2PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (sulfhydryl proteinase)
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2padA00
1MEGA 3BPFA 2WBFX 4YYSA 2DZYA 1F2CA 1ZIVA 1O0EA 4YYRA 5FPWA 3PW3A 3O0UA 3TNXA 4DMXA 1MIRA 4PI3A 1FH0A 1MEMA 1A6RA 1NL6A 4X6JA 5EF4A 3F5VA 1AU3A 4I05A 1PE6A 4DMYA 3KWBX 1CSBB 4BQVA 3RVXA 2OULA 3K8UA 4XR7A 1SP4B 1K3BB 3BWKA 3S3QA 3P5XA 3USVA 3H6SA 4CDFB 3PBHA 2YJCA 1BY8A 2E00A 2H7JA 3HHIA 4KLBA 1NLJA 2R9NA 3PNRA 3QJ3A 2XU3A 1BGOA 2FT2A 1NQCA 2CIOA 2OP3A 2DCBA 3RVWA 1CS8A 1PCIA 4AXMA 1TLOA 1POPA 1AU2A 3NHEA 3BPMA 2NQGA 4X6IA 2P0RA 2DC9A 2HHNA 4QRXA 2VHFA 4P6EA 2R9MA 1STFE 1AU4A 3WXFA 4W5BA 1U9QX 5JH3A 1ICFA 4HWYA 4Q8GA 3CBJA 1U9VA 1THEA 2FRAA 1TU6A 1ZCMA 2GHUA 3PDFA 3HD3A 4K7CA 2G8EA 3MORA 3IV2A 2B1MA 1CB5A 1ME4A 1CQDA 1ME3A 3AI8A 2E02A 4FK5A 4W5CA 4N4ZA 4OELA 3CH3X 1AYUA 1IWDA 2G7YA 3P5WA 4CDDB 3U8EA 3I06A 2F7DA 5CVNB 3KW9A 2E01A 2E03A 3IMAA 3IHPA 3K24A 4YVAA 3GCBA 1NB3A 1F2AA 1QXPA 4W4UA 1GLOA 2AVWA 4I04A 1YVBA 9PAPA 3KSEA 4P6GA 1HUCB 1AU0A 1QMYA 1Y08A 1AECA 1YALA 1JQPA 8PCHA 5JA7A 3F75A 1YT7A 3RVVA 1PPDA 3P5UA 3P5VA 3IUTA 4OEMA 2IBIA 4QRGA 3OISA 5F02A 3V6EA 1Q6KA 2C0YA 1ATKA 2AYNA 2R9FA 5PADA 3OVXA 2JQFR 1PBHA 2DJFB 4MSXA 4QBBA 4YYVA 1KHQA 1EF7A 4PADA 2YJ9A 3MHHA 1ITOA 4QH6A 1PPPA 4RY2A 4YYQA 4BS5A 3KX1A 2Y5BA 2PBHA 1S4VA 2PADA 3KWZA 4YYUA 3IOQA 2AIMA 2FYEA 2R9CA 4CDCB 2DCAA 3LFYA 1PXVA 2YJ8A 1GECE 1GMYA 3N3GA 4N8WA 3OF9A 1XKGA 4QRVA 2DZZA 2YJ2A 4X6HA 7PCKA 1MDWA 4WA6A 1CV8A 5K16A 2BDLA 2YJBA 2B1NA 3KFQA 3ERVA 3WXGA 2OZ2A 1NB5A 3BC3A 2NQIA 1CTEA 2JQGR 4AXLA 1TL9A 4Q8HA 1CVZA 3HHAA 2F1GA 2AS8A 2DJGB 2CB5A 1AYWA 1CJLA 2FQ9A 3CBKA 2FO5A 3MTNA 2P7UA 3O1GA 4ZUXU 2R6NA 5CVMA 1U5IA 6PADA 2DC7A 5CHVA 1KFUL 2G6DA 3C9EA 4PP2E 2ACTA 1EWOA 2G8JA 3WXEA 2DCCA 3HWNA 1EWPA 3QSDA 3KKUA 5CVOB 2HD5A 3D6SA 2VHSA 3E1ZB 3K9MA 2AYOA 1SNKA 1PADA 3ZUAA 2FRQA 1PIPA 1YK8A 2GFOA 2HXZA 3H8CA 2DC8A 1U9XA 4N79A 4CZWA 3N4CA 1Y4HA 1EWLA 1VSNA 1AYVA 3OF8A 3BCNA 1MHWA 1KHPA 3V6CA 1BP4A 2NQDB 2O6XA 1EWMA 1DEUA 2PREA 3MHSA 3S3RA 2AUZA 2NQAA 1AIMA 2FUDA 2BDZA 2ATOA 4BSQA 5CHTA 1VJVA 1MS6A 3IEJA 1M6DA 3BOWA 4YYWA 2DCDA 1BQIA 3N3KA 2P86A 1U9WA 4I07A 1F29A 1QDQA 4FIPA 2XU1A 3I3TA 2ARYA 1F2BA 3H89A 2XU4A 1CPJA 2AUXA 2Y6EA 1PPOA 4FJCA 1GCBA 1NPZA 1KFXL 1YK7A 4BPVA 3H8BA 1X9YA 2XU5A 1KXRA 2AU1A 4MZOA 5J94A 2DC6A 3OVZA 4CDEB 3QT4A 2R9OA 1PPNA 4XUIA 2IPPB 4YV8A 2HH5A 4PP1A 4MZSA 5A24A 5EGWA 4BS6A 3M99A 2PNSA 3H7DA 1QOLA 3LXSA 3CH2X 3B79A 1DF0A 4G54A 3DF0A 2FTDA
