4N79A

Structure of cathepsin k-dermatan sulfate complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of collagen fiber degradation by cathepsin K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin K
total genus 59
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2013-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4n79A00
1MEMA 2NQGA 1KHPA 3KW9A 1ME4A 1KFUL 2OP3A 1EWOA 3F5VA 1ATKA 2B1MA 5A24A 1CQDA 3KWZA 2DC7A 3P5UA 4X6JA 1KHQA 2P7UA 2B1NA 1CS8A 1THEA 1YK8A 3RVVA 1EF7A 3H6SA 1AU3A 1EWLA 1STFE 3CBJA 1BY8A 2PREA 1EWMA 1ZCMA 3OF8A 4CDFB 2GFOA 4XUIA 4YYUA 1CSBB 3IUTA 3H8CA 2G7YA 1YT7A 4MZSA 1CB5A 2AIMA 4PP2E 2JQGR 2YJCA 3H7DA 1AYWA 1CTEA 1CJLA 7PCKA 2FQ9A 2DZYA 4BS5A 4DMXA 2PADA 4N79A 1PBHA 1NB3A 4FIPA 2DCAA 3P5VA 1JQPA 1QXPA 1Q6KA 3KKUA 4AXMA 3CH3X 2XU1A 3BPFA 2ACTA 1KXRA 5CHTA 3MHHA 3WXFA 1PPNA 2O6XA 2IPPB 4Q8GA 1PE6A 1U9QX 3V6CA 1YVBA 2NQDB 1CPJA 6PADA 2OULA 1GECE 1M6DA 2GHUA 2DC9A 1PCIA 1DF0A 2AUZA 4W4UA 2HXZA 5CVMA 2DCDA 4MSXA 2BDZA 3HD3A 3ZUAA 5PADA 1AECA 1PPDA 1PPPA 3QSDA 4XR7A 3H8BA 4I04A 4YYWA 3O1GA 4FJCA 3BC3A 3B79A 4CZWA 4KLBA 4BQVA 1ME3A 4X6HA 3BCNA 3WXEA 3LFYA 5J94A 1YALA 3F75A 3ERVA 3BWKA 4N4ZA 3LXSA 4I07A 1NL6A 1AYUA 2FO5A 1F29A 1ITOA 1VSNA 4N8WA 3PBHA 3M99A 2AS8A 1ZIVA 2Y5BA 2CIOA 2AYOA 3I3TA 1Y08A 3OVXA 2F7DA 5FPWA 3QJ3A 4OEMA 3MTNA 3P5XA 1MHWA 2DC6A 2AVWA 4BSQA 2YJ9A 2R9NA 2FYEA 2P0RA 3OISA 1MS6A 3QT4A 4X6IA 2WBFX 1TL9A 3IMAA 1GLOA 2VHSA 4K7CA 3USVA 2E00A 4AXLA 2YJBA 1AIMA 5K16A 1QMYA 2BDLA 3S3QA 2FRAA 3C9EA 4P6EA 2ARYA 1VJVA 2FRQA 3CH2X 1BQIA 1S4VA 1SNKA 4PADA 2OZ2A 3TNXA 3P5WA 3E1ZB 2AUXA 4HWYA 5EGWA 2FT2A 3MHSA 4FK5A 2DCCA 1PIPA 1CV8A 2R9MA 3KSEA 2HH5A 2IBIA 3U8EA 2DJFB 2VHFA 1PADA 2R9FA 3K9MA 4CDCB 3K24A 2G8EA 3KWBX 1YK7A 4RY2A 4YYSA 4QBBA 3N4CA 3HWNA 3KFQA 2HHNA 1NPZA 1PXVA 1KFXL 4WA6A 3MORA 3RVXA 5JH3A 1GCBA 3N3KA 1IWDA 3O0UA 2PBHA 4YVAA 3GCBA 2ATOA 2F1GA 1U5IA 3NHEA 1FH0A 4BS6A 1QDQA 2CB5A 1GMYA 3HHIA 1AU2A 4P6GA 2PNSA 2C0YA 2NQAA 2DZZA 1MDWA 4CDDB 1F2CA 2G6DA 2DC8A 2XU4A 1HUCB 3OF9A 1U9VA 1U9XA 2G8JA 1U9WA 1MEGA 3KX1A 2P86A 4QRVA 1ICFA 2XU3A 4YYQA 2YJ8A 2H7JA 4ZUXU 4QRXA 3N3GA 5EF4A 5JA7A 1NLJA 1AU0A 4YYVA 5F02A 1XKGA 3HHAA 1X9YA 4YV8A 3IHPA 2R9CA 4W5CA 2AU1A 3RVWA 3IOQA 1MIRA 1K3BB 3K8UA 2AYNA 4I05A 1AYVA 2E01A 1POPA 2DJGB 2Y6EA 4QH6A 3S3RA 1O0EA 3I06A 4G54A 4CDEB 4YYRA 1F2BA 9PAPA 5CVNB 1SP4B 1DEUA 1TU6A 4DMYA 2FTDA 3AI8A 1QOLA 5CHVA 3PDFA 3V6EA 2R9OA 1AU4A 1PPOA 3OVZA 1NQCA 1EWPA 5CVOB 1BP4A 2JQFR 2E02A 1Y4HA 1BGOA 2XU5A 3WXGA 3PNRA 3IEJA 2DCBA 3CBKA 4Q8HA 3IV2A 3H89A 2HD5A 4W5BA 4PP1A 4MZOA 3D6SA 1CVZA 2R6NA 3BOWA 1F2AA 2YJ2A 2NQIA 8PCHA 3DF0A 4PI3A 2E03A 3BPMA 4BPVA 1NB5A 1TLOA 2FUDA 4QRGA 4OELA 1A6RA 3PW3A
