2PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPAIN
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2padA00
4W5BA 4KLBA 4QH6A 3I06A 7PCKA 4X6IA 2NQDB 3PNRA 1S4VA 2G8EA 3P5VA 3WXFA 4X6JA 2OZ2A 2FYEA 1EF7A 1Y4HA 2PNSA 4AXLA 2R9OA 3KWZA 2R6NA 5A24A 1A6RA 2E00A 4P6GA 1YK8A 2AUZA 3H89A 2FUDA 3I3TA 1THEA 3O0UA 1Y08A 3N4CA 5JA7A 1IWDA 4YYVA 4K7CA 1CTEA 3RVXA 2R9CA 2FQ9A 3PDFA 9PAPA 2Y5BA 2YJBA 4AXMA 1GCBA 1VSNA 1CVZA 2ATOA 1CSBB 2DCCA 3OF8A 5PADA 3KW9A 3U8EA 5K16A 2E02A 3OVXA 3H6SA 3P5XA 4BPVA 3BWKA 1M6DA 3HHAA 1CQDA 3BCNA 3CBKA 4HWYA 3B79A 1CV8A 1TU6A 3HHIA 3MHHA 3H7DA 4BSQA 2AIMA 1ZCMA 3IEJA 1YT7A 4N8WA 5FPWA 2AS8A 5EF4A 3OF9A 4CDEB 4G54A 4QRVA 3GCBA 2PBHA 3F75A 5EGWA 2C0YA 2O6XA 2AYOA 3HD3A 1CPJA 1FH0A 5CVMA 1PADA 3H8CA 2YJCA 4YYUA 3CBJA 4CDCB 2F1GA 4WA6A 4BQVA 4I04A 3USVA 1PIPA 3ZUAA 3BOWA 2F7DA 1MS6A 1F29A 2AUXA 3QJ3A 2R9FA 1PPPA 4Q8HA 1VJVA 2ACTA 4BS6A 2DC6A 1F2CA 4MZSA 1TL9A 2NQAA 2IBIA 4CZWA 2NQIA 3BPFA 3KWBX 1KHPA 3CH2X 4CDFB 4PADA 2B1NA 2DCBA 3CH3X 2B1MA 1F2BA 1BY8A 3V6CA 1EWPA 1K3BB 3PW3A 4QBBA 2WBFX 2XU3A 2HXZA 2DC8A 5CHTA 1PPNA 3F5VA 1F2AA 5JH3A 1GMYA 4FK5A 1SNKA 4QRGA 2DZZA 5CVNB 4YYRA 5J94A 4DMYA 1U9VA 3KFQA 1MEGA 3C9EA 3IHPA 2Y6EA 2XU1A 1AU2A 1KXRA 3WXGA 4PI3A 1TLOA 1KFUL 1GLOA 2DC7A 1AU0A 2JQFR 1MEMA 2FT2A 1ITOA 3HWNA 3OVZA 1ME3A 4QRXA 1AYUA 4MZOA 3D6SA 2DC9A 3E1ZB 1GECE 2CB5A 4OEMA 4N4ZA 1MIRA 3TNXA 1MHWA 1AECA 3MTNA 4YYQA 4CDDB 2OULA 1AU4A 2HD5A 2P86A 2G7YA 3IUTA 3MHSA 3RVWA 4YVAA 3MORA 1X9YA 4PP1A 5F02A 3PBHA 1DEUA 3K24A 3M99A 1EWOA 2HH5A 2FTDA 1NQCA 3IV2A 4YYSA 3P5UA 1ZIVA 3K9MA 2DJGB 1ICFA 3OISA 1KHQA 3QT4A 3ERVA 1CB5A 4BS5A 2DZYA 2YJ2A 2DCAA 1JQPA 1U9QX 2HHNA 2JQGR 4DMXA 2OP3A 2GFOA 4OELA 1HUCB 4X6HA 1AU3A 1CS8A 2XU5A 2PREA 2AU1A 3H8BA 1PBHA 2PADA 1AIMA 1CJLA 1STFE 3O1GA 4W5CA 2R9MA 5CVOB 2FRAA 2R9NA 2H7JA 4XUIA 1O0EA 1POPA 3LFYA 1ATKA 5CHVA 3AI8A 3KKUA 1QOLA 3KSEA 2BDZA 1U5IA 2YJ8A 4RY2A 4PP2E 3KX1A 4P6EA 1AYWA 1KFXL 2NQGA 1QXPA 1MDWA 1NLJA 3N3KA 3WXEA 3K8UA 2P7UA 4I05A 4W4UA 1PCIA 4FIPA 3LXSA 1BP4A 2GHUA 2E03A 2CIOA 8PCHA 6PADA 2IPPB 3S3QA 2BDLA 3DF0A 3S3RA 1PXVA 2DCDA 2G8JA 2AYNA 3P5WA 4I07A 1YVBA 1DF0A 4YV8A 1BQIA 3QSDA 1YK7A 2XU4A 1PPDA 3BPMA 3IMAA 2G6DA 2ARYA 1SP4B 1PE6A 2E01A 1NPZA 2FO5A 4Q8GA 4YYWA 1U9WA 1NB3A 1AYVA 2DJFB 2FRQA 3IOQA 1BGOA 2VHSA 2YJ9A 1YALA 4FJCA 1NB5A 4ZUXU 1ME4A 3N3GA 4N79A 2AVWA 4MSXA 1QMYA 1NL6A 1PPOA 1Q6KA 2P0RA 1EWMA 2VHFA 4XR7A 3V6EA 1XKGA 3BC3A 1QDQA 3NHEA 1U9XA 1EWLA 3RVVA