chains in the Genus database with same CATH superfamily
1MEGA 3BPFA 2WBFX 4YYSA 2DZYA 1F2CA 1ZIVA 1O0EA 4YYRA 5FPWA 3PW3A 2J7QC 3O0UA 3TNXA 4DMXA 1MIRA 2DOSA 4PI3A 1FH0A 1MEMA 1A6RA 1NL6A 3PRMA 4X6JA 5EF4A 1PVJA 3F5VA 3PHUA 1AU3A 4I05A 1PE6A 4DMYA 4OVZA 3KWBX 1CSBB 4BQVA 3RVXA 2OULA 3K8UA 4XR7A 1SP4B 1K3BB 3BWKA 3S3QA 3IFUA 3P5XA 3USVA 3H6SA 4CDFB 3PBHA 4MM3B 2YJCA 1BY8A 2E00A 2H7JA 3HHIA 4KLBA 1NLJA 2R9NA 3PRPA 3PNRA 2BTWA 3QJ3A 3MTVA 2XU3A 1BGOA 2FT2A 1NQCA 2CIOA 2OP3A 3PHWA 2DCBA 3RVWA 1CS8A 1PCIA 4AXMA 1TLOA 1POPA 1AU2A 3NHEA 4OVZB 2AGAA 3BPMA 2NQGA 4X6IA 2P0RA 2DC9A 2HHNA 4QRXA 2VHFA 4P6EA 2R9MA 1STFE 1AU4A 4IUMA 3WXFA 4W5BA 1U9QX 5JH3A 4PT5A 1ICFA 4HWYA 4BOSA 4Q8GA 3CBJA 1U9VA 1THEA 2FRAA 1TU6A 1ZCMA 2GHUA 3PDFA 3HD3A 4K7CA 2G8EA 4BOPA 3MORA 3PHXA 3IV2A 2B1MA 1CB5A 1ME4A 1CQDA 1ME3A 3AI8A 2E02A 4FK5A 4W5CA 4N4ZA 4OELA 3CH3X 1AYUA 1IWDA 2G7YA 3P5WA 4CDDB 3U8EA 3I06A 2F7DA 5CVNB 3KW9A 2E01A 2E03A 3IMAA 3IHPA 3K24A 4YVAA 4XZXA 3GCBA 1NB3A 3O65A 1F2AA 1QXPA 4W4UA 4IP3A 1GLOA 2AVWA 4I04A 1YVBA 2Z84A 9PAPA 3KSEA 4P6GA 1HUCB 5KO3A 1AU0A 1QMYA 1Y08A 1AECA 1YALA 1JQPA 8PCHA 5JZEA 5JA7A 3F75A 1YT7A 3RVVA 1PPDA 3P5UA 3P5VA 3IUTA 4OEMA 2IBIA 4QRGA 3OISA 3TRKA 5F02A 3V6EA 1Q6KA 4P16A 1UKFA 2C0YA 1ATKA 2AYNA 2R9FA 5PADA 3OVXA 2JQFR 1PBHA 2DJFB 4MSXA 4QBBA 4YYVA 3C0RA 1KHQA 1EF7A 4PADA 2YJ9A 3MHHA 1ITOA 4QH6A 1PPPA 4RY2A 4YYQA 4BS5A 2UZJA 3KX1A 3ZNHA 2Y5BA 2PBHA 1S4VA 2PADA 4ZTBA 3KWZA 4YYUA 3IOQA 2AIMA 2FYEA 2R9CA 4CDCB 2DCAA 3LFYA 1PXVA 2YJ8A 1GECE 1GMYA 3N3GA 4N8WA 4RF1A 3OF9A 4D8BA 1XKGA 4QRVA 2DZZA 2YJ2A 4X6HA 7PCKA 1MDWA 4WA6A 1CV8A 5K16A 2HWKA 2BDLA 2YJBA 2B1NA 3KFQA 3ERVA 3WXGA 2OZ2A 3BBAA 1NB5A 2BU3A 3BC3A 2NQIA 1CTEA 3B21A 2JQGR 4AXLA 1TL9A 4Q8HA 1CVZA 3HHAA 2F1GA 2AS8A 2DJGB 2CB5A 4D8IA 1AYWA 1CJLA 3RNVA 2FQ9A 3MJ5A 4REZA 3CBKA 4BOQA 2FO5A 3MTNA 4RKXA 2P7UA 3O1GA 4ZUXU 2R6NA 5CVMA 1U5IA 6PADA 1YZBA 4MI7A 2DC7A 5CHVA 1KFUL 4M0WA 2G6DA 2JRIA 3C9EA 4PP2E 2ACTA 1EWOA 2G8JA 3WXEA 2DCCA 3HWNA 1EWPA 3QSDA 3KKUA 5CVOB 2HD5A 3D6SA 2VHSA 2JTCA 3E1ZB 3K9MA 3MP2A 2AYOA 1SNKA 4WURA 1PADA 3W30A 2FE8A 3ZUAA 2FRQA 1PIPA 4OW0A 1YK8A 5EZSA 3E9SA 2GFOA 2HXZA 3H8CA 4BOUA 2DC8A 1U9XA 4N79A 4CZWA 3N4CA 3BY4A 1Y4HA 1EWLA 1VSNA 4BOZA 1AYVA 3OF8A 3BCNA 1MHWA 1KHPA 3V6CA 1BP4A 2NQDB 2O6XA 4D8EA 1EWMA 1DEUA 2PREA 3MHSA 3S3RA 2AUZA 2NQAA 1AIMA 2FUDA 3PT2A 2BDZA 2ATOA 4BSQA 5CHTA 