chains in the Genus database with same CATH superfamily
1MEMA 2NQGA 1KHPA 3KW9A 1ME4A 2BTWB 1KFUL 2OP3A 1EWOA 3F5VA 1ATKA 2B1MA 5A24A 1CQDA 3KWZA 2DC7A 3P5UA 4X6JA 1KHQA 3C0RA 2P7UA 2B1NA 4OVZB 1CS8A 1THEA 2JTCA 1YK8A 3RVVA 1EF7A 3H6SA 1AU3A 3PHXA 1EWLA 1STFE 3CBJA 1BY8A 2PREA 1EWMA 1ZCMA 3OF8A 4CDFB 2GFOA 4XUIA 4YYUA 1CSBB 3IUTA 5JZEA 3H8CA 2G7YA 1YT7A 4MZSA 1CB5A 2AIMA 4PP2E 2JQGR 4IP3A 4REZA 2YJCA 3H7DA 1AYWA 1CTEA 1CJLA 7PCKA 2FQ9A 2DZYA 4BS5A 4DMXA 2PADA 4N79A 1PBHA 1NB3A 4FIPA 2DCAA 3P5VA 1JQPA 1QXPA 4MM3B 1Q6KA 3KKUA 2Z84A 4AXMA 3CH3X 2XU1A 3BBAA 3BPFA 2ACTA 1KXRA 5CHTA 3OQCA 3PRPA 3MHHA 3WXFA 1PPNA 2O6XA 2IPPB 3PT2A 4Q8GA 1PE6A 1U9QX 3V6CA 1YVBA 2NQDB 1CPJA 3MP2A 6PADA 2OULA 1GECE 1M6DA 2GHUA 3E9SA 2BU3A 2DC9A 4D8IA 1PCIA 3IFUA 1DF0A 2AUZA 4W4UA 2HXZA 5CVMA 2DCDA 4MSXA 2BDZA 3HD3A 2UZJA 3ZUAA 5PADA 1AECA 1PPDA 3PRMA 1PPPA 3QSDA 4BOQA 2BTWA 4XR7A 3H8BA 4I04A 4YYWA 3O1GA 3TRKA 4FJCA 3BC3A 3B79A 2AGAA 4CZWA 3B21A 4KLBA 4BQVA 1ME3A 4X6HA 3BCNA 3WXEA 3LFYA 3F75A 1YALA 5J94A 3ERVA 3BWKA 4N4ZA 3LXSA 4I07A 3RNVA 3O65A 3BY4A 1NL6A 1AYUA 2FO5A 5KO3A 1F29A 1ITOA 1VSNA 4N8WA 3PBHA 3M99A 2AS8A 1ZIVA 4BOUA 2Y5BA 4D8BA 2CIOA 2AYOA 3I3TA 4R3DA 1Y08A 3OVXA 2F7DA 5FPWA 2J7QA 2DOSA 3QJ3A 3PHUA 4OEMA 3MTNA 3P5XA 1MHWA 2DC6A 2AVWA 4BSQA 2YJ9A 2R9NA 2FYEA 1PVJA 2P0RA 4BOZA 5E6JA 5EZSA 3OISA 1MS6A 3QT4A 4X6IA 2WBFX 1TL9A 3IMAA 1GLOA 4OVZA 2VHSA 4K7CA 3USVA 2E00A 4AXLA 4RNAA 2YJBA 4OW0A 1AIMA 5K16A 1QMYA 2BDLA 3S3QA 2FRAA 3C9EA 4P6EA 2ARYA 1UKFA 1VJVA 2FRQA 3CH2X 1BQIA 3TMPA 1S4VA 1SNKA 4PADA 2OZ2A 3TNXA 3P5WA 2FE8A 3E1ZB 3PSEA 2AUXA 4HWYA 5EGWA 2FT2A 3MHSA 4FK5A 3ZNHA 2DCCA 4PT5A 1PIPA 1CV8A 2R9MA 3KSEA 2HH5A 2IBIA 3U8EA 2DJFB 2VHFA 1PADA 4RF1A 2R9FA 3K9MA 4CDCB 3K24A 2G8EA 3KWBX 1YK7A 4RY2A 4YYSA 4QBBA 3N4CA 3HWNA 3KFQA 2HHNA 1NPZA 1PXVA 1KFXL 4WA6A 3MORA 3RVXA 5JH3A 1GCBA 3N3KA 2HWKA 1IWDA 3O0UA 2PBHA 4YVAA 3GCBA 2ATOA 4BOPA 2F1GA 1U5IA 3NHEA 1FH0A 4BS6A 4WURA 1QDQA 2CB5A 1GMYA 3HHIA 1AU2A 4P6GA 2PNSA 2C0YA 2NQAA 2DZZA 4A5UA 1MDWA 4CDDB 1F2CA 2G6DA 2DC8A 2XU4A 1HUCB 3OF9A 1U9VA 1U9XA 2G8JA 1U9WA 1MEGA 3KX1A 2J7QC 2P86A 1ICFA 4QRVA 4D8EA 2XU3A 4YYQA 2YJ8A 2H7JA 4BOSA 4ZUXU 4QRXA 3N3GA 5EF4A 5JA7A 4RF0A 5EZQA 1NLJA 1AU0A 