2PADA

Binding of chloromethyl ketone substrate analogues to crystalline papain
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
212
structure length
212
Chain Sequence
IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNQYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNQGALLYSIANQPVSVVLQAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of chloromethyl ketone substrate analogues to crystalline papain.
pubmed doi rcsb
source organism Carica papaya
molecule tags Hydrolase (sulfhydryl proteinase)
molecule keywords PAPAIN
total genus 55
structure length 212
sequence length 212
ec nomenclature ec 3.4.22.2: Papain.
pdb deposition date 1976-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 2padA00
3IMAA 1BP4A 3BPFA 1X9YA 3OVXA 5K16A 4CDEB 4YYVA 4CDDB 5CVMA 2NQIA 2CB5A 1PPOA 1Y4HA 3QJ3A 3PNRA 4DMYA 3RVWA 3HWNA 5CVNB 2YJBA 1QOLA 1QXPA 1Q6KA 1F2CA 2PNSA 3F75A 3GCBA 2XU5A 3K24A 3PBHA 4QRVA 2YJ8A 3MHHA 1AYUA 1AU3A 3RVXA 2DC7A 2AVWA 1ME3A 8PCHA 3NHEA 1U9WA 2JQGR 4OELA 1BQIA 2XU3A 1AYWA 3F5VA 4QRXA 3BOWA 2P86A 2PBHA 1ZCMA 3HHIA 1KFXL 4X6JA 1YVBA 2PADA 3IEJA 5JH3A 3BPMA 1A6RA 2DCBA 1KHQA 1PPPA 3OVZA 3N4CA 3H6SA 4PADA 2R9FA 2FO5A 3LXSA 2NQAA 1TLOA 3H7DA 2F7DA 4G54A 5A24A 3OF9A 2JQFR 1DF0A 1ME4A 3O0UA 1NQCA 3D6SA 4PP1A 4N8WA 1PADA 2FUDA 3I06A 3HD3A 1CJLA 2R6NA 1FH0A 3H8BA 1K3BB 1TL9A 2OULA 4ZUXU 1GLOA 1PIPA 2BDZA 4BS6A 2FQ9A 4I05A 1BGOA 1EWMA 1PPNA 1NB3A 6PADA 2P7UA 1PCIA 4PI3A 2VHFA 4CZWA 1AU2A 3QT4A 4FK5A 2IPPB 1NB5A 3CBJA 2YJCA 1AECA 3P5WA 2G8EA 1U9QX 3N3GA 2ARYA 4P6GA 1HUCB 2E00A 1AU4A 3MTNA 2FTDA 1U5IA 3P5XA 2G8JA 2DCAA 1DEUA 3IUTA 3USVA 4YYUA 2Y6EA 1NLJA 4QH6A 1CB5A 1MHWA 2CIOA 3CBKA 4BPVA 2R9NA 3H8CA 1GMYA 7PCKA 1F29A 2C0YA 3QSDA 4MZOA 2AU1A 2PREA 1YK7A 1F2AA 3WXGA 2FRQA 1EWOA 2BDLA 3P5UA 3KW9A 2ACTA 1S4VA 2GHUA 3ZUAA 5CHVA 3WXFA 1CSBB 2DC9A 2HD5A 3KX1A 5J94A 2IBIA 3LFYA 1MEMA 2AYOA 3MHSA 1ATKA 2AYNA 1ICFA 3KKUA 5FPWA 1Y08A 4XUIA 5F02A 3PDFA 2R9OA 2HH5A 2AUXA 2B1NA 2F1GA 3IOQA 3N3KA 2DC6A 4AXMA 4FIPA 4I07A 3ERVA 1THEA 2YJ2A 3BCNA 5EGWA 2OZ2A 1CTEA 3RVVA 1IWDA 1KFUL 3K8UA 2AS8A 4Q8HA 2YJ9A 3CH2X 2NQGA 2FRAA 5CHTA 1MS6A 2DZYA 1ITOA 5JA7A 4MSXA 3WXEA 1CS8A 3H89A 2HHNA 2AIMA 1KHPA 4QBBA 1AU0A 1VSNA 4HWYA 1O0EA 1POPA 4YYRA 3P5VA 2GFOA 2O6XA 4KLBA 3PW3A 2FYEA 4DMXA 4YYQA 1QDQA 2AUZA 3B79A 2B1MA 2E02A 3O1GA 4YV8A 2P0RA 1STFE 2XU1A 3U8EA 4W4UA 3V6EA 2R9MA 3OISA 1M6DA 4AXLA 2G6DA 2H7JA 3MORA 4YYSA 3AI8A 4WA6A 3S3QA 2FT2A 2NQDB 4W5BA 3C9EA 1EWLA 3BC3A 3BWKA 2OP3A 5PADA 2DZZA 