chains in the Genus database with same CATH superfamily
4W5BA 3PSEA 4KLBA 4QH6A 2UZJA 3I06A 7PCKA 4X6IA 2NQDB 3PNRA 1S4VA 2G8EA 3P5VA 3WXFA 4PT5A 4X6JA 2OZ2A 4D8IA 2FYEA 1DKIA 1EF7A 1Y4HA 2PNSA 4AXLA 2R9OA 3KWZA 2R6NA 5A24A 1A6RA 2E00A 4P6GA 1YK8A 2AUZA 3H89A 2FUDA 3I3TA 1THEA 2J7QC 3O0UA 1Y08A 3N4CA 5JA7A 1IWDA 3PHUA 4YYVA 4K7CA 3RNVA 1YZBA 3IFUA 1CTEA 3RVXA 2R9CA 5KO3A 2FQ9A 3PDFA 9PAPA 2Y5BA 2YJBA 4AXMA 4D8EA 1GCBA 1VSNA 1CVZA 2ATOA 4WURA 1CSBB 2DCCA 3OF8A 5PADA 3KW9A 3U8EA 5K16A 2E02A 3OVXA 3H6SA 4OVZB 3P5XA 4BPVA 3BWKA 1M6DA 3HHAA 1CQDA 3BCNA 3CBKA 4HWYA 3B79A 4MM3B 1CV8A 4GUAA 1TU6A 3HHIA 3MHHA 3H7DA 4BSQA 2AIMA 1ZCMA 3IEJA 1YT7A 4N8WA 5FPWA 2AS8A 5EF4A 2BTWA 3OF9A 4CDEB 4G54A 4QRVA 3GCBA 2PBHA 3F75A 5EGWA 2C0YA 2O6XA 2AYOA 3MP2A 3HD3A 1CPJA 4HXDB 1FH0A 5CVMA 1PADA 3H8CA 2YJCA 4D8BA 4YYUA 3CBJA 4BOUA 4CDCB 4RKXA 2F1GA 4RF0A 4WA6A 1PVJA 4BQVA 4I04A 3USVA 1PIPA 3ZUAA 3BOWA 2F7DA 1MS6A 1F29A 2AUXA 3QJ3A 2R9FA 1PPPA 4Q8HA 1VJVA 2ACTA 4BS6A 2DC6A 1F2CA 4BOSA 4MZSA 1TL9A 2NQAA 2IBIA 2Z84A 3BB7A 4CZWA 2NQIA 3BY4A 3BPFA 3KWBX 1KHPA 3CH2X 4CDFB 4PADA 2B1NA 3MJ5A 2DCBA 3CH3X 2B1MA 1F2BA 1BY8A 3V6CA 1EWPA 1K3BB 3PW3A 4QBBA 4BOPA 3BBAA 2WBFX 3W30A 2XU3A 2HXZA 3E9SA 2DC8A 5CHTA 1PPNA 3F5VA 1F2AA 4RF1A 5JH3A 1GMYA 4FK5A 1SNKA 4QRGA 2DZZA 5CVNB 4YYRA 5J94A 4IP3A 4DMYA 1U9VA 3KFQA 1MEGA 3C9EA 3IHPA 2Y6EA 2XU1A 1AU2A 1KXRA 3WXGA 4PI3A 1TLOA 1KFUL 3OQCA 1GLOA 2DC7A 3PRPA 1AU0A 2JQFR 4A5UA 1MEMA 2FT2A 1ITOA 3HWNA 3OVZA 1ME3A 4XZXA 4QRXA 1AYUA 4MZOA 3TMPA 3D6SA 2DC9A 3E1ZB 5EZSA 1GECE 2CB5A 4OEMA 4BOZA 4N4ZA 1MIRA 5E6JA 3TNXA 1MHWA 3B21A 1AECA 3MTNA 4YYQA 4CDDB 2OULA 1AU4A 2HD5A 2P86A 2G7YA 3IUTA 3MHSA 3RVWA 4YVAA 3MORA 1X9YA 4PP1A 5JZEA 5F02A 3PBHA 1DEUA 3K24A 3M99A 1EWOA 2HH5A 2FTDA 1NQCA 3IV2A 4YYSA 3P5UA 3PHXA 1ZIVA 3K9MA 4P16A 2DJGB 1ICFA 3OISA 1KHQA 2FE8A 3QT4A 3ERVA 1CB5A 4BS5A 2DZYA 2YJ2A 2DCAA 4OW0A 1JQPA 1U9QX 2HHNA 2JQGR 4DMXA 2J7QA 2OP3A 2GFOA 4OELA 1HUCB 4X6HA 1AU3A 2DOSA 1CS8A 2XU5A 2PREA 2AU1A 4OVZA 3H8BA 3TRKA 1PBHA 2PADA 1AIMA 1CJLA 1STFE 3O1GA 4W5CA 2R9MA 5CVOB 2FRAA 2JTCA 2HWKA 2R9NA 2H7JA 4RNAA 4XUIA 1O0EA 1POPA 3LFYA 1ATKA 5CHVA 3AI8A 4BOQA 4M0WA 2BTWB 5EZQA 3PT2A 3KKUA 1QOLA 3KSEA 2AGAA 2BDZA 1U5IA 2YJ8A 2BU3A 4RY2A 3PHWA 4ZTBA 4PP2E 3KX1A 3C0RA 4P6EA 1AYWA 1KFXL 2NQGA 1QXPA 1MDWA 4R3DA 1NLJA 3N3KA 3ZNHA 3WXEA 3K8UA 2P7UA 4I05A 4W4UA 1PCIA 4FIPA 3LXSA 1BP4A 2GHUA 