3F75A

Activated toxoplasma gondii cathepsin l (tgcpl) in complex with its propeptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
VLPSELPAGVDWRSRGCVTPVKDQRDCGSCWAFSTTGALEGAHCAKTGKLVSLSEQELMDCSRAEGNQSCSGGEMNDAFQYVLDSGGICSEDAYPYLARDEECRAQSCEKVVKILGFKDVPRRSEAAMKAALAKSPVSIAIEADQMPFQFYHEGVFDASCGTDLDHGVLLVGYGTDKESKKDFWIMKNSWGTGWGRDGYMYMAMHKGEEGQCGLLLDASFPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L Protease
publication title Toxoplasma gondii cathepsin L is the primary target of the invasion-inhibitory compound morpholinurea-leucyl-homophenyl-vinyl sulfone phenyl.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Hydrolase
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3f75A00
1MEGA 1U9XA 4PP2E 2CIOA 5JH3A 3H8CA 2AYOA 1PPPA 3BC3A 2G8JA 3H7DA 3PW3A 2B1NA 3KWBX 2R9NA 1CB5A 2CB5A 2DC9A 1F2AA 2DCDA 1AU4A 2Y6EA 1DEUA 2XU4A 4P6GA 3BPMA 1NPZA 1CSBB 4OEMA 3WXEA 4OELA 3BOWA 2YJ2A 3OVZA 3OF9A 5CVOB 4CZWA 1AYVA 1JQPA 5CVMA 3OISA 4PI3A 4I07A 4BQVA 1ITOA 2FO5A 1TL9A 1ATKA 3DF0A 8PCHA 1YALA 2GHUA 3C9EA 2R9CA 5JA7A 3WXGA 4MZSA 4QRXA 1KXRA 3OF8A 2E03A 3P5XA 2E01A 4N8WA 1PBHA 2VHSA 4P6EA 1CQDA 1CS8A 4BS5A 1ZIVA 3U8EA 1POPA 4BS6A 2E00A 4CDDB 2DC8A 1ICFA 1MEMA 1GMYA 2R6NA 2DJFB 3BCNA 4DMXA 2P0RA 2XU1A 4CDFB 4RY2A 4W5CA 3F75A 1PPOA 2G7YA 1CPJA 2HXZA 4QRVA 4W4UA 1EWMA 3HHIA 1GCBA 4I04A 2B1MA 2IBIA 1IWDA 4PADA 2YJ8A 1SP4B 2DCBA 1AU3A 2BDLA 1U9WA 4ZUXU 1PE6A 3S3RA 2AS8A 1F29A 1O0EA 1SNKA 1MHWA 4YYWA 2FYEA 5K16A 5CVNB 1MDWA 3QJ3A 3H89A 1KFUL 1S4VA 2OP3A 4CDCB 4FK5A 1NB3A 4YYRA 1F2BA 2YJBA 3IEJA 3RVXA 2XU5A 3H6SA 1QOLA 2NQGA 3H8BA 1STFE 3K8UA 3PDFA 5FPWA 3WXFA 2R9FA 3V6EA 2Y5BA 4I05A 1U9QX 3B79A 5EF4A 4QRGA 2HH5A 3MTNA 1NL6A 3CBKA 3F5VA 1EWLA 3MORA 3K9MA 4N4ZA 2FTDA 2FRQA 3O1GA 1CJLA 2HD5A 2R9MA 3USVA 2PBHA 2ARYA 4Q8GA 2AUXA 4YYUA 4X6IA 2VHFA 3TNXA 1Y08A 3MHHA 