5EZQA 1VJVA 1MS6A 3IEJA 1M6DA 3BOWA 4YYWA 2DCDA 3W31A 1BQIA 3TMPA 3BB7A 3N3KA 4GUAA 2P86A 1U9WA 4I07A 1F29A 1QDQA 4R3DA 4HXDB 4FIPA 2XU1A 3I3TA 5E6JA 2ARYA 1F2BA 3OQCA 4RNAA 3H89A 2XU4A 1CPJA 2AUXA 2J7QA 2Y6EA 1PPOA 4FJCA 1DKIA 1GCBA 1NPZA 1KFXL 1YK7A 4BPVA 3H8BA 1X9YA 2XU5A 1KXRA 2AU1A 4MZOA 5J94A 2DC6A 3OVZA 2BTWB 4CDEB 3QT4A 2R9OA 1PPNA 4RF0A 4XUIA 2IPPB 4YV8A 2HH5A 4PP1A 4MZSA 5A24A 5EGWA 4BS6A 3M99A 2PNSA 3PSEA 3H7DA 1QOLA 3LXSA 3CH2X 3B79A 1DF0A 4G54A 3DF0A 4A5UA 2FTDA
chains in the Genus database with same CATH topology
1MEGA 3BPFA 2WBFX 4YYSA 2DZYA 1F2CA 1ZIVA 4GUZA 1O0EA 4YYRA 5FPWA 3PW3A 3O0UA 3TNXA 4DMXA 1MIRA 4PI3A 1FH0A 1MEMA 1A6RA 1W4TA 1NL6A 4X6JA 5EF4A 3F5VA 1AU3A 4I05A 1PE6A 4DMYA 3KWBX 1CSBB 4BQVA 3RVXA 2OULA 3K8UA 4XR7A 1SP4B 1K3BB 3BWKA 3S3QA 3P5XA 3USVA 3H6SA 4CDFB 3PBHA 2YJCA 1BY8A 2E00A 2H7JA 3HHIA 4KLBA 1NLJA 2R9NA 3PNRA 3QJ3A 2XU3A 1BGOA 2FT2A 1NQCA 2CIOA 2OP3A 2DCBA 3RVWA 1CS8A 1PCIA 4AXMA 1TLOA 1POPA 1AU2A 3NHEA 2BSZA 3BPMA 2NQGA 4X6IA 2P0RA 2DC9A 2HHNA 4QRXA 2VHFA 4P6EA 2R9MA 1STFE 1AU4A 3WXFA 4W5BA 1U9QX 5JH3A 1ICFA 4HWYA 4Q8GA 3CBJA 1U9VA 1THEA 2FRAA 1TU6A 1ZCMA 2GHUA 3PDFA 3HD3A 4K7CA 2G8EA 3MORA 3IV2A 2B1MA 1CB5A 1ME4A 1CQDA 1ME3A 3AI8A 2E02A 4FK5A 4W5CA 4N4ZA 4OELA 3CH3X 1AYUA 1IWDA 2G7YA 3P5WA 4CDDB 3U8EA 3I06A 2F7DA 5CVNB 3KW9A 2E01A 2E03A 3IMAA 3IHPA 3K24A 4YVAA 3GCBA 1NB3A 1F2AA 1QXPA 4W4UA 4B55A 1GLOA 2AVWA 1W5RA 4I04A 1YVBA 9PAPA 3KSEA 4P6GA 1HUCB 1AU0A 1QMYA 1Y08A 1AECA 1YALA 1JQPA 8PCHA 5JA7A 3F75A 1YT7A 3RVVA 1PPDA 3D9WA 3P5UA 3P5VA 3IUTA 4OEMA 2IBIA 4QRGA 3OISA 5F02A 3V6EA 1Q6KA 2C0YA 1ATKA 2AYNA 2R9FA 5PADA 4NV8A 3OVXA 2JQFR 1PBHA 2DJFB 4MSXA 4QBBA 4YYVA 1KHQA 4C5PA 1EF7A 4PADA 2YJ9A 3MHHA 1ITOA 4QH6A 1PPPA 4RY2A 4YYQA 4BS5A 3KX1A 2VFCA 2Y5BA 2PBHA 1S4VA 2PADA 3KWZA 4YYUA 3IOQA 2AIMA 2FYEA 2R9CA 4CDCB 2DCAA 3LFYA 1PXVA 2YJ8A 1GECE 1GMYA 3N3GA 4N8WA 3OF9A 1XKGA 4QRVA 2DZZA 2YJ2A 4X6HA 7PCKA 1MDWA 4WA6A 1CV8A 5K16A 2BDLA 2YJBA 2B1NA 3KFQA 3ERVA 3WXGA 2OZ2A 1NB5A 3BC3A 2NQIA 1CTEA 2JQGR 4AXLA 1TL9A 1W6FA 4Q8HA 1CVZA 3HHAA 2F1GA 2AS8A 2DJGB 2CB5A 1AYWA 1CJLA 2FQ9A 3LTWA 3CBKA 2FO5A 3MTNA 2P7UA 3O1GA 4BGFA 4ZUXU 2R6NA 5CVMA 1U5IA 6PADA 2DC7A 5CHVA 1KFUL 2G6DA 3C9EA 4PP2E 2ACTA 1EWOA 2G8JA 3WXEA 2DCCA 1GX3A 3HWNA 1EWPA 3QSDA 3KKUA 5CVOB 2HD5A 3D6SA 2VHSA 3E1ZB 3K9MA 2AYOA 1SNKA 1PADA 3ZUAA 2FRQA 1PIPA 1YK8A 2GFOA 2HXZA 3H8CA 2DC8A 1U9XA 4N79A 4CZWA 3N4CA 1Y4HA 1EWLA 1VSNA 