4YYVA 5F02A 1XKGA 3HHAA 1X9YA 4YV8A 3IHPA 2R9CA 4IUMA 4W5CA 2AU1A 3RVWA 3IOQA 1MIRA 3W31A 1K3BB 3K8UA 2AYNA 4I05A 1AYVA 2E01A 1POPA 4ZTBA 2DJGB 2Y6EA 4QH6A 3S3RA 1O0EA 3I06A 4G54A 4CDEB 4YYRA 4P16A 1F2BA 9PAPA 3PHWA 5CVNB 1SP4B 1DEUA 1TU6A 4DMYA 4GUAA 2FTDA 3W30A 3AI8A 1QOLA 5CHVA 3PDFA 2R9OA 3OVZA 1AU4A 1PPOA 3BB7A 3V6EA 1NQCA 1EWPA 3MTVA 2JRIA 1BP4A 2JQFR 4XZXA 5CVOB 2E02A 1Y4HA 4M0WA 1BGOA 2XU5A 4RKXA 3WXGA 3PNRA 3IEJA 2DCBA 3CBKA 4Q8HA 3IV2A 3H89A 2HD5A 4HXDB 4W5BA 4PP1A 4MZOA 1YZBA 3D6SA 1CVZA 2R6NA 3BOWA 1F2AA 2YJ2A 3MJ5A 2NQIA 8PCHA 3DF0A 1DKIA 4PI3A 2E03A 3BPMA 4BPVA 1NB5A 1TLOA 4MI7A 2FUDA 4QRGA 4OELA 1A6RA 3PW3A
chains in the Genus database with same CATH topology
1MEMA 2NQGA 1KHPA 3KW9A 1ME4A 1KFUL 2OP3A 1EWOA 3F5VA 1ATKA 2B1MA 5A24A 1CQDA 3KWZA 2DC7A 3P5UA 4X6JA 1KHQA 2P7UA 2B1NA 1CS8A 1THEA 1YK8A 3RVVA 1EF7A 3H6SA 1AU3A 1EWLA 1STFE 3CBJA 1BY8A 2PREA 1EWMA 1ZCMA 3OF8A 4CDFB 2GFOA 4XUIA 4YYUA 1CSBB 3IUTA 3H8CA 2G7YA 1YT7A 4C5PA 4MZSA 1CB5A 2AIMA 4PP2E 2JQGR 2YJCA 3H7DA 1AYWA 1CTEA 1CJLA 7PCKA 2FQ9A 2DZYA 4BS5A 4DMXA 2PADA 4N79A 1PBHA 1NB3A 4FIPA 2DCAA 3P5VA 1JQPA 1QXPA 1Q6KA 3KKUA 4AXMA 3CH3X 2XU1A 3BPFA 2ACTA 1KXRA 5CHTA 3MHHA 3WXFA 1PPNA 2O6XA 2IPPB 4Q8GA 1PE6A 1U9QX 3V6CA 1YVBA 2NQDB 1CPJA 6PADA 2OULA 1GECE 1M6DA 2GHUA 2DC9A 1PCIA 1DF0A 2AUZA 1E2TA 4W4UA 2HXZA 1W5RA 5CVMA 2DCDA 4MSXA 2BDZA 3HD3A 3ZUAA 5PADA 1AECA 1PPDA 1PPPA 3QSDA 4XR7A 3H8BA 4I04A 4YYWA 3O1GA 4FJCA 3BC3A 3B79A 4CZWA 4KLBA 4BQVA 1ME3A 4X6HA 3BCNA 3WXEA 3LFYA 5J94A 1YALA 3F75A 1W4TA 3ERVA 4BGFA 3BWKA 4N4ZA 3LXSA 4I07A 1NL6A 1AYUA 2FO5A 1F29A 1ITOA 1VSNA 4N8WA 3PBHA 3M99A 2AS8A 1ZIVA 2Y5BA 2CIOA 2AYOA 3I3TA 1Y08A 3OVXA 2F7DA 5FPWA 3QJ3A 2BSZA 4OEMA 3MTNA 3P5XA 1MHWA 2DC6A 2AVWA 4BSQA 2YJ9A 2R9NA 2FYEA 2P0RA 3OISA 1MS6A 3QT4A 4X6IA 2VFCA 2WBFX 1TL9A 3IMAA 4B55A 1GLOA 2VHSA 4K7CA 3USVA 2E00A 4AXLA 2YJBA 1AIMA 5K16A 1QMYA 2BDLA 3S3QA 2FRAA 3C9EA 4P6EA 2ARYA 1VJVA 2FRQA 3CH2X 1BQIA 1S4VA 1SNKA 4PADA 2OZ2A 3TNXA 3P5WA 3E1ZB 2AUXA 4HWYA 5EGWA 2FT2A 3MHSA 4FK5A 2DCCA 1PIPA 1CV8A 2R9MA 3KSEA 2HH5A 2IBIA 3U8EA 2DJFB 4GUZA 2VHFA 1PADA 1GX3A 2R9FA 3K9MA 4CDCB 4NV8A 3K24A 2G8EA 3KWBX 1YK7A 4RY2A 4YYSA 4QBBA 3N4CA 3HWNA 3KFQA 2HHNA 1NPZA 1PXVA 1KFXL 4WA6A 3MORA 3RVXA 5JH3A 1GCBA 3N3KA 1IWDA 3O0UA 2PBHA 4YVAA 3GCBA 2ATOA 3LTWA 2F1GA 1U5IA 3NHEA 1FH0A 4BS6A 1QDQA 2CB5A 1GMYA 3HHIA 1AU2A 4P6GA 2PNSA 2C0YA 2NQAA 2DZZA 1MDWA 4CDDB 1F2CA 2G6DA 2DC8A 2XU4A 1HUCB 3OF9A 1U9VA 