T A;  4Q8G A;  1EWM A;  2HXZ A;  3LTW A;  1POP A;  4W4U A;  1AIM A;  8PCH A;  4YYU A;  1JQP A;  3V6C A;  2HD5 A;  2YJB A;  1F2B A;  3MHS A;  4BQV A;  4BPV A;  2ATO A;  3BCN A;  1MS6 A;  5FPW A;  1YAL A;  3N3G A;  4X6I A;  1PPD A;  4QBB A;  1MDW A;  2XU5 A;  1YT7 A;  4B55 A;  4C5P A;  1CVZ A;  1PPO A;  1EWP A;  1ME3 A;  2XU4 A;  1MHW A;  3CH3 X;  5JA7 A;  2E02 A;  3RVV A;  2F7D A;  2JQG R;  1U9Q X;  3IMA A;  1CV8 A;  1U9V A;  4AXL A;  1Y4H A;  4FK5 A;  3AI8 A;  1GX3 A;  1NB5 A;  1XKG A;  3HHI A;  1QXP A;  4BSQ A;  1CPJ A;  1U9W A;  4QRV A;  4DMX A;  4I05 A;  1AU0 A;  3PNR A;  1FH0 A;  1EWO A;  2IPP B;  2DCD A;  4Q8H A;  2BDZ A;  3B79 A;  3HD3 A;  1AU2 A;  3S3Q A;  2YJ8 A;  2B1N A;  1ICF A;  3H6S A;  3RVX A;  3H7D A;  3KWZ A;  2E01 A;  4BGF A;  4N79 A;  1AEC A;  2VFC A;  4PP2 E;  3N3K A;  2G8J A;  1PXV A;  2HHN A;  4QH6 A;  2YJ2 A;  1GMY A;  6PAD A;  3RVW A;  2NQG A;  1GEC E;  2FQ9 A;  5EGW A;  3F75 A;  2HH5 A;  2DCA A;  2E03 A;  3OF9 A;  3KX1 A;  2AU1 A;  2P0R A;  1TL9 A;  3BWK A;  1VSN A;  1Y08 A;  2BDL A;  2VHS A;  3O1G A;  5PAD A;  1W6F A;  1SNK A;  5A24 A;  4I04 A;  1Q6K A;  2FYE A;  1NPZ A;  2AUZ A;  1PBH A;  2FUD A;  3U8E A;  2C0Y A;  3KFQ A;  4OEM A;  2PRE A;  5CHV A;  4G54 A;  4MSX A;  1AU4 A;  2NQA A;  3TNX A;  4MZS A;  2CIO A;  1ZCM A;  3MHH A;  2F1G A;  2IBI A;  2DCB A;  2R9M A;  2AUX A;  1AU3 A;  3M99 A;  1BP4 A;  1YK8 A;  1KFX L;  3H89 A;  1PCI A;  5CVM A;  4NV8 A;  3HWN A;  1PPP A;  1K3B B;  2G8E A;  4AXM A;  2E00 A;  2FT2 A;  1NQC A;  2Y6E A;  2AYN A;  4DMY A;  2P7U A;  1KHP A;  3IUT A;  4PP1 A;  2YJ9 A;  1MIR A;  4CDE B;  2OP3 A;  3K9M A;  4X6H A;  3K24 A;  3KKU A;  4WA6 A;  3CBK A;  5CVO B;  7PCK A;  1AYU A;  1AYV A;  1NB3 A;  4P6G A;  1TLO A;  2DCC A;  3IHP A;  3N4C A;  2ARY A;  3C9E A;  4BS5 A;  4CZW A;  4K7C A;  3WXG A;  3P5W A;  2FTD A;  4W5B A;  1IWD A;  1F2A A;  2AYO A;  1BGO A;  1KHQ A;  3OVX A;  2OZ2 A;  1GLO A;  3QSD A;  5EF4 A;  2DC9 A;  4OEL A;  1SP4 B;  1HUC B;  3I3T A;  1AYW A;  2G6D A;  3USV A;  2DC8 A;  2R9O A;  3KW9 A;  1W5R A;  1PIP A;  2JQF R;  4MZO A;  1U9X A;  4CDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...