4FJCA 4P6EA 3TNXA 1MEGA 3K9MA 1EF7A 4BQVA 3OF8A 2DJFB 1VJVA 4MZSA 1AYVA 9PAPA 3IV2A 4I04A 1SP4B 3I3TA 1PPDA 2HXZA 1QMYA 4CDFB 4N79A 2VHSA 3HHAA 1F2BA 2R9CA 1CQDA 1PE6A 2DC8A 2WBFX 1TU6A 5CVOB 1MDWA 1CPJA 1SNKA 3CH3X 1NL6A 4QRGA 4YYWA 1YT7A 3V6CA 1PXVA 2G7YA 1CVZA 3KSEA 1AIMA 2DCCA 3M99A 3DF0A 2DJGB 1GECE 4K7CA 1CV8A 1EWPA 4BSQA 2Y5BA 2DCDA 1YK8A 3S3RA 4N4ZA 3KFQA 5EF4A 1JQPA 1XKGA 1ZIVA 1GCBA 4CDCB 4PP2E 1U9VA 4Q8GA 1MIRA 2E03A 3KWZA 4X6HA 1BY8A 4RY2A 4BS5A 1U9XA 1YALA 3IHPA 2ATOA 4W5CA 1PBHA 3E1ZB 3KWBX 4XR7A 4OEMA 4X6IA 1KXRA 2XU4A 1NPZA 2E01A 4YVAA
chains in the Genus database with same CATH superfamily
3IMAA 1BP4A 3BPFA 1X9YA 3OVXA 5K16A 4CDEB 4YYVA 4CDDB 5CVMA 2NQIA 3TMPA 2CB5A 1PPOA 1Y4HA 3QJ3A 3PHUA 4RF0A 3PNRA 4RNAA 4DMYA 3RVWA 4BOUA 3HWNA 5CVNB 2YJBA 1QOLA 1QXPA 1Q6KA 2J7QC 1F2CA 2PNSA 3F75A 3GCBA 2XU5A 3K24A 3PBHA 4QRVA 2YJ8A 3MHHA 1AYUA 1AU3A 3RVXA 4WURA 2DC7A 2AVWA 1ME3A 8PCHA 3NHEA 1U9WA 3MP2A 4A5UA 3O65A 2JQGR 4OELA 1BQIA 2XU3A 1AYWA 3PRMA 3F5VA 3PHXA 4QRXA 3BOWA 4PT5A 2P86A 2PBHA 1ZCMA 3HHIA 1KFXL 4X6JA 1YVBA 2PADA 3IEJA 5JH3A 3BPMA 1A6RA 2DCBA 1KHQA 1PPPA 3OVZA 4BOQA 3N4CA 3H6SA 4PADA 2R9FA 2FO5A 3LXSA 2NQAA 1TLOA 3H7DA 2F7DA 4G54A 5A24A 3OF9A 3B21A 2JQFR 3O0UA 1DF0A 1ME4A 1NQCA 3D6SA 4PP1A 4N8WA 2UZJA 1PADA 2FUDA 3I06A 4BOSA 3HD3A 1CJLA 2R6NA 1FH0A 3H8BA 1K3BB 1TL9A 2OULA 4ZUXU 1GLOA 1PIPA 2BDZA 2Z84A 4BS6A 2BTWB 2FQ9A 4I05A 1BGOA 4RF1A 3ZNHA 1EWMA 1PPNA 1NB3A 6PADA 2P7UA 1PCIA 4PI3A 4OW0A 2VHFA 4CZWA 1AU2A 3QT4A 4FK5A 5KO3A 2IPPB 1NB5A 3CBJA 2YJCA 1AECA 3P5WA 2G8EA 1U9QX 3N3GA 2ARYA 4P6GA 1HUCB 5JZEA 2E00A 3OQCA 1AU4A 3MTNA 2FTDA 3PT2A 1PVJA 3BY4A 1U5IA 3P5XA 2G8JA 2DCAA 1DEUA 3IUTA 3USVA 4YYUA 2Y6EA 1NLJA 4QH6A 1CB5A 1MHWA 2CIOA 3CBKA 4BPVA 2BU3A 2R9NA 3H8CA 1GMYA 4HXDB 7PCKA 1F29A 2C0YA 3QSDA 4MZOA 2AU1A 2PREA 5EZSA 1YK7A 1F2AA 3WXGA 2FRQA 1EWOA 2BDLA 3P5UA 3KW9A 2ACTA 1S4VA 2GHUA 3ZUAA 5CHVA 3WXFA 1CSBB 3BB7A 2DC9A 2HD5A 3KX1A 5J94A 4D8IA 2IBIA 3LFYA 1MEMA 2AYOA 3MHSA 1ATKA 2AYNA 1ICFA 3KKUA 4IP3A 5FPWA 1Y08A 4XUIA 5F02A 3PDFA 2R9OA 2HH5A 2AUXA 2HWKA 2B1NA 2J7QA 2F1GA 3IOQA 3N3KA 2DC6A 4M0WA 4XZXA 4AXMA 4FIPA 4I07A 3ERVA 1THEA 3MJ5A 2YJ2A 3BCNA 5EGWA 2OZ2A 4P16A 1CTEA 3RVVA 1IWDA 1KFUL 3K8UA 2AS8A 4Q8HA 3PHWA 4REZA 2YJ9A 3CH2X 2NQGA 2FRAA 5CHTA 1MS6A 2DZYA 1ITOA 4D8BA 5JA7A 4MSXA 3WXEA 1CS8A 3H89A 2HHNA 4D8EA 2AIMA 1KHPA 4QBBA 1AU0A 1VSNA 4HWYA 1O0EA 1POPA 4YYRA 3P5VA 3W30A 2GFOA 2O6XA 4KLBA 3PW3A 4BOPA 2FYEA 4DMXA 4YYQA 1QDQA 2AUZA 3B79A 2B1MA 2E02A 3O1GA 