2E03A 2CIOA 8PCHA 6PADA 2IPPB 3S3QA 2BDLA 3MTVA 3PRMA 3DF0A 3S3RA 1PXVA 2DCDA 2G8JA 2AYNA 3P5WA 4I07A 1YVBA 1DF0A 2JRIA 1BQIA 3W31A 4YV8A 3QSDA 1YK7A 2XU4A 1PPDA 4MI7A 3BPMA 3IMAA 4IUMA 2G6DA 2ARYA 1SP4B 1PE6A 2E01A 1NPZA 2FO5A 4Q8GA 4REZA 4YYWA 1U9WA 1NB3A 1AYVA 2DJFB 2FRQA 3IOQA 1BGOA 2VHSA 2YJ9A 1YALA 4FJCA 1NB5A 4ZUXU 1ME4A 3N3GA 4N79A 2AVWA 4MSXA 1QMYA 1NL6A 1PPOA 1Q6KA 2P0RA 1EWMA 2VHFA 4XR7A 3O65A 3V6EA 1XKGA 3BC3A 1QDQA 1UKFA 3NHEA 1U9XA 1EWLA 3RVVA
chains in the Genus database with same CATH topology
4W5BA 4KLBA 4QH6A 1W4TA 3I06A 7PCKA 4X6IA 2NQDB 3PNRA 1S4VA 2G8EA 3P5VA 3WXFA 4X6JA 2OZ2A 2FYEA 1EF7A 1Y4HA 2PNSA 4AXLA 2R9OA 3KWZA 2R6NA 5A24A 1A6RA 2E00A 4P6GA 1YK8A 2AUZA 3H89A 2FUDA 3I3TA 1THEA 3O0UA 1Y08A 3N4CA 4GUZA 5JA7A 1IWDA 4YYVA 4K7CA 1CTEA 3RVXA 2R9CA 2FQ9A 3PDFA 9PAPA 2Y5BA 2YJBA 4AXMA 1GCBA 1VSNA 1CVZA 2ATOA 1CSBB 2DCCA 3OF8A 4NV8A 3KW9A 5PADA 3U8EA 5K16A 2E02A 3OVXA 1E2TA 3H6SA 1GX3A 3P5XA 4BPVA 3BWKA 1M6DA 3HHAA 1CQDA 3BCNA 1W6FA 3CBKA 4HWYA 3B79A 1CV8A 1TU6A 3HHIA 3MHHA 3H7DA 4BSQA 2AIMA 1ZCMA 3IEJA 1YT7A 4N8WA 5FPWA 2AS8A 5EF4A 3OF9A 4CDEB 4G54A 4QRVA 3GCBA 2PBHA 3F75A 5EGWA 2C0YA 2O6XA 2AYOA 3HD3A 1CPJA 1FH0A 5CVMA 1PADA 3H8CA 2YJCA 4YYUA 3LTWA 3CBJA 4CDCB 2F1GA 4WA6A 4BQVA 4I04A 3USVA 1PIPA 3ZUAA 3BOWA 2F7DA 1MS6A 1F29A 2AUXA 3QJ3A 2R9FA 1PPPA 4Q8HA 1VJVA 2ACTA 4BS6A 2DC6A 1F2CA 1W5RA 4MZSA 1TL9A 2NQAA 2IBIA 4CZWA 2NQIA 3BPFA 3KWBX 1KHPA 3CH2X 4CDFB 4PADA 2B1NA 2DCBA 3CH3X 2B1MA 1F2BA 1BY8A 3V6CA 1EWPA 1K3BB 3PW3A 4QBBA 2WBFX 2XU3A 2HXZA 2DC8A 5CHTA 1PPNA 3F5VA 1F2AA 5JH3A 1GMYA 4FK5A 1SNKA 4QRGA 2DZZA 5CVNB 3D9WA 5J94A 4YYRA 4DMYA 1U9VA 3KFQA 1MEGA 3C9EA 3IHPA 2Y6EA 2XU1A 1AU2A 1KXRA 3WXGA 4PI3A 1TLOA 1KFUL 1GLOA 2DC7A 1AU0A 2JQFR 1MEMA 2FT2A 1ITOA 3HWNA 3OVZA 1ME3A 4QRXA 1AYUA 4MZOA 3D6SA 2DC9A 3E1ZB 1GECE 2CB5A 4OEMA 4N4ZA 1MIRA 3TNXA 1MHWA 1AECA 3MTNA 4YYQA 4CDDB 2OULA 1AU4A 2HD5A 2P86A 2G7YA 3IUTA 3MHSA 3RVWA 4YVAA 3MORA 1X9YA 4PP1A 5F02A 3PBHA 1DEUA 3K24A 3M99A 1EWOA 2HH5A 2FTDA 1NQCA 3IV2A 4YYSA 3P5UA 1ZIVA 3K9MA 2DJGB 1ICFA 3OISA 1KHQA 3QT4A 3ERVA 1CB5A 4BS5A 2DZYA 2YJ2A 2DCAA 1JQPA 1U9QX 2HHNA 2JQGR 4DMXA 2OP3A 2GFOA 4OELA 1HUCB 4X6HA 1AU3A 1CS8A 2XU5A 2PREA 2AU1A 3H8BA 1PBHA 2PADA 1AIMA 4NV7A 1CJLA 1STFE 3O1GA 4W5CA 2R9MA 5CVOB 2FRAA 2R9NA 4C5PA 2H7JA 4XUIA 1O0EA 1POPA 3LFYA 1ATKA 5CHVA 3AI8A 4BGFA 3KKUA 1QOLA 3KSEA 2BDZA 1U5IA 2YJ8A 4RY2A 4PP2E 3KX1A 4P6EA 1AYWA 1KFXL 