1U9XA 2G8JA 1U9WA 1MEGA 3KX1A 2P86A 4QRVA 1ICFA 2XU3A 4YYQA 2YJ8A 2H7JA 4ZUXU 3D9WA 4QRXA 3N3GA 5EF4A 5JA7A 1NLJA 1AU0A 4YYVA 5F02A 1XKGA 3HHAA 1X9YA 4YV8A 2VFBA 3IHPA 2R9CA 4W5CA 2AU1A 3RVWA 3IOQA 1MIRA 1K3BB 3K8UA 2AYNA 4I05A 1AYVA 2E01A 1POPA 2DJGB 2Y6EA 4QH6A 3S3RA 1O0EA 3I06A 4G54A 4CDEB 1W6FA 4YYRA 4NV7A 1F2BA 9PAPA 5CVNB 1SP4B 1DEUA 1TU6A 4DMYA 2FTDA 3AI8A 1QOLA 5CHVA 3PDFA 2R9OA 3OVZA 1AU4A 1PPOA 3V6EA 1NQCA 1EWPA 5CVOB 1BP4A 2JQFR 2E02A 1Y4HA 1BGOA 2XU5A 3WXGA 3PNRA 3IEJA 2DCBA 3CBKA 4Q8HA 3IV2A 3H89A 2HD5A 4W5BA 4PP1A 4MZOA 3D6SA 1CVZA 2R6NA 3BOWA 1F2AA 2YJ2A 2NQIA 8PCHA 3DF0A 4PI3A 2E03A 3BPMA 4BPVA 1NB5A 1TLOA 2FUDA 4QRGA 4OELA 1A6RA 3PW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEM A;  2NQG A;  1KHP A;  3KW9 A;  1ME4 A;  1KFU L;  2OP3 A;  1EWO A;  3F5V A;  1ATK A;  2B1M A;  5A24 A;  1CQD A;  3KWZ A;  2DC7 A;  3P5U A;  4X6J A;  1KHQ A;  2P7U A;  2B1N A;  1CS8 A;  1THE A;  1YK8 A;  3RVV A;  1EF7 A;  3H6S A;  1AU3 A;  1EWL A;  1STF E;  3CBJ A;  1BY8 A;  2PRE A;  1EWM A;  1ZCM A;  3OF8 A;  4CDF B;  2GFO A;  4XUI A;  4YYU A;  1CSB B;  3IUT A;  3H8C A;  2G7Y A;  1YT7 A;  4MZS A;  1CB5 A;  2AIM A;  4PP2 E;  2JQG R;  2YJC A;  3H7D A;  1AYW A;  1CTE A;  1CJL A;  7PCK A;  2FQ9 A;  2DZY A;  4BS5 A;  4DMX A;  2PAD A;  4N79 A;  1PBH A;  1NB3 A;  4FIP A;  2DCA A;  3P5V A;  1JQP A;  1QXP A;  1Q6K A;  3KKU A;  4AXM A;  3CH3 X;  2XU1 A;  3BPF A;  2ACT A;  1KXR A;  5CHT A;  3MHH A;  3WXF A;  1PPN A;  2O6X A;  2IPP B;  4Q8G A;  1PE6 A;  1U9Q X;  3V6C A;  1YVB A;  2NQD B;  1CPJ A;  6PAD A;  2OUL A;  1GEC E;  1M6D A;  2GHU A;  2DC9 A;  1PCI A;  1DF0 A;  2AUZ A;  4W4U A;  2HXZ A;  5CVM A;  2DCD A;  4MSX A;  2BDZ A;  3HD3 A;  3ZUA A;  5PAD A;  1AEC A;  1PPD A;  1PPP A;  3QSD A;  4XR7 A;  3H8B A;  4I04 A;  4YYW A;  3O1G A;  4FJC A;  3BC3 A;  3B79 A;  4CZW A;  4KLB A;  4BQV A;  1ME3 A;  4X6H A;  3BCN A;  3WXE A;  3LFY A;  5J94 A;  1YAL A;  3F75 A;  3ERV A;  3BWK A;  4N4Z A;  3LXS A;  4I07 A;  1NL6 A;  1AYU A;  2FO5 A;  1F29 A;  1ITO A;  1VSN A;  4N8W A;  3PBH A;  3M99 A;  2AS8 A;  1ZIV A;  2Y5B A;  2CIO A;  2AYO A;  3I3T A;  1Y08 A;  3OVX A;  2F7D A;  5FPW A;  3QJ3 A;  4OEM A;  3MTN A;  3P5X A;  1MHW A;  2DC6 A;  2AVW A;  4BSQ A;  2YJ9 A;  2R9N A;  2FYE A;  2P0R A;  3OIS A;  1MS6 A;  3QT4 A;  4X6I A;  2WBF X;  1TL9 A;  3IMA A;  1GLO A;  2VHS A;  4K7C A;  3USV A;  2E00 A;  4AXL A;  2YJB A;  1AIM A;  5K16 A;  1QMY A;  2BDL A;  3S3Q