4YV8A 2P0RA 1STFE 2XU1A 3U8EA 4W4UA 3V6EA 2R9MA 3OISA 1M6DA 4AXLA 2JRIA 2G6DA 2H7JA 3MORA 4YYSA 3C0RA 3AI8A 2AGAA 4OVZA 4ZTBA 5E6JA 4WA6A 3S3QA 2FT2A 2NQDB 4W5BA 3C9EA 1EWLA 3BC3A 3BWKA 1DKIA 2OP3A 5PADA 2DZZA 3BBAA 4R3DA 4FJCA 4RKXA 2BTWA 4P6EA 3TNXA 1MEGA 3K9MA 1EF7A 4BQVA 2DOSA 3OF8A 2DJFB 1VJVA 4MZSA 2FE8A 1AYVA 9PAPA 3IFUA 3IV2A 4I04A 1SP4B 3I3TA 1PPDA 2HXZA 4MI7A 3RNVA 1QMYA 4CDFB 4N79A 2VHSA 3HHAA 1F2BA 2R9CA 1CQDA 1PE6A 3PRPA 2DC8A 2WBFX 1TU6A 5CVOB 1MDWA 1CPJA 2JTCA 1SNKA 3CH3X 1NL6A 4QRGA 1YZBA 4YYWA 1YT7A 3V6CA 1PXVA 3W31A 2G7YA 1CVZA 3KSEA 3MTVA 1AIMA 4BOZA 2DCCA 4GUAA 3M99A 1UKFA 3DF0A 2DJGB 3E9SA 1GECE 4K7CA 1CV8A 1EWPA 4BSQA 2Y5BA 2DCDA 1YK8A 3S3RA 4N4ZA 4IUMA 3KFQA 5EF4A 1JQPA 1XKGA 1ZIVA 3PSEA 1GCBA 4CDCB 4PP2E 4OVZB 1U9VA 4Q8GA 1MIRA 2E03A 3TRKA 3KWZA 4X6HA 1BY8A 4RY2A 5EZQA 4BS5A 1U9XA 1YALA 3IHPA 2ATOA 4W5CA 1PBHA 3E1ZB 3KWBX 4XR7A 4OEMA 4X6IA 1KXRA 2XU4A 1NPZA 2E01A 4YVAA 4MM3B
chains in the Genus database with same CATH topology
3IMAA 1BP4A 3BPFA 1X9YA 3OVXA 5K16A 4CDEB 4YYVA 4CDDB 5CVMA 2NQIA 2CB5A 1PPOA 1Y4HA 3QJ3A 3PNRA 4DMYA 3RVWA 3HWNA 5CVNB 2YJBA 1QOLA 1QXPA 1Q6KA 1F2CA 2PNSA 3F75A 3GCBA 2XU5A 3K24A 3PBHA 4QRVA 2YJ8A 3MHHA 1AYUA 1AU3A 2VFBA 3RVXA 2DC7A 2AVWA 1ME3A 8PCHA 3NHEA 1U9WA 2JQGR 4OELA 1BQIA 2XU3A 1AYWA 3F5VA 4QRXA 3BOWA 2P86A 2PBHA 1ZCMA 3HHIA 1KFXL 4X6JA 1YVBA 2PADA 3IEJA 5JH3A 3BPMA 1A6RA 2DCBA 1KHQA 1PPPA 3OVZA 3N4CA 3H6SA 4PADA 2R9FA 2FO5A 3LXSA 2NQAA 1TLOA 3H7DA 2F7DA 4G54A 5A24A 3OF9A 2JQFR 1DF0A 1ME4A 3O0UA 1NQCA 3D6SA 4PP1A 4N8WA 1PADA 2FUDA 3I06A 3HD3A 1CJLA 2R6NA 1FH0A 3H8BA 1K3BB 1TL9A 2OULA 4ZUXU 1GLOA 1PIPA 2BDZA 4BS6A 2FQ9A 4I05A 1BGOA 1EWMA 1PPNA 1NB3A 6PADA 2P7UA 3LTWA 4C5PA 1PCIA 4PI3A 2VHFA 4CZWA 1AU2A 3QT4A 4FK5A 2IPPB 1W4TA 1NB5A 3CBJA 2YJCA 1AECA 3P5WA 2BSZA 2G8EA 1U9QX 3N3GA 2ARYA 4P6GA 1HUCB 2E00A 1AU4A 3MTNA 2FTDA 1U5IA 3P5XA 2G8JA 2DCAA 1DEUA 3IUTA 3USVA 4YYUA 2Y6EA 1NLJA 4QH6A 1CB5A 1MHWA 2CIOA 3CBKA 4BPVA 2R9NA 3H8CA 1GMYA 7PCKA 1F29A 2C0YA 3QSDA 4MZOA 2AU1A 2PREA 1YK7A 1F2AA 3WXGA 2FRQA 1EWOA 2BDLA 3P5UA 3KW9A 2ACTA 1S4VA 2GHUA 3ZUAA 5CHVA 3WXFA 1CSBB 2DC9A 2HD5A 1GX3A 3KX1A 5J94A 2IBIA 3LFYA 1MEMA 2AYOA 3MHSA 1ATKA 2AYNA 1ICFA 3KKUA 5FPWA 1Y08A 4XUIA 5F02A 3PDFA 2R9OA 4BGFA 2HH5A 2AUXA 2B1NA 2F1GA 3IOQA 3N3KA 2DC6A 4AXMA 4FIPA 4I07A 3ERVA 1THEA 2YJ2A 3BCNA 5EGWA 2OZ2A 1CTEA 3RVVA 1W5RA 1IWDA 1KFUL 3K8UA 2AS8A 4Q8HA 2YJ9A 3CH2X 2NQGA 2FRAA 5CHTA 1MS6A 2DZYA 1ITOA 1W6FA 5JA7A 4MSXA 3WXEA 1CS8A 3H89A 2HHNA 2AIMA 