2NQGA 1QXPA 1MDWA 1NLJA 3N3KA 3WXEA 3K8UA 2P7UA 4I05A 4W4UA 1PCIA 4FIPA 3LXSA 1BP4A 2GHUA 2E03A 2CIOA 8PCHA 6PADA 2IPPB 3S3QA 2BDLA 3DF0A 3S3RA 1PXVA 2DCDA 2G8JA 2VFBA 2AYNA 3P5WA 4I07A 1YVBA 1DF0A 4YV8A 1BQIA 3QSDA 1YK7A 2XU4A 1PPDA 2BSZA 3BPMA 3IMAA 2G6DA 2ARYA 1SP4B 1PE6A 2E01A 1NPZA 2FO5A 4Q8GA 2VFCA 4YYWA 1U9WA 1NB3A 1AYVA 2DJFB 2FRQA 3IOQA 1BGOA 2VHSA 2YJ9A 1YALA 4FJCA 1NB5A 4ZUXU 1ME4A 3N3GA 4N79A 2AVWA 4MSXA 1QMYA 1NL6A 1PPOA 1Q6KA 2P0RA 1EWMA 2VHFA 4XR7A 4B55A 3V6EA 1XKGA 3BC3A 1QDQA 3NHEA 1U9XA 1EWLA 3RVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5B A;  4KLB A;  4QH6 A;  3I06 A;  7PCK A;  4X6I A;  2NQD B;  3PNR A;  1S4V A;  2G8E A;  3P5V A;  3WXF A;  4X6J A;  2OZ2 A;  2FYE A;  1EF7 A;  1Y4H A;  2PNS A;  4AXL A;  2R9O A;  3KWZ A;  2R6N A;  5A24 A;  1A6R A;  2E00 A;  4P6G A;  1YK8 A;  2AUZ A;  3H89 A;  2FUD A;  3I3T A;  1THE A;  3O0U A;  1Y08 A;  3N4C A;  5JA7 A;  1IWD A;  4YYV A;  4K7C A;  1CTE A;  3RVX A;  2R9C A;  2FQ9 A;  3PDF A;  9PAP A;  2Y5B A;  2YJB A;  4AXM A;  1GCB A;  1VSN A;  1CVZ A;  2ATO A;  1CSB B;  2DCC A;  3OF8 A;  5PAD A;  3KW9 A;  3U8E A;  5K16 A;  2E02 A;  3OVX A;  3H6S A;  3P5X A;  4BPV A;  3BWK A;  1M6D A;  3HHA A;  1CQD A;  3BCN A;  3CBK A;  4HWY A;  3B79 A;  1CV8 A;  1TU6 A;  3HHI A;  3MHH A;  3H7D A;  4BSQ A;  2AIM A;  1ZCM A;  3IEJ A;  1YT7 A;  4N8W A;  5FPW A;  2AS8 A;  5EF4 A;  3OF9 A;  4CDE B;  4G54 A;  4QRV A;  3GCB A;  2PBH A;  3F75 A;  5EGW A;  2C0Y A;  2O6X A;  2AYO A;  3HD3 A;  1CPJ A;  1FH0 A;  5CVM A;  1PAD A;  3H8C A;  2YJC A;  4YYU A;  3CBJ A;  4CDC B;  2F1G A;  4WA6 A;  4BQV A;  4I04 A;  3USV A;  1PIP A;  3ZUA A;  3BOW A;  2F7D A;  1MS6 A;  1F29 A;  2AUX A;  3QJ3 A;  2R9F A;  1PPP A;  4Q8H A;  1VJV A;  2ACT A;  4BS6 A;  2DC6 A;  1F2C A;  4MZS A;  1TL9 A;  2NQA A;  2IBI A;  4CZW A;  2NQI A;  3BPF A;  3KWB X;  1KHP A;  3CH2 X;  4CDF B;  4PAD A;  2B1N A;  2DCB A;  3CH3 X;  2B1M A;  1F2B A;  1BY8 A;  3V6C A;  1EWP A;  1K3B B;  3PW3 A;  4QBB A;  2WBF X;  2XU3 A;  2HXZ A;  2DC8 A;  5CHT A;  1PPN A;  3F5V A;  1F2A A;  5JH3 A;  1GMY A;  4FK5 A;  1SNK A;  4QRG A;  2DZZ A;  5CVN B;  4YYR A;  5J94 A;  4DMY A;  1U9V A;  3KFQ A;  1MEG A;  3C9E A;  3IHP A;  2Y6E A;  2XU1 A;  1AU2 A;  1KXR A;  3WXG A;  4PI3 A;  1TLO A;  1KFU L;  1GLO A;  2DC7 A;  1AU0 A;  2JQF R;  1MEM A;  2FT2 A;  1ITO A;  3HWN A;  3OVZ A;  1ME3 A;  4QRX A;  1AYU A;  4MZO A;  3D6S A;  2DC9 A;  