A;  2FRA A;  3C9E A;  4P6E A;  2ARY A;  1VJV A;  2FRQ A;  3CH2 X;  1BQI A;  1S4V A;  1SNK A;  4PAD A;  2OZ2 A;  3TNX A;  3P5W A;  3E1Z B;  2AUX A;  4HWY A;  5EGW A;  2FT2 A;  3MHS A;  4FK5 A;  2DCC A;  1PIP A;  1CV8 A;  2R9M A;  3KSE A;  2HH5 A;  2IBI A;  3U8E A;  2DJF B;  2VHF A;  1PAD A;  2R9F A;  3K9M A;  4CDC B;  3K24 A;  2G8E A;  3KWB X;  1YK7 A;  4RY2 A;  4YYS A;  4QBB A;  3N4C A;  3HWN A;  3KFQ A;  2HHN A;  1NPZ A;  1PXV A;  1KFX L;  4WA6 A;  3MOR A;  3RVX A;  5JH3 A;  1GCB A;  3N3K A;  1IWD A;  3O0U A;  2PBH A;  4YVA A;  3GCB A;  2ATO A;  2F1G A;  1U5I A;  3NHE A;  1FH0 A;  4BS6 A;  1QDQ A;  2CB5 A;  1GMY A;  3HHI A;  1AU2 A;  4P6G A;  2PNS A;  2C0Y A;  2NQA A;  2DZZ A;  1MDW A;  4CDD B;  1F2C A;  2G6D A;  2DC8 A;  2XU4 A;  1HUC B;  3OF9 A;  1U9V A;  1U9X A;  2G8J A;  1U9W A;  1MEG A;  3KX1 A;  2P86 A;  4QRV A;  1ICF A;  2XU3 A;  4YYQ A;  2YJ8 A;  2H7J A;  4ZUX U;  4QRX A;  3N3G A;  5EF4 A;  5JA7 A;  1NLJ A;  1AU0 A;  4YYV A;  5F02 A;  1XKG A;  3HHA A;  1X9Y A;  4YV8 A;  3IHP A;  2R9C A;  4W5C A;  2AU1 A;  3RVW A;  3IOQ A;  1MIR A;  1K3B B;  3K8U A;  2AYN A;  4I05 A;  1AYV A;  2E01 A;  1POP A;  2DJG B;  2Y6E A;  4QH6 A;  3S3R A;  1O0E A;  3I06 A;  4G54 A;  4CDE B;  4YYR A;  1F2B A;  9PAP A;  5CVN B;  1SP4 B;  1DEU A;  1TU6 A;  4DMY A;  2FTD A;  3AI8 A;  1QOL A;  5CHV A;  3PDF A;  3V6E A;  2R9O A;  1AU4 A;  1PPO A;  3OVZ A;  1NQC A;  1EWP A;  5CVO B;  1BP4 A;  2JQF R;  2E02 A;  1Y4H A;  1BGO A;  2XU5 A;  3WXG A;  3PNR A;  3IEJ A;  2DCB A;  3CBK A;  4Q8H A;  3IV2 A;  3H89 A;  2HD5 A;  4W5B A;  4PP1 A;  4MZO A;  3D6S A;  1CVZ A;  2R6N A;  3BOW A;  1F2A A;  2YJ2 A;  2NQI A;  8PCH A;  3DF0 A;  4PI3 A;  2E03 A;  3BPM A;  4BPV A;  1NB5 A;  1TLO A;  2FUD A;  4QRG A;  4OEL A;  1A6R A;  3PW3 A; 
#chains in the Genus database with same CATH topology
 1MEM A;  2NQG A;  1KHP A;  3KW9 A;  1ME4 A;  2BTW B;  1KFU L;  2OP3 A;  1EWO A;  3F5V A;  1ATK A;  2B1M A;  5A24 A;  1CQD A;  3KWZ A;  2DC7 A;  3P5U A;  4X6J A;  1KHQ A;  3C0R A;  2P7U A;  2B1N A;  4OVZ B;  1CS8 A;  1THE A;  2JTC A;  1YK8 A;  3RVV A;  1EF7 A;  3H6S A;  1AU3 A;  3PHX A;  1EWL A;  1STF E;  3CBJ A;  1BY8 A;  2PRE A;  1EWM A;  1ZCM A;  3OF8 A;  4CDF B;  2GFO A;  4XUI A;  4YYU A;  1CSB B;  3IUT A;  5JZE A;  3H8C A;  2G7Y A;  1YT7 A;  4MZS A;  1CB5 A;  2AIM A;  4PP2 E;  2JQG R;  4IP3 A;  4REZ A;  2YJC A;  3H7D A;  1AYW A;  1CTE A;  1CJL A;  7PCK A;  2FQ9 A;  2DZY A;  4BS5 A;  