1AYVA 3OF8A 3BCNA 1MHWA 1KHPA 3V6CA 1BP4A 2NQDB 2O6XA 1EWMA 1DEUA 2PREA 3MHSA 3S3RA 2AUZA 2NQAA 1AIMA 2FUDA 2BDZA 2ATOA 4BSQA 5CHTA 1VJVA 1MS6A 3IEJA 1M6DA 3BOWA 4YYWA 2DCDA 1BQIA 3N3KA 2P86A 1U9WA 4I07A 1F29A 1QDQA 4FIPA 1E2TA 2XU1A 3I3TA 2ARYA 1F2BA 3H89A 2XU4A 1CPJA 2AUXA 2Y6EA 1PPOA 4FJCA 1GCBA 1NPZA 1KFXL 1YK7A 4BPVA 3H8BA 1X9YA 2XU5A 1KXRA 2AU1A 4MZOA 5J94A 2DC6A 3OVZA 4CDEB 3QT4A 2R9OA 1PPNA 4XUIA 2IPPB 4YV8A 2HH5A 4PP1A 4MZSA 5A24A 5EGWA 4BS6A 3M99A 2PNSA 3H7DA 1QOLA 3LXSA 3CH2X 3B79A 2VFBA 4NV7A 1DF0A 4G54A 3DF0A 2FTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEG A;  3BPF A;  2WBF X;  4YYS A;  2DZY A;  1F2C A;  1ZIV A;  1O0E A;  4YYR A;  5FPW A;  3PW3 A;  3O0U A;  3TNX A;  4DMX A;  1MIR A;  4PI3 A;  1FH0 A;  1MEM A;  1A6R A;  1NL6 A;  4X6J A;  5EF4 A;  3F5V A;  1AU3 A;  4I05 A;  1PE6 A;  4DMY A;  3KWB X;  1CSB B;  4BQV A;  3RVX A;  2OUL A;  3K8U A;  4XR7 A;  1SP4 B;  1K3B B;  3BWK A;  3S3Q A;  3P5X A;  3USV A;  3H6S A;  4CDF B;  3PBH A;  2YJC A;  1BY8 A;  2E00 A;  2H7J A;  3HHI A;  4KLB A;  1NLJ A;  2R9N A;  3PNR A;  3QJ3 A;  2XU3 A;  1BGO A;  2FT2 A;  1NQC A;  2CIO A;  2OP3 A;  2DCB A;  3RVW A;  1CS8 A;  1PCI A;  4AXM A;  1TLO A;  1POP A;  1AU2 A;  3NHE A;  3BPM A;  2NQG A;  4X6I A;  2P0R A;  2DC9 A;  2HHN A;  4QRX A;  2VHF A;  4P6E A;  2R9M A;  1STF E;  1AU4 A;  3WXF A;  4W5B A;  1U9Q X;  5JH3 A;  1ICF A;  4HWY A;  4Q8G A;  3CBJ A;  1U9V A;  1THE A;  2FRA A;  1TU6 A;  1ZCM A;  2GHU A;  3PDF A;  3HD3 A;  4K7C A;  2G8E A;  3MOR A;  3IV2 A;  2B1M A;  1CB5 A;  1ME4 A;  1CQD A;  1ME3 A;  3AI8 A;  2E02 A;  4FK5 A;  4W5C A;  4N4Z A;  4OEL A;  3CH3 X;  1AYU A;  1IWD A;  2G7Y A;  3P5W A;  4CDD B;  3U8E A;  3I06 A;  2F7D A;  5CVN B;  3KW9 A;  2E01 A;  2E03 A;  3IMA A;  3IHP A;  3K24 A;  4YVA A;  3GCB A;  1NB3 A;  1F2A A;  1QXP A;  4W4U A;  1GLO A;  2AVW A;  4I04 A;  1YVB A;  9PAP A;  3KSE A;  4P6G A;  1HUC B;  1AU0 A;  1QMY A;  1Y08 A;  1AEC A;  1YAL A;  1JQP A;  8PCH A;  5JA7 A;  3F75 A;  1YT7 A;  3RVV A;  1PPD A;  3P5U A;  3P5V A;  3IUT A;  4OEM A;  2IBI A;  4QRG A;  3OIS A;  5F02 A;  3V6E A;  1Q6K A;  2C0Y A;  1ATK A;  2AYN A;  2R9F A;  5PAD A;  3OVX A;  2JQF R;  1PBH A;  2DJF B;  4MSX A;  4QBB A;  4YYV A;  1KHQ A;  1EF7 A;  4PAD A;  2YJ9 A;  3MHH A;  1ITO A;  4QH6 A;  1PPP A;  4RY2 A;  4YYQ A;  4BS5 A;  3KX1 A;  2Y5B A;  2PBH A;  1S4V A;  2PAD A;  3KWZ A;  4YYU A;  3IOQ A;  2AIM A;  2FYE A;  