1KHPA 4QBBA 1AU0A 1VSNA 4HWYA 1O0EA 1POPA 4YYRA 3P5VA 2GFOA 2O6XA 4KLBA 3PW3A 2FYEA 4DMXA 4YYQA 1QDQA 2AUZA 3B79A 2B1MA 2E02A 3O1GA 4YV8A 2P0RA 1STFE 2XU1A 3U8EA 4W4UA 3V6EA 2R9MA 3OISA 1M6DA 4AXLA 2G6DA 2H7JA 3MORA 4YYSA 3AI8A 4B55A 4WA6A 3S3QA 2FT2A 2NQDB 4W5BA 3C9EA 1EWLA 3BC3A 3BWKA 3D9WA 2OP3A 5PADA 2DZZA 4FJCA 4P6EA 3TNXA 1MEGA 3K9MA 1EF7A 4NV7A 4BQVA 3OF8A 2DJFB 1VJVA 4MZSA 1E2TA 1AYVA 9PAPA 3IV2A 4I04A 1SP4B 3I3TA 1PPDA 2HXZA 1QMYA 4CDFB 4N79A 2VHSA 3HHAA 1F2BA 2R9CA 1CQDA 1PE6A 2DC8A 2WBFX 1TU6A 5CVOB 1MDWA 1CPJA 4NV8A 1SNKA 3CH3X 1NL6A 4QRGA 4YYWA 1YT7A 3V6CA 1PXVA 2G7YA 1CVZA 3KSEA 1AIMA 2DCCA 3M99A 3DF0A 2DJGB 1GECE 4K7CA 1CV8A 1EWPA 4BSQA 2Y5BA 2DCDA 1YK8A 3S3RA 4N4ZA 3KFQA 5EF4A 1JQPA 1XKGA 1ZIVA 1GCBA 4CDCB 4PP2E 1U9VA 4GUZA 4Q8GA 1MIRA 2E03A 2VFCA 3KWZA 4X6HA 1BY8A 4RY2A 4BS5A 1U9XA 1YALA 3IHPA 2ATOA 4W5CA 1PBHA 3E1ZB 3KWBX 4XR7A 4OEMA 4X6IA 1KXRA 2XU4A 1NPZA 2E01A 4YVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMA A;  1BP4 A;  3BPF A;  1X9Y A;  3OVX A;  5K16 A;  4CDE B;  4YYV A;  4CDD B;  5CVM A;  2NQI A;  2CB5 A;  1PPO A;  1Y4H A;  3QJ3 A;  3PNR A;  4DMY A;  3RVW A;  3HWN A;  5CVN B;  2YJB A;  1QOL A;  1QXP A;  1Q6K A;  1F2C A;  2PNS A;  3F75 A;  3GCB A;  2XU5 A;  3K24 A;  3PBH A;  4QRV A;  2YJ8 A;  3MHH A;  1AYU A;  1AU3 A;  3RVX A;  2DC7 A;  2AVW A;  1ME3 A;  8PCH A;  3NHE A;  1U9W A;  2JQG R;  4OEL A;  1BQI A;  2XU3 A;  1AYW A;  3F5V A;  4QRX A;  3BOW A;  2P86 A;  2PBH A;  1ZCM A;  3HHI A;  1KFX L;  4X6J A;  1YVB A;  2PAD A;  3IEJ A;  5JH3 A;  3BPM A;  1A6R A;  2DCB A;  1KHQ A;  1PPP A;  3OVZ A;  3N4C A;  3H6S A;  4PAD A;  2R9F A;  2FO5 A;  3LXS A;  2NQA A;  1TLO A;  3H7D A;  2F7D A;  4G54 A;  5A24 A;  3OF9 A;  2JQF R;  1DF0 A;  1ME4 A;  3O0U A;  1NQC A;  3D6S A;  4PP1 A;  4N8W A;  1PAD A;  2FUD A;  3I06 A;  3HD3 A;  1CJL A;  2R6N A;  1FH0 A;  3H8B A;  1K3B B;  1TL9 A;  2OUL A;  4ZUX U;  1GLO A;  1PIP A;  2BDZ A;  4BS6 A;  2FQ9 A;  4I05 A;  1BGO A;  1EWM A;  1PPN A;  1NB3 A;  6PAD A;  2P7U A;  1PCI A;  4PI3 A;  2VHF A;  4CZW A;  1AU2 A;  3QT4 A;  4FK5 A;  2IPP B;  1NB5 A;  3CBJ A;  2YJC A;  1AEC A;  3P5W A;  2G8E A;  1U9Q X;  3N3G A;  2ARY A;  4P6G A;  1HUC B;  2E00 A;  1AU4 A;  3MTN A;  2FTD A;  1U5I A;  3P5X A;  2G8J A;  2DCA A;  1DEU A;  3IUT A;  3USV A;  4YYU A;  2Y6E A;  1NLJ A;  4QH6 A;  1CB5 A;  1MHW A;  2CIO A;  3CBK A;  4BPV A;  2R9N A;  3H8C A;  1GMY A;  7PCK A;  1F29 A;  2C0Y A;  3QSD A;  4MZO A;  2AU1 A;  2PRE A;  1YK7 A;  1F2A A;  3WXG