4DMX A;  2PAD A;  4N79 A;  1PBH A;  1NB3 A;  4FIP A;  2DCA A;  3P5V A;  1JQP A;  1QXP A;  4MM3 B;  1Q6K A;  3KKU A;  2Z84 A;  4AXM A;  3CH3 X;  2XU1 A;  3BBA A;  3BPF A;  2ACT A;  1KXR A;  5CHT A;  3OQC A;  3PRP A;  3MHH A;  3WXF A;  1PPN A;  2O6X A;  2IPP B;  3PT2 A;  4Q8G A;  1PE6 A;  1U9Q X;  3V6C A;  1YVB A;  2NQD B;  1CPJ A;  3MP2 A;  6PAD A;  2OUL A;  1GEC E;  1M6D A;  2GHU A;  3E9S A;  2BU3 A;  2DC9 A;  4D8I A;  1PCI A;  3IFU A;  1DF0 A;  2AUZ A;  4W4U A;  2HXZ A;  5CVM A;  2DCD A;  4MSX A;  2BDZ A;  3HD3 A;  2UZJ A;  3ZUA A;  5PAD A;  1AEC A;  1PPD A;  3PRM A;  1PPP A;  3QSD A;  4BOQ A;  2BTW A;  4XR7 A;  3H8B A;  4I04 A;  4YYW A;  3O1G A;  3TRK A;  4FJC A;  3BC3 A;  3B79 A;  2AGA A;  4CZW A;  3B21 A;  4KLB A;  4BQV A;  1ME3 A;  4X6H A;  3BCN A;  3WXE A;  3LFY A;  3F75 A;  1YAL A;  5J94 A;  3ERV A;  3BWK A;  4N4Z A;  3LXS A;  4I07 A;  3RNV A;  3O65 A;  3BY4 A;  1NL6 A;  1AYU A;  2FO5 A;  5KO3 A;  1F29 A;  1ITO A;  1VSN A;  4N8W A;  3PBH A;  3M99 A;  2AS8 A;  1ZIV A;  4BOU A;  2Y5B A;  4D8B A;  2CIO A;  2AYO A;  3I3T A;  4R3D A;  1Y08 A;  3OVX A;  2F7D A;  5FPW A;  2J7Q A;  2DOS A;  3QJ3 A;  3PHU A;  4OEM A;  3MTN A;  3P5X A;  1MHW A;  2DC6 A;  2AVW A;  4BSQ A;  2YJ9 A;  2R9N A;  2FYE A;  1PVJ A;  2P0R A;  4BOZ A;  5E6J A;  5EZS A;  3OIS A;  1MS6 A;  3QT4 A;  4X6I A;  2WBF X;  1TL9 A;  3IMA A;  1GLO A;  4OVZ A;  2VHS A;  4K7C A;  3USV A;  2E00 A;  4AXL A;  4RNA A;  2YJB A;  4OW0 A;  1AIM A;  5K16 A;  1QMY A;  2BDL A;  3S3Q A;  2FRA A;  3C9E A;  4P6E A;  2ARY A;  1UKF A;  1VJV A;  2FRQ A;  3CH2 X;  1BQI A;  3TMP A;  1S4V A;  1SNK A;  4PAD A;  2OZ2 A;  3TNX A;  3P5W A;  2FE8 A;  3E1Z B;  3PSE A;  2AUX A;  4HWY A;  5EGW A;  2FT2 A;  3MHS A;  4FK5 A;  3ZNH A;  2DCC A;  4PT5 A;  1PIP A;  1CV8 A;  2R9M A;  3KSE A;  2HH5 A;  2IBI A;  3U8E A;  2DJF B;  2VHF A;  1PAD A;  4RF1 A;  2R9F A;  3K9M A;  4CDC B;  3K24 A;  2G8E A;  3KWB X;  1YK7 A;  4RY2 A;  4YYS A;  4QBB A;  3N4C A;  3HWN A;  3KFQ A;  2HHN A;  1NPZ A;  1PXV A;  1KFX L;  4WA6 A;  3MOR A;  3RVX A;  5JH3 A;  1GCB A;  3N3K A;  2HWK A;  1IWD A;  3O0U A;  2PBH A;  4YVA A;  3GCB A;  2ATO A;  4BOP A;  2F1G A;  1U5I A;  3NHE A;  1FH0 A;  4BS6 A;  4WUR A;  1QDQ A;  2CB5 A;  1GMY A;  3HHI A;  1AU2 A;  4P6G A;  2PNS A;  2C0Y A;  2NQA A;  2DZZ A;  4A5U A;  1MDW A;  4CDD B;  1F2C A;  2G6D A;  2DC8 A;  2XU4 A;  1HUC B;  3OF9 A;  1U9V A;  1U9X A;  2G8J A;  1U9W A;  1MEG A;  3KX1 A;  2J7Q