2R9C A;  4CDC B;  2DCA A;  3LFY A;  1PXV A;  2YJ8 A;  1GEC E;  1GMY A;  3N3G A;  4N8W A;  3OF9 A;  1XKG A;  4QRV A;  2DZZ A;  2YJ2 A;  4X6H A;  7PCK A;  1MDW A;  4WA6 A;  1CV8 A;  5K16 A;  2BDL A;  2YJB A;  2B1N A;  3KFQ A;  3ERV A;  3WXG A;  2OZ2 A;  1NB5 A;  3BC3 A;  2NQI A;  1CTE A;  2JQG R;  4AXL A;  1TL9 A;  4Q8H A;  1CVZ A;  3HHA A;  2F1G A;  2AS8 A;  2DJG B;  2CB5 A;  1AYW A;  1CJL A;  2FQ9 A;  3CBK A;  2FO5 A;  3MTN A;  2P7U A;  3O1G A;  4ZUX U;  2R6N A;  5CVM A;  1U5I A;  6PAD A;  2DC7 A;  5CHV A;  1KFU L;  2G6D A;  3C9E A;  4PP2 E;  2ACT A;  1EWO A;  2G8J A;  3WXE A;  2DCC A;  3HWN A;  1EWP A;  3QSD A;  3KKU A;  5CVO B;  2HD5 A;  3D6S A;  2VHS A;  3E1Z B;  3K9M A;  2AYO A;  1SNK A;  1PAD A;  3ZUA A;  2FRQ A;  1PIP A;  1YK8 A;  2GFO A;  2HXZ A;  3H8C A;  2DC8 A;  1U9X A;  4N79 A;  4CZW A;  3N4C A;  1Y4H A;  1EWL A;  1VSN A;  1AYV A;  3OF8 A;  3BCN A;  1MHW A;  1KHP A;  3V6C A;  1BP4 A;  2NQD B;  2O6X A;  1EWM A;  1DEU A;  2PRE A;  3MHS A;  3S3R A;  2AUZ A;  2NQA A;  1AIM A;  2FUD A;  2BDZ A;  2ATO A;  4BSQ A;  5CHT A;  1VJV A;  1MS6 A;  3IEJ A;  1M6D A;  3BOW A;  4YYW A;  2DCD A;  1BQI A;  3N3K A;  2P86 A;  1U9W A;  4I07 A;  1F29 A;  1QDQ A;  4FIP A;  2XU1 A;  3I3T A;  2ARY A;  1F2B A;  3H89 A;  2XU4 A;  1CPJ A;  2AUX A;  2Y6E A;  1PPO A;  4FJC A;  1GCB A;  1NPZ A;  1KFX L;  1YK7 A;  4BPV A;  3H8B A;  1X9Y A;  2XU5 A;  1KXR A;  2AU1 A;  4MZO A;  5J94 A;  2DC6 A;  3OVZ A;  4CDE B;  3QT4 A;  2R9O A;  1PPN A;  4XUI A;  2IPP B;  4YV8 A;  2HH5 A;  4PP1 A;  4MZS A;  5A24 A;  5EGW A;  4BS6 A;  3M99 A;  2PNS A;  3H7D A;  1QOL A;  3LXS A;  3CH2 X;  3B79 A;  1DF0 A;  4G54 A;  3DF0 A;  2FTD A; 
#chains in the Genus database with same CATH topology
 1MEG A;  3BPF A;  2WBF X;  4YYS A;  2DZY A;  1F2C A;  1ZIV A;  1O0E A;  4YYR A;  5FPW A;  3PW3 A;  2J7Q C;  3O0U A;  3TNX A;  4DMX A;  1MIR A;  2DOS A;  4PI3 A;  1FH0 A;  1MEM A;  1A6R A;  1NL6 A;  3PRM A;  4X6J A;  5EF4 A;  1PVJ A;  3F5V A;  3PHU A;  1AU3 A;  4I05 A;  1PE6 A;  4DMY A;  4OVZ A;  3KWB X;  1CSB B;  4BQV A;  3RVX A;  2OUL A;  3K8U A;  4XR7 A;  1SP4 B;  1K3B B;  3BWK A;  3S3Q A;  3IFU A;  3P5X A;  3USV A;  3H6S A;  4CDF B;  3PBH A;  4MM3 B;  2YJC A;  1BY8 A;  2E00 A;  2H7J A;  3HHI A;  4KLB A;  1NLJ A;  2R9N A;  3PRP A;  3PNR A;  2BTW A;  3QJ3 A;  3MTV A;  2XU3 A;  1BGO A;  2FT2 A;  1NQC A;  2CIO A;  2OP3 A;  3PHW A;  2DCB A;  3RVW A;  1CS8 A;  1PCI