A;  2FRQ A;  1EWO A;  2BDL A;  3P5U A;  3KW9 A;  2ACT A;  1S4V A;  2GHU A;  3ZUA A;  5CHV A;  3WXF A;  1CSB B;  2DC9 A;  2HD5 A;  3KX1 A;  5J94 A;  2IBI A;  3LFY A;  1MEM A;  2AYO A;  3MHS A;  1ATK A;  2AYN A;  1ICF A;  3KKU A;  5FPW A;  1Y08 A;  4XUI A;  5F02 A;  3PDF A;  2R9O A;  2HH5 A;  2AUX A;  2B1N A;  2F1G A;  3IOQ A;  3N3K A;  2DC6 A;  4AXM A;  4FIP A;  4I07 A;  3ERV A;  1THE A;  2YJ2 A;  3BCN A;  5EGW A;  2OZ2 A;  1CTE A;  3RVV A;  1IWD A;  1KFU L;  3K8U A;  2AS8 A;  4Q8H A;  2YJ9 A;  3CH2 X;  2NQG A;  2FRA A;  5CHT A;  1MS6 A;  2DZY A;  1ITO A;  5JA7 A;  4MSX A;  3WXE A;  1CS8 A;  3H89 A;  2HHN A;  2AIM A;  1KHP A;  4QBB A;  1AU0 A;  1VSN A;  4HWY A;  1O0E A;  1POP A;  4YYR A;  3P5V A;  2GFO A;  2O6X A;  4KLB A;  3PW3 A;  2FYE A;  4DMX A;  4YYQ A;  1QDQ A;  2AUZ A;  3B79 A;  2B1M A;  2E02 A;  3O1G A;  4YV8 A;  2P0R A;  1STF E;  2XU1 A;  3U8E A;  4W4U A;  3V6E A;  2R9M A;  3OIS A;  1M6D A;  4AXL A;  2G6D A;  2H7J A;  3MOR A;  4YYS A;  3AI8 A;  4WA6 A;  3S3Q A;  2FT2 A;  2NQD B;  4W5B A;  3C9E A;  1EWL A;  3BC3 A;  3BWK A;  2OP3 A;  5PAD A;  2DZZ A;  4FJC A;  4P6E A;  3TNX A;  1MEG A;  3K9M A;  1EF7 A;  4BQV A;  3OF8 A;  2DJF B;  1VJV A;  4MZS A;  1AYV A;  9PAP A;  3IV2 A;  4I04 A;  1SP4 B;  3I3T A;  1PPD A;  2HXZ A;  1QMY A;  4CDF B;  4N79 A;  2VHS A;  3HHA A;  1F2B A;  2R9C A;  1CQD A;  1PE6 A;  2DC8 A;  2WBF X;  1TU6 A;  5CVO B;  1MDW A;  1CPJ A;  1SNK A;  3CH3 X;  1NL6 A;  4QRG A;  4YYW A;  1YT7 A;  3V6C A;  1PXV A;  2G7Y A;  1CVZ A;  3KSE A;  1AIM A;  2DCC A;  3M99 A;  3DF0 A;  2DJG B;  1GEC E;  4K7C A;  1CV8 A;  1EWP A;  4BSQ A;  2Y5B A;  2DCD A;  1YK8 A;  3S3R A;  4N4Z A;  3KFQ A;  5EF4 A;  1JQP A;  1XKG A;  1ZIV A;  1GCB A;  4CDC B;  4PP2 E;  1U9V A;  4Q8G A;  1MIR A;  2E03 A;  3KWZ A;  4X6H A;  1BY8 A;  4RY2 A;  4BS5 A;  1U9X A;  1YAL A;  3IHP A;  2ATO A;  4W5C A;  1PBH A;  3E1Z B;  3KWB X;  4XR7 A;  4OEM A;  4X6I A;  1KXR A;  2XU4 A;  1NPZ A;  2E01 A;  4YVA A; 
#chains in the Genus database with same CATH topology
 3IMA A;  1BP4 A;  3BPF A;  1X9Y A;  3OVX A;  5K16 A;  4CDE B;  4YYV A;  4CDD B;  5CVM A;  2NQI A;  3TMP A;  2CB5 A;  1PPO A;  1Y4H A;  3QJ3 A;  3PHU A;  4RF0 A;  3PNR A;  4RNA A;  4DMY A;  3RVW A;  4BOU A;  3HWN A;  5CVN B;  2YJB A;  1QOL A;  1QXP A;  1Q6K A;  2J7Q C;  1F2C A;  2PNS A;  3F75 A;  3GCB A;  2XU5 A;  3K24 A;  3PBH A;  4QRV A;  2YJ8 A;  3MHH A;  1AYU A;  1AU3 A;  3RVX A;  4WUR A;  2DC7 A;  2AVW A;  1ME3 A;  8PCH A;  3NHE A;  1U9W A;  