C;  2P86 A;  1ICF A;  4QRV A;  4D8E A;  2XU3 A;  4YYQ A;  2YJ8 A;  2H7J A;  4BOS A;  4ZUX U;  4QRX A;  3N3G A;  5EF4 A;  5JA7 A;  4RF0 A;  5EZQ A;  1NLJ A;  1AU0 A;  4YYV A;  5F02 A;  1XKG A;  3HHA A;  1X9Y A;  4YV8 A;  3IHP A;  2R9C A;  4IUM A;  4W5C A;  2AU1 A;  3RVW A;  3IOQ A;  1MIR A;  3W31 A;  1K3B B;  3K8U A;  2AYN A;  4I05 A;  1AYV A;  2E01 A;  1POP A;  4ZTB A;  2DJG B;  2Y6E A;  4QH6 A;  3S3R A;  1O0E A;  3I06 A;  4G54 A;  4CDE B;  4YYR A;  4P16 A;  1F2B A;  9PAP A;  3PHW A;  5CVN B;  1SP4 B;  1DEU A;  1TU6 A;  4DMY A;  4GUA A;  2FTD A;  3W30 A;  3AI8 A;  1QOL A;  5CHV A;  3PDF A;  2R9O A;  3OVZ A;  1AU4 A;  1PPO A;  3BB7 A;  3V6E A;  1NQC A;  1EWP A;  3MTV A;  2JRI A;  1BP4 A;  2JQF R;  4XZX A;  5CVO B;  2E02 A;  1Y4H A;  4M0W A;  1BGO A;  2XU5 A;  4RKX A;  3WXG A;  3PNR A;  3IEJ A;  2DCB A;  3CBK A;  4Q8H A;  3IV2 A;  3H89 A;  2HD5 A;  4HXD B;  4W5B A;  4PP1 A;  4MZO A;  1YZB A;  3D6S A;  1CVZ A;  2R6N A;  3BOW A;  1F2A A;  2YJ2 A;  3MJ5 A;  2NQI A;  8PCH A;  3DF0 A;  1DKI A;  4PI3 A;  2E03 A;  3BPM A;  4BPV A;  1NB5 A;  1TLO A;  4MI7 A;  2FUD A;  4QRG A;  4OEL A;  1A6R A;  3PW3 A; 
#chains in the Genus database with same CATH homology
 1MEM A;  2NQG A;  1KHP A;  3KW9 A;  1ME4 A;  1KFU L;  2OP3 A;  1EWO A;  3F5V A;  1ATK A;  2B1M A;  5A24 A;  1CQD A;  3KWZ A;  2DC7 A;  3P5U A;  4X6J A;  1KHQ A;  2P7U A;  2B1N A;  1CS8 A;  1THE A;  1YK8 A;  3RVV A;  1EF7 A;  3H6S A;  1AU3 A;  1EWL A;  1STF E;  3CBJ A;  1BY8 A;  2PRE A;  1EWM A;  1ZCM A;  3OF8 A;  4CDF B;  2GFO A;  4XUI A;  4YYU A;  1CSB B;  3IUT A;  3H8C A;  2G7Y A;  1YT7 A;  4C5P A;  4MZS A;  1CB5 A;  2AIM A;  4PP2 E;  2JQG R;  2YJC A;  3H7D A;  1AYW A;  1CTE A;  1CJL A;  7PCK A;  2FQ9 A;  2DZY A;  4BS5 A;  4DMX A;  2PAD A;  4N79 A;  1PBH A;  1NB3 A;  4FIP A;  2DCA A;  3P5V A;  1JQP A;  1QXP A;  1Q6K A;  3KKU A;  4AXM A;  3CH3 X;  2XU1 A;  3BPF A;  2ACT A;  1KXR A;  5CHT A;  3MHH A;  3WXF A;  1PPN A;  2O6X A;  2IPP B;  4Q8G A;  1PE6 A;  1U9Q X;  3V6C A;  1YVB A;  2NQD B;  1CPJ A;  6PAD A;  2OUL A;  1GEC E;  1M6D A;  2GHU A;  2DC9 A;  1PCI A;  1DF0 A;  2AUZ A;  1E2T A;  4W4U A;  2HXZ A;  1W5R A;  5CVM A;  2DCD A;  4MSX A;  2BDZ A;  3HD3 A;  3ZUA A;  5PAD A;  1AEC A;  1PPD A;  1PPP A;  3QSD A;  4XR7 A;  3H8B A;  4I04 A;  4YYW A;  3O1G A;  4FJC A;  3BC3 A;  3B79 A;  4CZW A;  4KLB A;  4BQV A;  1ME3 A;  4X6H A;  3BCN A;  3WXE A;  3LFY A;  5J94 A;  1YAL A;  3F75 A;  1W4T A;  