1U9VA 2O6XA 4BPVA 6PADA 3V6CA 3KWZA 1PCIA 1Q6KA 4CDEB 2FUDA 2BDZA 3N3GA 1QXPA 5EGWA 1BP4A 4HWYA 2AU1A 3D6SA 1NLJA 2DZZA 1CTEA 4MZOA 3CH2X 3AI8A 2E02A 4MSXA 1BY8A 1YK8A 3KW9A 1KHQA 2F7DA 4XR7A 1X9YA 2HHNA 3OVXA 2FRAA 1F2CA 3E1ZB 4QBBA 4WA6A 2IPPB 1FH0A 2YJ9A 2DCAA 1YVBA 2PNSA 3CH3X 5J94A 4K7CA 1ZCMA 1K3BB 1MIRA 2NQAA 3PNRA 3LFYA 1AU0A 2JQFR 3IHPA 1A6RA 4KLBA 1THEA 4PP1A 1TLOA 2DZYA 3NHEA 4FJCA 4AXMA 3KSEA 2P86A 1CVZA 1NQCA 2DJGB 4XUIA 4X6JA 4QH6A 1PPNA 4BSQA 1EF7A 1AYWA 1AU2A 1VSNA 3M99A 5CHTA 2OULA 2C0YA 3BPFA 9PAPA 1AIMA 3IV2A 2AYNA 2F1GA 3N3KA 1M6DA 2GFOA 3KKUA 1ME4A 5PADA 3IMAA 3QT4A 4YVAA 7PCKA 3ERVA 1VJVA 2ATOA 3HWNA 3N4CA 2P7UA 4W5BA 1QMYA 3BWKA 2OZ2A 1KFXL 2G6DA 2ACTA 3CBJA 1GLOA 3PBHA 3QSDA 2XU3A 1Y4HA 5F02A 2NQIA 2G8EA 2AVWA 2WBFX 3LXSA 3RVVA 3P5VA 3KFQA 5CHVA 1GECE 4N79A 3HD3A 2DCCA 3S3QA 3KX1A 1AYUA 4YV8A 5A24A 1NB5A 1PADA 2FQ9A 3IUTA 3O0UA 2PREA 3ZUAA 1U5IA 2FT2A 1EWOA 2YJCA 1TU6A 1ME3A 3K24A 1BQIA 4FIPA 2AIMA 3GCBA 2H7JA 1PPDA 4YYVA 1DF0A 2NQDB 1AECA 1BGOA 1PIPA 4Q8HA 3I3TA 2DC7A 3HHAA 1QDQA 1YK7A 4X6HA 4G54A 3P5UA 3RVWA 1CV8A 1EWPA 1MS6A 4YYSA 2PADA 1KHPA 1HUCB 3MHSA 2JQGR 1XKGA 3I06A 2AUZA 2R9OA 3P5WA 2DC6A 1YT7A 1PXVA 3IOQA 4DMYA 4AXLA 4YYQA
chains in the Genus database with same CATH superfamily
1MEGA 2BTWA 1U9XA 4PP2E 2CIOA 5JH3A 3H8CA 5E6JA 2AYOA 1PPPA 3BC3A 2G8JA 3H7DA 3PHXA 3PW3A 2B1NA 3KWBX 2R9NA 4PT5A 1CB5A 2CB5A 2DC9A 1F2AA 2DCDA 1AU4A 2Y6EA 4IUMA 1DEUA 2XU4A 4P6GA 2BTWB 4P16A 3BPMA 1UKFA 1NPZA 1CSBB 4D8BA 4OEMA 3WXEA 4OELA 3BOWA 4IP3A 2YJ2A 3OVZA 3OF9A 5CVOB 4CZWA 1AYVA 1JQPA 5CVMA 3OISA 4PI3A 4I07A 4BQVA 1ITOA 2FO5A 1TL9A 1ATKA 3DF0A 8PCHA 1YALA 2GHUA 3C9EA 2R9CA 5JA7A 3WXGA 4MZSA 4QRXA 1KXRA 3MTVA 3OF8A 2E03A 3P5XA 2E01A 4N8WA 1PBHA 2VHSA 4P6EA 1CQDA 3C0RA 1CS8A 4BOUA 4BS5A 1ZIVA 3U8EA 1POPA 5EZQA 4BS6A 2E00A 4CDDB 1YZBA 2DC8A 