3MP2 A;  4A5U A;  3O65 A;  2JQG R;  4OEL A;  1BQI A;  2XU3 A;  1AYW A;  3PRM A;  3F5V A;  3PHX A;  4QRX A;  3BOW A;  4PT5 A;  2P86 A;  2PBH A;  1ZCM A;  3HHI A;  1KFX L;  4X6J A;  1YVB A;  2PAD A;  3IEJ A;  5JH3 A;  3BPM A;  1A6R A;  2DCB A;  1KHQ A;  1PPP A;  3OVZ A;  4BOQ A;  3N4C A;  3H6S A;  4PAD A;  2R9F A;  2FO5 A;  3LXS A;  2NQA A;  1TLO A;  3H7D A;  2F7D A;  4G54 A;  5A24 A;  3OF9 A;  3B21 A;  2JQF R;  3O0U A;  1DF0 A;  1ME4 A;  1NQC A;  3D6S A;  4PP1 A;  4N8W A;  2UZJ A;  1PAD A;  2FUD A;  3I06 A;  4BOS A;  3HD3 A;  1CJL A;  2R6N A;  1FH0 A;  3H8B A;  1K3B B;  1TL9 A;  2OUL A;  4ZUX U;  1GLO A;  1PIP A;  2BDZ A;  2Z84 A;  4BS6 A;  2BTW B;  2FQ9 A;  4I05 A;  1BGO A;  4RF1 A;  3ZNH A;  1EWM A;  1PPN A;  1NB3 A;  6PAD A;  2P7U A;  1PCI A;  4PI3 A;  4OW0 A;  2VHF A;  4CZW A;  1AU2 A;  3QT4 A;  4FK5 A;  5KO3 A;  2IPP B;  1NB5 A;  3CBJ A;  2YJC A;  1AEC A;  3P5W A;  2G8E A;  1U9Q X;  3N3G A;  2ARY A;  4P6G A;  1HUC B;  5JZE A;  2E00 A;  3OQC A;  1AU4 A;  3MTN A;  2FTD A;  3PT2 A;  1PVJ A;  3BY4 A;  1U5I A;  3P5X A;  2G8J A;  2DCA A;  1DEU A;  3IUT A;  3USV A;  4YYU A;  2Y6E A;  1NLJ A;  4QH6 A;  1CB5 A;  1MHW A;  2CIO A;  3CBK A;  4BPV A;  2BU3 A;  2R9N A;  3H8C A;  1GMY A;  4HXD B;  7PCK A;  1F29 A;  2C0Y A;  3QSD A;  4MZO A;  2AU1 A;  2PRE A;  5EZS A;  1YK7 A;  1F2A A;  3WXG A;  2FRQ A;  1EWO A;  2BDL A;  3P5U A;  3KW9 A;  2ACT A;  1S4V A;  2GHU A;  3ZUA A;  5CHV A;  3WXF A;  1CSB B;  3BB7 A;  2DC9 A;  2HD5 A;  3KX1 A;  5J94 A;  4D8I A;  2IBI A;  3LFY A;  1MEM A;  2AYO A;  3MHS A;  1ATK A;  2AYN A;  1ICF A;  3KKU A;  4IP3 A;  5FPW A;  1Y08 A;  4XUI A;  5F02 A;  3PDF A;  2R9O A;  2HH5 A;  2AUX A;  2HWK A;  2B1N A;  2J7Q A;  2F1G A;  3IOQ A;  3N3K A;  2DC6 A;  4M0W A;  4XZX A;  4AXM A;  4FIP A;  4I07 A;  3ERV A;  1THE A;  3MJ5 A;  2YJ2 A;  3BCN A;  5EGW A;  2OZ2 A;  4P16 A;  1CTE A;  3RVV A;  1IWD A;  1KFU L;  3K8U A;  2AS8 A;  4Q8H A;  3PHW A;  4REZ A;  2YJ9 A;  3CH2 X;  2NQG A;  2FRA A;  5CHT A;  1MS6 A;  2DZY A;  1ITO A;  4D8B A;  5JA7 A;  4MSX A;  3WXE A;  1CS8 A;  3H89 A;  2HHN A;  4D8E A;  2AIM A;  1KHP A;  4QBB A;  1AU0 A;  1VSN A;  4HWY A;  1O0E A;  1POP A;  4YYR A;  3P5V A;  3W30 A;  2GFO A;  2O6X A;  4KLB A;  3PW3 A;  4BOP A;  2FYE A;  4DMX A;  4YYQ A;  1QDQ A;  2AUZ A;  3B79 A;  2B1M A;  2E02 A;  3O1G A;  4YV8 A;  2P0R A;  1STF E;  2XU1 A;  3U8E A;  4W4U A;  3V6E A;  2R9M A;  3OIS A;  1M6D A;  4AXL A;  2JRI A;  2G6D A;  2H7J A;  3MOR A;  4YYS A;  3C0R A;  3AI8 A;  