3ERV A;  4BGF A;  3BWK A;  4N4Z A;  3LXS A;  4I07 A;  1NL6 A;  1AYU A;  2FO5 A;  1F29 A;  1ITO A;  1VSN A;  4N8W A;  3PBH A;  3M99 A;  2AS8 A;  1ZIV A;  2Y5B A;  2CIO A;  2AYO A;  3I3T A;  1Y08 A;  3OVX A;  2F7D A;  5FPW A;  3QJ3 A;  2BSZ A;  4OEM A;  3MTN A;  3P5X A;  1MHW A;  2DC6 A;  2AVW A;  4BSQ A;  2YJ9 A;  2R9N A;  2FYE A;  2P0R A;  3OIS A;  1MS6 A;  3QT4 A;  4X6I A;  2VFC A;  2WBF X;  1TL9 A;  3IMA A;  4B55 A;  1GLO A;  2VHS A;  4K7C A;  3USV A;  2E00 A;  4AXL A;  2YJB A;  1AIM A;  5K16 A;  1QMY A;  2BDL A;  3S3Q A;  2FRA A;  3C9E A;  4P6E A;  2ARY A;  1VJV A;  2FRQ A;  3CH2 X;  1BQI A;  1S4V A;  1SNK A;  4PAD A;  2OZ2 A;  3TNX A;  3P5W A;  3E1Z B;  2AUX A;  4HWY A;  5EGW A;  2FT2 A;  3MHS A;  4FK5 A;  2DCC A;  1PIP A;  1CV8 A;  2R9M A;  3KSE A;  2HH5 A;  2IBI A;  3U8E A;  2DJF B;  4GUZ A;  2VHF A;  1PAD A;  1GX3 A;  2R9F A;  3K9M A;  4CDC B;  4NV8 A;  3K24 A;  2G8E A;  3KWB X;  1YK7 A;  4RY2 A;  4YYS A;  4QBB A;  3N4C A;  3HWN A;  3KFQ A;  2HHN A;  1NPZ A;  1PXV A;  1KFX L;  4WA6 A;  3MOR A;  3RVX A;  5JH3 A;  1GCB A;  3N3K A;  1IWD A;  3O0U A;  2PBH A;  4YVA A;  3GCB A;  2ATO A;  3LTW A;  2F1G A;  1U5I A;  3NHE A;  1FH0 A;  4BS6 A;  1QDQ A;  2CB5 A;  1GMY A;  3HHI A;  1AU2 A;  4P6G A;  2PNS A;  2C0Y A;  2NQA A;  2DZZ A;  1MDW A;  4CDD B;  1F2C A;  2G6D A;  2DC8 A;  2XU4 A;  1HUC B;  3OF9 A;  1U9V A;  1U9X A;  2G8J A;  1U9W A;  1MEG A;  3KX1 A;  2P86 A;  4QRV A;  1ICF A;  2XU3 A;  4YYQ A;  2YJ8 A;  2H7J A;  4ZUX U;  3D9W A;  4QRX A;  3N3G A;  5EF4 A;  5JA7 A;  1NLJ A;  1AU0 A;  4YYV A;  5F02 A;  1XKG A;  3HHA A;  1X9Y A;  4YV8 A;  2VFB A;  3IHP A;  2R9C A;  4W5C A;  2AU1 A;  3RVW A;  3IOQ A;  1MIR A;  1K3B B;  3K8U A;  2AYN A;  4I05 A;  1AYV A;  2E01 A;  1POP A;  2DJG B;  2Y6E A;  4QH6 A;  3S3R A;  1O0E A;  3I06 A;  4G54 A;  4CDE B;  1W6F A;  4YYR A;  4NV7 A;  1F2B A;  9PAP A;  5CVN B;  1SP4 B;  1DEU A;  1TU6 A;  4DMY A;  2FTD A;  3AI8 A;  1QOL A;  5CHV A;  3PDF A;  2R9O A;  3OVZ A;  1AU4 A;  1PPO A;  3V6E A;  1NQC A;  1EWP A;  5CVO B;  1BP4 A;  2JQF R;  2E02 A;  1Y4H A;  1BGO A;  2XU5 A;  3WXG A;  3PNR A;  3IEJ A;  2DCB A;  3CBK A;  4Q8H A;  3IV2 A;  3H89 A;  2HD5 A;  4W5B A;  4PP1 A;  4MZO A;  3D6S A;  1CVZ A;  2R6N A;  3BOW A;  1F2A A;  2YJ2 A;  2NQI A;  8PCH A;  3DF0 A;  4PI3 A;  2E03 A;  3BPM A;  4BPV A;  1NB5 A;  1TLO A;  2FUD A;  4QRG A;  4OEL A;  1A6R A;  3PW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...