A;  4AXM A;  1TLO A;  1POP A;  1AU2 A;  3NHE A;  4OVZ B;  2AGA A;  3BPM A;  2NQG A;  4X6I A;  2P0R A;  2DC9 A;  2HHN A;  4QRX A;  2VHF A;  4P6E A;  2R9M A;  1STF E;  1AU4 A;  4IUM A;  3WXF A;  4W5B A;  1U9Q X;  5JH3 A;  4PT5 A;  1ICF A;  4HWY A;  4BOS A;  4Q8G A;  3CBJ A;  1U9V A;  1THE A;  2FRA A;  1TU6 A;  1ZCM A;  2GHU A;  3PDF A;  3HD3 A;  4K7C A;  2G8E A;  4BOP A;  3MOR A;  3PHX A;  3IV2 A;  2B1M A;  1CB5 A;  1ME4 A;  1CQD A;  1ME3 A;  3AI8 A;  2E02 A;  4FK5 A;  4W5C A;  4N4Z A;  4OEL A;  3CH3 X;  1AYU A;  1IWD A;  2G7Y A;  3P5W A;  4CDD B;  3U8E A;  3I06 A;  2F7D A;  5CVN B;  3KW9 A;  2E01 A;  2E03 A;  3IMA A;  3IHP A;  3K24 A;  4YVA A;  4XZX A;  3GCB A;  1NB3 A;  3O65 A;  1F2A A;  1QXP A;  4W4U A;  4IP3 A;  1GLO A;  2AVW A;  4I04 A;  1YVB A;  2Z84 A;  9PAP A;  3KSE A;  4P6G A;  1HUC B;  5KO3 A;  1AU0 A;  1QMY A;  1Y08 A;  1AEC A;  1YAL A;  1JQP A;  8PCH A;  5JZE A;  5JA7 A;  3F75 A;  1YT7 A;  3RVV A;  1PPD A;  3P5U A;  3P5V A;  3IUT A;  4OEM A;  2IBI A;  4QRG A;  3OIS A;  3TRK A;  5F02 A;  3V6E A;  1Q6K A;  4P16 A;  1UKF A;  2C0Y A;  1ATK A;  2AYN A;  2R9F A;  5PAD A;  3OVX A;  2JQF R;  1PBH A;  2DJF B;  4MSX A;  4QBB A;  4YYV A;  3C0R A;  1KHQ A;  1EF7 A;  4PAD A;  2YJ9 A;  3MHH A;  1ITO A;  4QH6 A;  1PPP A;  4RY2 A;  4YYQ A;  4BS5 A;  2UZJ A;  3KX1 A;  3ZNH A;  2Y5B A;  2PBH A;  1S4V A;  2PAD A;  4ZTB A;  3KWZ A;  4YYU A;  3IOQ A;  2AIM A;  2FYE A;  2R9C A;  4CDC B;  2DCA A;  3LFY A;  1PXV A;  2YJ8 A;  1GEC E;  1GMY A;  3N3G A;  4N8W A;  4RF1 A;  3OF9 A;  4D8B A;  1XKG A;  4QRV A;  2DZZ A;  2YJ2 A;  4X6H A;  7PCK A;  1MDW A;  4WA6 A;  1CV8 A;  5K16 A;  2HWK A;  2BDL A;  2YJB A;  2B1N A;  3KFQ A;  3ERV A;  3WXG A;  2OZ2 A;  3BBA A;  1NB5 A;  2BU3 A;  3BC3 A;  2NQI A;  1CTE A;  3B21 A;  2JQG R;  4AXL A;  1TL9 A;  4Q8H A;  1CVZ A;  3HHA A;  2F1G A;  2AS8 A;  2DJG B;  2CB5 A;  4D8I A;  1AYW A;  1CJL A;  3RNV A;  2FQ9 A;  3MJ5 A;  4REZ A;  3CBK A;  4BOQ A;  2FO5 A;  3MTN A;  4RKX A;  2P7U A;  3O1G A;  4ZUX U;  2R6N A;  5CVM A;  1U5I A;  6PAD A;  1YZB A;  4MI7 A;  2DC7 A;  5CHV A;  1KFU L;  4M0W A;  2G6D A;  2JRI A;  3C9E A;  4PP2 E;  2ACT A;  1EWO A;  2G8J A;  3WXE A;  2DCC A;  3HWN A;  1EWP A;  3QSD A;  3KKU A;  5CVO B;  2HD5 A;  3D6S A;  2VHS A;  2JTC A;  3E1Z B;  3K9M A;  3MP2 A;  2AYO A;  1SNK A;  4WUR A;  1PAD A;  3W30 A;  2FE8 A;  3ZUA A;  2FRQ A;  1PIP A;  4OW0 A;  1YK8 A;  5EZS A;  3E9S A;  