3E1Z B;  1GEC E;  2CB5 A;  4OEM A;  4N4Z A;  1MIR A;  3TNX A;  1MHW A;  1AEC A;  3MTN A;  4YYQ A;  4CDD B;  2OUL A;  1AU4 A;  2HD5 A;  2P86 A;  2G7Y A;  3IUT A;  3MHS A;  3RVW A;  4YVA A;  3MOR A;  1X9Y A;  4PP1 A;  5F02 A;  3PBH A;  1DEU A;  3K24 A;  3M99 A;  1EWO A;  2HH5 A;  2FTD A;  1NQC A;  3IV2 A;  4YYS A;  3P5U A;  1ZIV A;  3K9M A;  2DJG B;  1ICF A;  3OIS A;  1KHQ A;  3QT4 A;  3ERV A;  1CB5 A;  4BS5 A;  2DZY A;  2YJ2 A;  2DCA A;  1JQP A;  1U9Q X;  2HHN A;  2JQG R;  4DMX A;  2OP3 A;  2GFO A;  4OEL A;  1HUC B;  4X6H A;  1AU3 A;  1CS8 A;  2XU5 A;  2PRE A;  2AU1 A;  3H8B A;  1PBH A;  2PAD A;  1AIM A;  1CJL A;  1STF E;  3O1G A;  4W5C A;  2R9M A;  5CVO B;  2FRA A;  2R9N A;  2H7J A;  4XUI A;  1O0E A;  1POP A;  3LFY A;  1ATK A;  5CHV A;  3AI8 A;  3KKU A;  1QOL A;  3KSE A;  2BDZ A;  1U5I A;  2YJ8 A;  4RY2 A;  4PP2 E;  3KX1 A;  4P6E A;  1AYW A;  1KFX L;  2NQG A;  1QXP A;  1MDW A;  1NLJ A;  3N3K A;  3WXE A;  3K8U A;  2P7U A;  4I05 A;  4W4U A;  1PCI A;  4FIP A;  3LXS A;  1BP4 A;  2GHU A;  2E03 A;  2CIO A;  8PCH A;  6PAD A;  2IPP B;  3S3Q A;  2BDL A;  3DF0 A;  3S3R A;  1PXV A;  2DCD A;  2G8J A;  2AYN A;  3P5W A;  4I07 A;  1YVB A;  1DF0 A;  4YV8 A;  1BQI A;  3QSD A;  1YK7 A;  2XU4 A;  1PPD A;  3BPM A;  3IMA A;  2G6D A;  2ARY A;  1SP4 B;  1PE6 A;  2E01 A;  1NPZ A;  2FO5 A;  4Q8G A;  4YYW A;  1U9W A;  1NB3 A;  1AYV A;  2DJF B;  2FRQ A;  3IOQ A;  1BGO A;  2VHS A;  2YJ9 A;  1YAL A;  4FJC A;  1NB5 A;  4ZUX U;  1ME4 A;  3N3G A;  4N79 A;  2AVW A;  4MSX A;  1QMY A;  1NL6 A;  1PPO A;  1Q6K A;  2P0R A;  1EWM A;  2VHF A;  4XR7 A;  3V6E A;  1XKG A;  3BC3 A;  1QDQ A;  3NHE A;  1U9X A;  1EWL A;  3RVV A; 
#chains in the Genus database with same CATH topology
 4W5B A;  3PSE A;  4KLB A;  4QH6 A;  2UZJ A;  3I06 A;  7PCK A;  4X6I A;  2NQD B;  3PNR A;  1S4V A;  2G8E A;  3P5V A;  3WXF A;  4PT5 A;  4X6J A;  2OZ2 A;  4D8I A;  2FYE A;  1DKI A;  1EF7 A;  1Y4H A;  2PNS A;  4AXL A;  2R9O A;  3KWZ A;  2R6N A;  5A24 A;  1A6R A;  2E00 A;  4P6G A;  1YK8 A;  2AUZ A;  3H89 A;  2FUD A;  3I3T A;  1THE A;  2J7Q C;  3O0U A;  1Y08 A;  3N4C A;  5JA7 A;  1IWD A;  3PHU A;  4YYV A;  4K7C A;  3RNV A;  1YZB A;  3IFU A;  1CTE A;  3RVX A;  2R9C A;  5KO3 A;  2FQ9 A;  3PDF A;  9PAP A;  2Y5B A;  2YJB A;  4AXM A;  4D8E A;  1GCB A;  1VSN A;  1CVZ A;  2ATO A;  4WUR A;  1CSB B;  2DCC A;  3OF8 A;  5PAD A;  3KW9 A;  3U8E A;  5K16 A;  2E02 A;  3OVX A;  3H6S A;  4OVZ B;  3P5X A;  4BPV A;  3BWK A;  1M6D A;  3HHA A;  1CQD A;  3BCN A;  3CBK A;  4HWY A;  3B79 A;  4MM3 B;  1CV8 A;  4GUA A;  1TU6 A;  3HHI A;  3MHH A;  3H7D A;  4BSQ A;  2AIM A;  1ZCM A;  3IEJ A;  1YT7 A;  4N8W A;  5FPW A;  2AS8 A;  5EF4 A;  2BTW A;  3OF9 A;  4CDE B;  4G54 A;  4QRV A;  3GCB A;  2PBH A;  3F75 A;  5EGW A;  2C0Y A;  2O6X A;  2AYO A;  3MP2 A;  3HD3 A;  1CPJ A;  4HXD B;  1FH0 A;  5CVM A;  1PAD A;  3H8C A;  2YJC A;  4D8B A;  4YYU A;  3CBJ A;  4BOU A;  4CDC B;  4RKX A;  2F1G A;  4RF0 A;  4WA6 A;  1PVJ A;  4BQV A;  4I04 A;  3USV A;  1PIP A;  3ZUA A;  3BOW A;  2F7D A;  1MS6 A;  1F29 A;  2AUX A;  3QJ3 A;  2R9F A;  1PPP A;  4Q8H A;  1VJV A;  2ACT A;  4BS6 A;  2DC6 A;  1F2C A;  4BOS A;  4MZS A;  1TL9 A;  2NQA A;  2IBI A;  2Z84 A;  3BB7 A;  4CZW A;  2NQI A;  3BY4 A;  3BPF A;  3KWB X;  1KHP A;  3CH2 X;  4CDF B;  4PAD A;  2B1N A;  3MJ5 A;  2DCB A;  3CH3 X;  2B1M A;  1F2B A;  1BY8 A;  3V6C A;  1EWP A;  1K3B B;  3PW3 A;  4QBB A;  4BOP A;  3BBA A;  2WBF X;  3W30 A;  2XU3 A;  2HXZ A;  3E9S A;  2DC8 A;  5CHT A;  1PPN A;  3F5V A;  1F2A A;  4RF1 A;  5JH3 A;  1GMY A;  4FK5 A;  1SNK A;  4QRG A;  2DZZ A;  5CVN B;  4YYR A;  5J94 A;  4IP3 A;  4DMY A;  1U9V A;  3KFQ A;  1MEG A;  3C9E A;  3IHP A;  2Y6E A;  2XU1 A;  1AU2 A;  1KXR A;  3WXG A;  4PI3 A;  1TLO A;  1KFU L;  3OQC A;  1GLO A;  2DC7 A;  3PRP A;  1AU0 A;  2JQF R;  4A5U A;  1MEM A;  2FT2 A;  1ITO A;  3HWN A;  3OVZ A;  1ME3 A;  4XZX A;  4QRX A;  1AYU A;  4MZO A;  3TMP A;  3D6S A;  2DC9 A;  3E1Z B;  5EZS A;  1GEC E;  2CB5 A;  4OEM A;  4BOZ A;  4N4Z A;  1MIR A;  5E6J A;  3TNX A;  1MHW A;  3B21 A;  1AEC A;  3MTN A;  4YYQ A;  4CDD B;  2OUL A;  1AU4 A;  2HD5 A;  2P86 A;  2G7Y A;  3IUT A;  3MHS A;  3RVW A;  4YVA A;  3MOR A;  1X9Y A;  4PP1 A;  5JZE A;  5F02 A;  3PBH A;  1DEU A;  3K24 A;  3M99 A;  1EWO A;  2HH5 A;  2FTD A;  1NQC A;  3IV2 A;  4YYS A;  3P5U A;  3PHX A;  1ZIV A;  3K9M A;  4P16 A;  2DJG B;  1ICF A;  3OIS A;  1KHQ A;  2FE8 A;  3QT4 A;  3ERV A;  1CB5 A;  4BS5 A;  2DZY A;  2YJ2 A;  2DCA A;  4OW0 A;  1JQP A;  1U9Q X;  2HHN A;  2JQG R;  4DMX A;  2J7Q A;  2OP3 A;  2GFO A;  4OEL A;  1HUC B;  4X6H A;  1AU3 A;  2DOS A;  1CS8 A;  2XU5 A;  2PRE A;  2AU1 A;  4OVZ A;  3H8B A;  3TRK A;  1PBH A;  2PAD A;  1AIM A;  1CJL A;  1STF E;  3O1G A;  4W5C A;  2R9M A;  5CVO B;  2FRA A;  2JTC A;  2HWK A;  2R9N A;  2H7J A;  4RNA A;  4XUI A;  1O0E A;  1POP A;  3LFY A;  1ATK A;  5CHV