2AGA A;  4OVZ A;  4ZTB A;  5E6J A;  4WA6 A;  3S3Q A;  2FT2 A;  2NQD B;  4W5B A;  3C9E A;  1EWL A;  3BC3 A;  3BWK A;  1DKI A;  2OP3 A;  5PAD A;  2DZZ A;  3BBA A;  4R3D A;  4FJC A;  4RKX A;  2BTW A;  4P6E A;  3TNX A;  1MEG A;  3K9M A;  1EF7 A;  4BQV A;  2DOS A;  3OF8 A;  2DJF B;  1VJV A;  4MZS A;  2FE8 A;  1AYV A;  9PAP A;  3IFU A;  3IV2 A;  4I04 A;  1SP4 B;  3I3T A;  1PPD A;  2HXZ A;  4MI7 A;  3RNV A;  1QMY A;  4CDF B;  4N79 A;  2VHS A;  3HHA A;  1F2B A;  2R9C A;  1CQD A;  1PE6 A;  3PRP A;  2DC8 A;  2WBF X;  1TU6 A;  5CVO B;  1MDW A;  1CPJ A;  2JTC A;  1SNK A;  3CH3 X;  1NL6 A;  4QRG A;  1YZB A;  4YYW A;  1YT7 A;  3V6C A;  1PXV A;  3W31 A;  2G7Y A;  1CVZ A;  3KSE A;  3MTV A;  1AIM A;  4BOZ A;  2DCC A;  4GUA A;  3M99 A;  1UKF A;  3DF0 A;  2DJG B;  3E9S A;  1GEC E;  4K7C A;  1CV8 A;  1EWP A;  4BSQ A;  2Y5B A;  2DCD A;  1YK8 A;  3S3R A;  4N4Z A;  4IUM A;  3KFQ A;  5EF4 A;  1JQP A;  1XKG A;  1ZIV A;  3PSE A;  1GCB A;  4CDC B;  4PP2 E;  4OVZ B;  1U9V A;  4Q8G A;  1MIR A;  2E03 A;  3TRK A;  3KWZ A;  4X6H A;  1BY8 A;  4RY2 A;  5EZQ A;  4BS5 A;  1U9X A;  1YAL A;  3IHP A;  2ATO A;  4W5C A;  1PBH A;  3E1Z B;  3KWB X;  4XR7 A;  4OEM A;  4X6I A;  1KXR A;  2XU4 A;  1NPZ A;  2E01 A;  4YVA A;  4MM3 B; 
#chains in the Genus database with same CATH homology
 3IMA A;  1BP4 A;  3BPF A;  1X9Y A;  3OVX A;  5K16 A;  4CDE B;  4YYV A;  4CDD B;  5CVM A;  2NQI A;  2CB5 A;  1PPO A;  1Y4H A;  3QJ3 A;  3PNR A;  4DMY A;  3RVW A;  3HWN A;  5CVN B;  2YJB A;  1QOL A;  1QXP A;  1Q6K A;  1F2C A;  2PNS A;  3F75 A;  3GCB A;  2XU5 A;  3K24 A;  3PBH A;  4QRV A;  2YJ8 A;  3MHH A;  1AYU A;  1AU3 A;  2VFB A;  3RVX A;  2DC7 A;  2AVW A;  1ME3 A;  8PCH A;  3NHE A;  1U9W A;  2JQG R;  4OEL A;  1BQI A;  2XU3 A;  1AYW A;  3F5V A;  4QRX A;  3BOW A;  2P86 A;  2PBH A;  1ZCM A;  3HHI A;  1KFX L;  4X6J A;  1YVB A;  2PAD A;  3IEJ A;  5JH3 A;  3BPM A;  1A6R A;  2DCB A;  1KHQ A;  1PPP A;  3OVZ A;  3N4C A;  3H6S A;  4PAD A;  2R9F A;  2FO5 A;  3LXS A;  2NQA A;  1TLO A;  3H7D A;  2F7D A;  4G54 A;  5A24 A;  3OF9 A;  2JQF R;  1DF0 A;  1ME4 A;  3O0U A;  1NQC A;  3D6S A;  4PP1 A;  4N8W A;  1PAD A;  2FUD A;  3I06 A;  3HD3 A;  1CJL A;  2R6N A;  1FH0 A;  3H8B A;  1K3B B;  1TL9 A;  2OUL A;  4ZUX U;  1GLO A;  1PIP A;  2BDZ A;  4BS6 A;  2FQ9 A;  4I05 A;  1BGO A;  1EWM A;  1PPN A;  1NB3 A;  6PAD A;  2P7U A;  3LTW A;  4C5P A;  1PCI A;  4PI3 A;  2VHF A;  4CZW A;  1AU2 A;  3QT4 A;  4FK5 A;  2IPP B;  1W4T A;  1NB5 A;  3CBJ A;  2YJC A;  1AEC A;  3P5W