2GFO A;  2HXZ A;  3H8C A;  4BOU A;  2DC8 A;  1U9X A;  4N79 A;  4CZW A;  3N4C A;  3BY4 A;  1Y4H A;  1EWL A;  1VSN A;  4BOZ A;  1AYV A;  3OF8 A;  3BCN A;  1MHW A;  1KHP A;  3V6C A;  1BP4 A;  2NQD B;  2O6X A;  4D8E A;  1EWM A;  1DEU A;  2PRE A;  3MHS A;  3S3R A;  2AUZ A;  2NQA A;  1AIM A;  2FUD A;  3PT2 A;  2BDZ A;  2ATO A;  4BSQ A;  5CHT A;  5EZQ A;  1VJV A;  1MS6 A;  3IEJ A;  1M6D A;  3BOW A;  4YYW A;  2DCD A;  3W31 A;  1BQI A;  3TMP A;  3BB7 A;  3N3K A;  4GUA A;  2P86 A;  1U9W A;  4I07 A;  1F29 A;  1QDQ A;  4R3D A;  4HXD B;  4FIP A;  2XU1 A;  3I3T A;  5E6J A;  2ARY A;  1F2B A;  3OQC A;  4RNA A;  3H89 A;  2XU4 A;  1CPJ A;  2AUX A;  2J7Q A;  2Y6E A;  1PPO A;  4FJC A;  1DKI A;  1GCB A;  1NPZ A;  1KFX L;  1YK7 A;  4BPV A;  3H8B A;  1X9Y A;  2XU5 A;  1KXR A;  2AU1 A;  4MZO A;  5J94 A;  2DC6 A;  3OVZ A;  2BTW B;  4CDE B;  3QT4 A;  2R9O A;  1PPN A;  4RF0 A;  4XUI A;  2IPP B;  4YV8 A;  2HH5 A;  4PP1 A;  4MZS A;  5A24 A;  5EGW A;  4BS6 A;  3M99 A;  2PNS A;  3PSE A;  3H7D A;  1QOL A;  3LXS A;  3CH2 X;  3B79 A;  1DF0 A;  4G54 A;  3DF0 A;  4A5U A;  2FTD A; 
#chains in the Genus database with same CATH homology
 1MEG A;  3BPF A;  2WBF X;  4YYS A;  2DZY A;  1F2C A;  1ZIV A;  4GUZ A;  1O0E A;  4YYR A;  5FPW A;  3PW3 A;  3O0U A;  3TNX A;  4DMX A;  1MIR A;  4PI3 A;  1FH0 A;  1MEM A;  1A6R A;  1W4T A;  1NL6 A;  4X6J A;  5EF4 A;  3F5V A;  1AU3 A;  4I05 A;  1PE6 A;  4DMY A;  3KWB X;  1CSB B;  4BQV A;  3RVX A;  2OUL A;  3K8U A;  4XR7 A;  1SP4 B;  1K3B B;  3BWK A;  3S3Q A;  3P5X A;  3USV A;  3H6S A;  4CDF B;  3PBH A;  2YJC A;  1BY8 A;  2E00 A;  2H7J A;  3HHI A;  4KLB A;  1NLJ A;  2R9N A;  3PNR A;  3QJ3 A;  2XU3 A;  1BGO A;  2FT2 A;  1NQC A;  2CIO A;  2OP3 A;  2DCB A;  3RVW A;  1CS8 A;  1PCI A;  4AXM A;  1TLO A;  1POP A;  1AU2 A;  3NHE A;  2BSZ A;  3BPM A;  2NQG A;  4X6I A;  2P0R A;  2DC9 A;  2HHN A;  4QRX A;  2VHF A;  4P6E A;  2R9M A;  1STF E;  1AU4 A;  3WXF A;  4W5B A;  1U9Q X;  5JH3 A;  1ICF A;  4HWY A;  4Q8G A;  3CBJ A;  1U9V A;  1THE A;  2FRA A;  1TU6 A;  1ZCM A;  2GHU A;  3PDF A;  3HD3 A;  4K7C A;  2G8E A;  3MOR A;  3IV2 A;  2B1M A;  1CB5 A;  1ME4 A;  1CQD A;  1ME3 A;  3AI8 A;  2E02 A;  4FK5 A;  4W5C A;  4N4Z A;  4OEL A;  3CH3 X;  1AYU A;  1IWD A;  2G7Y A;  3P5W A;  4CDD B;  3U8E A;  3I06 A;  2F7D A;  5CVN B;  3KW9 A;  2E01 A;  2E03 A;  3IMA A;  3IHP A;  3K24 A;  4YVA A;  3GCB A;  1NB3 A;  1F2A A;  1QXP A;  4W4U A;  4B55 A;  1GLO A;  2AVW A;  1W5R A;  4I04 A;  1YVB A;  9PAP A;  3KSE A;  4P6G A;  1HUC B;  1AU0 A;  1QMY A;  1Y08 A;  1AEC A;  1YAL A;  1JQP A;  8PCH A;  5JA7 A;  3F75 A;  1YT7 A;  3RVV A;  1PPD A;  3D9W A;  3P5U A;  3P5V A;  3IUT A;  4OEM A;  2IBI A;  4QRG A;  3OIS A;  5F02 A;  3V6E A;  1Q6K A;  2C0Y A;  1ATK A;  2AYN A;  2R9F A;  5PAD A;  4NV8 A;  3OVX A;  2JQF R;  1PBH A;  2DJF B;  4MSX A;  4QBB A;  4YYV A;  1KHQ A;  4C5P A;  1EF7 A;  4PAD A;  2YJ9 A;  3MHH A;  1ITO A;  4QH6 A;  1PPP A;  4RY2 A;  4YYQ A;  4BS5 A;  3KX1 A;  2VFC A;  2Y5B A;  2PBH A;  1S4V A;  2PAD A;  3KWZ A;  4YYU A;  3IOQ A;  2AIM A;  2FYE A;  2R9C A;  4CDC B;  2DCA A;  3LFY A;  1PXV A;  2YJ8 A;  1GEC E;  1GMY A;  3N3G A;  4N8W A;  3OF9 A;  1XKG A;  4QRV A;  2DZZ A;  2YJ2 A;  4X6H A;  7PCK A;  1MDW A;  4WA6 A;  1CV8 A;  5K16 A;  2BDL A;  2YJB A;  2B1N A;  3KFQ A;  3ERV A;  3WXG A;  2OZ2 A;  1NB5 A;  3BC3 A;  2NQI A;  1CTE A;  2JQG R;  4AXL A;  1TL9 A;  1W6F A;  4Q8H A;  1CVZ A;  3HHA A;  2F1G A;  2AS8 A;  2DJG B;  2CB5 A;  1AYW A;  1CJL A;  2FQ9 A;  3LTW A;  3CBK A;  2FO5 A;  3MTN A;  2P7U A;  3O1G A;  4BGF A;  4ZUX U;  2R6N A;  5CVM A;  1U5I A;  6PAD A;  2DC7 A;  5CHV A;  1KFU L;  2G6D A;  3C9E A;  4PP2 E;  2ACT A;  1EWO A;  2G8J A;  3WXE A;  2DCC A;  1GX3 A;  3HWN A;  1EWP A;  3QSD A;  3KKU A;  5CVO B;  2HD5 A;  3D6S A;  2VHS A;  3E1Z B;  3K9M A;  2AYO A;  1SNK A;  1PAD A;  3ZUA A;  2FRQ A;  1PIP A;  1YK8 A;  2GFO A;  2HXZ A;  3H8C A;  2DC8 A;  1U9X A;  4N79 A;  4CZW A;  3N4C A;  1Y4H A;  1EWL A;  1VSN A;  1AYV A;  3OF8 A;  3BCN A;  1MHW A;  1KHP A;  3V6C A;  1BP4 A;  2NQD B;  2O6X A;  1EWM A;  1DEU A;  2PRE A;  3MHS A;  3S3R A;  2AUZ A;  2NQA A;  1AIM A;  2FUD A;  2BDZ A;  2ATO A;  4BSQ A;  5CHT A;  1VJV A;  1MS6 A;  3IEJ A;  1M6D A;  3BOW A;  4YYW A;  2DCD A;  1BQI A;  3N3K A;  2P86 A;  1U9W A;  4I07 A;  1F29 A;  1QDQ A;  4FIP A;  1E2T A;  2XU1 A;  3I3T A;  2ARY A;  1F2B A;  3H89 A;  2XU4 A;  1CPJ A;  2AUX A;  2Y6E A;  1PPO A;  4FJC A;  1GCB A;  1NPZ A;  1KFX L;  1YK7 A;  4BPV A;  3H8B A;  1X9Y A;  2XU5 A;  1KXR A;  2AU1 A;  4MZO A;  5J94 A;  2DC6 A;  3OVZ A;  4CDE B;  3QT4 A;  2R9O A;  1PPN A;  4XUI A;  2IPP B;  4YV8 A;  2HH5 A;  4PP1 A;  4MZS A;  5A24 A;  5EGW A;  4BS6 A;  3M99 A;  2PNS A;  3H7D A;  1QOL A;  3LXS A;  3CH2 X;  3B79 A;  2VFB A;  4NV7 A;  1DF0 A;  4G54 A;  3DF0 A;  2FTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...