A;  3AI8 A;  4BOQ A;  4M0W A;  2BTW B;  5EZQ A;  3PT2 A;  3KKU A;  1QOL A;  3KSE A;  2AGA A;  2BDZ A;  1U5I A;  2YJ8 A;  2BU3 A;  4RY2 A;  3PHW A;  4ZTB A;  4PP2 E;  3KX1 A;  3C0R A;  4P6E A;  1AYW A;  1KFX L;  2NQG A;  1QXP A;  1MDW A;  4R3D A;  1NLJ A;  3N3K A;  3ZNH A;  3WXE A;  3K8U A;  2P7U A;  4I05 A;  4W4U A;  1PCI A;  4FIP A;  3LXS A;  1BP4 A;  2GHU A;  2E03 A;  2CIO A;  8PCH A;  6PAD A;  2IPP B;  3S3Q A;  2BDL A;  3MTV A;  3PRM A;  3DF0 A;  3S3R A;  1PXV A;  2DCD A;  2G8J A;  2AYN A;  3P5W A;  4I07 A;  1YVB A;  1DF0 A;  2JRI A;  1BQI A;  3W31 A;  4YV8 A;  3QSD A;  1YK7 A;  2XU4 A;  1PPD A;  4MI7 A;  3BPM A;  3IMA A;  4IUM A;  2G6D A;  2ARY A;  1SP4 B;  1PE6 A;  2E01 A;  1NPZ A;  2FO5 A;  4Q8G A;  4REZ A;  4YYW A;  1U9W A;  1NB3 A;  1AYV A;  2DJF B;  2FRQ A;  3IOQ A;  1BGO A;  2VHS A;  2YJ9 A;  1YAL A;  4FJC A;  1NB5 A;  4ZUX U;  1ME4 A;  3N3G A;  4N79 A;  2AVW A;  4MSX A;  1QMY A;  1NL6 A;  1PPO A;  1Q6K A;  2P0R A;  1EWM A;  2VHF A;  4XR7 A;  3O65 A;  3V6E A;  1XKG A;  3BC3 A;  1QDQ A;  1UKF A;  3NHE A;  1U9X A;  1EWL A;  3RVV A; 
#chains in the Genus database with same CATH homology
 4W5B A;  4KLB A;  4QH6 A;  1W4T A;  3I06 A;  7PCK A;  4X6I A;  2NQD B;  3PNR A;  1S4V A;  2G8E A;  3P5V A;  3WXF A;  4X6J A;  2OZ2 A;  2FYE A;  1EF7 A;  1Y4H A;  2PNS A;  4AXL A;  2R9O A;  3KWZ A;  2R6N A;  5A24 A;  1A6R A;  2E00 A;  4P6G A;  1YK8 A;  2AUZ A;  3H89 A;  2FUD A;  3I3T A;  1THE A;  3O0U A;  1Y08 A;  3N4C A;  4GUZ A;  5JA7 A;  1IWD A;  4YYV A;  4K7C A;  1CTE A;  3RVX A;  2R9C A;  2FQ9 A;  3PDF A;  9PAP A;  2Y5B A;  2YJB A;  4AXM A;  1GCB A;  1VSN A;  1CVZ A;  2ATO A;  1CSB B;  2DCC A;  3OF8 A;  4NV8 A;  3KW9 A;  5PAD A;  3U8E A;  5K16 A;  2E02 A;  3OVX A;  1E2T A;  3H6S A;  1GX3 A;  3P5X A;  4BPV A;  3BWK A;  1M6D A;  3HHA A;  1CQD A;  3BCN A;  1W6F A;  3CBK A;  4HWY A;  3B79 A;  1CV8 A;  1TU6 A;  3HHI A;  3MHH A;  3H7D A;  4BSQ A;  2AIM A;  1ZCM A;  3IEJ A;  1YT7 A;  4N8W A;  5FPW A;  2AS8 A;  5EF4 A;  3OF9 A;  4CDE B;  4G54 A;  4QRV A;  3GCB A;  2PBH A;  3F75 A;  5EGW A;  2C0Y A;  2O6X A;  2AYO A;  3HD3 A;  1CPJ A;  1FH0 A;  5CVM A;  1PAD A;  3H8C A;  2YJC A;  4YYU A;  3LTW A;  3CBJ A;  4CDC B;  2F1G A;  4WA6 A;  4BQV A;  4I04 A;  3USV A;  1PIP A;  3ZUA A;  3BOW A;  2F7D A;  1MS6 A;  1F29 A;  2AUX A;  3QJ3 A;  2R9F A;  1PPP A;  4Q8H A;  1VJV A;  2ACT A;  4BS6 A;  2DC6 A;  1F2C A;  1W5R A;  4MZS A;  