A;  2BSZ A;  2G8E A;  1U9Q X;  3N3G A;  2ARY A;  4P6G A;  1HUC B;  2E00 A;  1AU4 A;  3MTN A;  2FTD A;  1U5I A;  3P5X A;  2G8J A;  2DCA A;  1DEU A;  3IUT A;  3USV A;  4YYU A;  2Y6E A;  1NLJ A;  4QH6 A;  1CB5 A;  1MHW A;  2CIO A;  3CBK A;  4BPV A;  2R9N A;  3H8C A;  1GMY A;  7PCK A;  1F29 A;  2C0Y A;  3QSD A;  4MZO A;  2AU1 A;  2PRE A;  1YK7 A;  1F2A A;  3WXG A;  2FRQ A;  1EWO A;  2BDL A;  3P5U A;  3KW9 A;  2ACT A;  1S4V A;  2GHU A;  3ZUA A;  5CHV A;  3WXF A;  1CSB B;  2DC9 A;  2HD5 A;  1GX3 A;  3KX1 A;  5J94 A;  2IBI A;  3LFY A;  1MEM A;  2AYO A;  3MHS A;  1ATK A;  2AYN A;  1ICF A;  3KKU A;  5FPW A;  1Y08 A;  4XUI A;  5F02 A;  3PDF A;  2R9O A;  4BGF A;  2HH5 A;  2AUX A;  2B1N A;  2F1G A;  3IOQ A;  3N3K A;  2DC6 A;  4AXM A;  4FIP A;  4I07 A;  3ERV A;  1THE A;  2YJ2 A;  3BCN A;  5EGW A;  2OZ2 A;  1CTE A;  3RVV A;  1W5R A;  1IWD A;  1KFU L;  3K8U A;  2AS8 A;  4Q8H A;  2YJ9 A;  3CH2 X;  2NQG A;  2FRA A;  5CHT A;  1MS6 A;  2DZY A;  1ITO A;  1W6F A;  5JA7 A;  4MSX A;  3WXE A;  1CS8 A;  3H89 A;  2HHN A;  2AIM A;  1KHP A;  4QBB A;  1AU0 A;  1VSN A;  4HWY A;  1O0E A;  1POP A;  4YYR A;  3P5V A;  2GFO A;  2O6X A;  4KLB A;  3PW3 A;  2FYE A;  4DMX A;  4YYQ A;  1QDQ A;  2AUZ A;  3B79 A;  2B1M A;  2E02 A;  3O1G A;  4YV8 A;  2P0R A;  1STF E;  2XU1 A;  3U8E A;  4W4U A;  3V6E A;  2R9M A;  3OIS A;  1M6D A;  4AXL A;  2G6D A;  2H7J A;  3MOR A;  4YYS A;  3AI8 A;  4B55 A;  4WA6 A;  3S3Q A;  2FT2 A;  2NQD B;  4W5B A;  3C9E A;  1EWL A;  3BC3 A;  3BWK A;  3D9W A;  2OP3 A;  5PAD A;  2DZZ A;  4FJC A;  4P6E A;  3TNX A;  1MEG A;  3K9M A;  1EF7 A;  4NV7 A;  4BQV A;  3OF8 A;  2DJF B;  1VJV A;  4MZS A;  1E2T A;  1AYV A;  9PAP A;  3IV2 A;  4I04 A;  1SP4 B;  3I3T A;  1PPD A;  2HXZ A;  1QMY A;  4CDF B;  4N79 A;  2VHS A;  3HHA A;  1F2B A;  2R9C A;  1CQD A;  1PE6 A;  2DC8 A;  2WBF X;  1TU6 A;  5CVO B;  1MDW A;  1CPJ A;  4NV8 A;  1SNK A;  3CH3 X;  1NL6 A;  4QRG A;  4YYW A;  1YT7 A;  3V6C A;  1PXV A;  2G7Y A;  1CVZ A;  3KSE A;  1AIM A;  2DCC A;  3M99 A;  3DF0 A;  2DJG B;  1GEC E;  4K7C A;  1CV8 A;  1EWP A;  4BSQ A;  2Y5B A;  2DCD A;  1YK8 A;  3S3R A;  4N4Z A;  3KFQ A;  5EF4 A;  1JQP A;  1XKG A;  1ZIV A;  1GCB A;  4CDC B;  4PP2 E;  1U9V A;  4GUZ A;  4Q8G A;  1MIR A;  2E03 A;  2VFC A;  3KWZ A;  4X6H A;  1BY8 A;  4RY2 A;  4BS5 A;  1U9X A;  1YAL A;  3IHP A;  2ATO A;  4W5C A;  1PBH A;  3E1Z B;  3KWB X;  4XR7 A;  4OEM A;  4X6I A;  1KXR A;  2XU4 A;  1NPZ A;  2E01 A;  4YVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...