1TL9 A;  2NQA A;  2IBI A;  4CZW A;  2NQI A;  3BPF A;  3KWB X;  1KHP A;  3CH2 X;  4CDF B;  4PAD A;  2B1N A;  2DCB A;  3CH3 X;  2B1M A;  1F2B A;  1BY8 A;  3V6C A;  1EWP A;  1K3B B;  3PW3 A;  4QBB A;  2WBF X;  2XU3 A;  2HXZ A;  2DC8 A;  5CHT A;  1PPN A;  3F5V A;  1F2A A;  5JH3 A;  1GMY A;  4FK5 A;  1SNK A;  4QRG A;  2DZZ A;  5CVN B;  3D9W A;  5J94 A;  4YYR A;  4DMY A;  1U9V A;  3KFQ A;  1MEG A;  3C9E A;  3IHP A;  2Y6E A;  2XU1 A;  1AU2 A;  1KXR A;  3WXG A;  4PI3 A;  1TLO A;  1KFU L;  1GLO A;  2DC7 A;  1AU0 A;  2JQF R;  1MEM A;  2FT2 A;  1ITO A;  3HWN A;  3OVZ A;  1ME3 A;  4QRX A;  1AYU A;  4MZO A;  3D6S A;  2DC9 A;  3E1Z B;  1GEC E;  2CB5 A;  4OEM A;  4N4Z A;  1MIR A;  3TNX A;  1MHW A;  1AEC A;  3MTN A;  4YYQ A;  4CDD B;  2OUL A;  1AU4 A;  2HD5 A;  2P86 A;  2G7Y A;  3IUT A;  3MHS A;  3RVW A;  4YVA A;  3MOR A;  1X9Y A;  4PP1 A;  5F02 A;  3PBH A;  1DEU A;  3K24 A;  3M99 A;  1EWO A;  2HH5 A;  2FTD A;  1NQC A;  3IV2 A;  4YYS A;  3P5U A;  1ZIV A;  3K9M A;  2DJG B;  1ICF A;  3OIS A;  1KHQ A;  3QT4 A;  3ERV A;  1CB5 A;  4BS5 A;  2DZY A;  2YJ2 A;  2DCA A;  1JQP A;  1U9Q X;  2HHN A;  2JQG R;  4DMX A;  2OP3 A;  2GFO A;  4OEL A;  1HUC B;  4X6H A;  1AU3 A;  1CS8 A;  2XU5 A;  2PRE A;  2AU1 A;  3H8B A;  1PBH A;  2PAD A;  1AIM A;  4NV7 A;  1CJL A;  1STF E;  3O1G A;  4W5C A;  2R9M A;  5CVO B;  2FRA A;  2R9N A;  4C5P A;  2H7J A;  4XUI A;  1O0E A;  1POP A;  3LFY A;  1ATK A;  5CHV A;  3AI8 A;  4BGF A;  3KKU A;  1QOL A;  3KSE A;  2BDZ A;  1U5I A;  2YJ8 A;  4RY2 A;  4PP2 E;  3KX1 A;  4P6E A;  1AYW A;  1KFX L;  2NQG A;  1QXP A;  1MDW A;  1NLJ A;  3N3K A;  3WXE A;  3K8U A;  2P7U A;  4I05 A;  4W4U A;  1PCI A;  4FIP A;  3LXS A;  1BP4 A;  2GHU A;  2E03 A;  2CIO A;  8PCH A;  6PAD A;  2IPP B;  3S3Q A;  2BDL A;  3DF0 A;  3S3R A;  1PXV A;  2DCD A;  2G8J A;  2VFB A;  2AYN A;  3P5W A;  4I07 A;  1YVB A;  1DF0 A;  4YV8 A;  1BQI A;  3QSD A;  1YK7 A;  2XU4 A;  1PPD A;  2BSZ A;  3BPM A;  3IMA A;  2G6D A;  2ARY A;  1SP4 B;  1PE6 A;  2E01 A;  1NPZ A;  2FO5 A;  4Q8G A;  2VFC A;  4YYW A;  1U9W A;  1NB3 A;  1AYV A;  2DJF B;  2FRQ A;  3IOQ A;  1BGO A;  2VHS A;  2YJ9 A;  1YAL A;  4FJC A;  1NB5 A;  4ZUX U;  1ME4 A;  3N3G A;  4N79 A;  2AVW A;  4MSX A;  1QMY A;  1NL6 A;  1PPO A;  1Q6K A;  2P0R A;  1EWM A;  2VHF A;  4XR7 A;  4B55 A;  3V6E A;  1XKG A;  3BC3 A;  1QDQ A;  3NHE A;  1U9X A;  1EWL A;  3RVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...