1ICFA 1MEMA 1GMYA 2R6NA 4BOSA 2DJFB 3BCNA 4DMXA 2P0RA 2XU1A 4CDFB 4RY2A 4W5CA 3F75A 1PPOA 2G7YA 1CPJA 2FE8A 2HXZA 4HXDB 4QRVA 4W4UA 1EWMA 3HHIA 1GCBA 4I04A 2B1MA 2IBIA 1IWDA 4PADA 2YJ8A 3PHWA 1SP4B 2DCBA 2BU3A 4OW0A 4R3DA 1AU3A 2BDLA 1U9WA 4ZUXU 1PE6A 3S3RA 2AS8A 1F29A 1O0EA 1SNKA 1MHWA 4YYWA 2FYEA 5K16A 5CVNB 1MDWA 2Z84A 3QJ3A 3H89A 1KFUL 1S4VA 2OP3A 4CDCB 4FK5A 1NB3A 4YYRA 1F2BA 2YJBA 3BB7A 4OVZA 4WURA 3IEJA 3RVXA 2XU5A 3RNVA 3H6SA 1QOLA 2NQGA 4D8IA 3H8BA 1STFE 4MM3B 3W30A 3K8UA 3PDFA 5FPWA 3WXFA 2R9FA 5JZEA 3V6EA 2Y5BA 4I05A 1U9QX 3B79A 5EF4A 4QRGA 4OVZB 2HH5A 3MTNA 1NL6A 3CBKA 3F5VA 1EWLA 3MORA 3K9MA 3MJ5A 4N4ZA 2FTDA 2FRQA 3O1GA 1CJLA 4RF0A 2HD5A 2R9MA 3USVA 2PBHA 2ARYA 4Q8GA 4XZXA 2AUXA 4YYUA 4RNAA 4X6IA 2JRIA 2VHFA 4RF1A 3PRPA 3TNXA 5EZSA 3O65A 1Y08A 3MHHA 1U9VA 2O6XA 4BOPA 4BPVA 6PADA 3V6CA 3KWZA 1PCIA 1Q6KA 3TRKA 3PSEA 4CDEB 2FUDA 2BDZA 3B21A 3N3GA 1QXPA 5EGWA 1BP4A 4HWYA 2AU1A 3D6SA 1NLJA 2DZZA 1CTEA 4MZOA 3CH2X 3AI8A 4MI7A 2E02A 4MSXA 1BY8A 1YK8A 3KW9A 1KHQA 2F7DA 4XR7A 1X9YA 2HHNA 3OVXA 2FRAA 1F2CA 3E1ZB 4QBBA 4WA6A 2IPPB 3PRMA 1FH0A 2YJ9A 2DOSA 3PT2A 2DCAA 1YVBA 2PNSA 3CH3X 5J94A 4K7CA 1ZCMA 4A5UA 1K3BB 1MIRA 2NQAA 3PNRA 3LFYA 3IFUA 1AU0A 2HWKA 2JQFR 3E9SA 1A6RA 3IHPA 4KLBA 1THEA 4PP1A 1TLOA 2DZYA 3NHEA 4FJCA 4AXMA 4D8EA 3KSEA 2P86A 1CVZA 3BBAA 1NQCA 2DJGB 4XUIA 4X6JA 3BY4A 4QH6A 1PPNA 4BSQA 1EF7A 1AYWA 1AU2A 1VSNA 3M99A 5CHTA 4RKXA 2OULA 3TMPA 2C0YA 3BPFA 4REZA 9PAPA 1AIMA 3MP2A 3IV2A 2AYNA 2F1GA 3N3KA 1M6DA 2GFOA 3KKUA 1ME4A 1DKIA 5PADA 3IMAA 3QT4A 4YVAA 7PCKA 3ERVA 1VJVA 2ATOA 3HWNA 3N4CA 2P7UA 4W5BA 1QMYA 3BWKA 2OZ2A 1KFXL 2G6DA 2ACTA 3CBJA 1GLOA 3PBHA 3QSDA 2XU3A 4ZTBA 2J7QA 1Y4HA 5F02A 2NQIA 2G8EA 2AVWA 2WBFX 3LXSA 3RVVA 3P5VA 3KFQA 5CHVA 1GECE 4N79A 3HD3A 4BOZA 2DCCA 3S3QA 3KX1A 3PHUA 1AYUA 4YV8A 5A24A 3ZNHA 1NB5A 1PADA 2FQ9A 2UZJA 3IUTA 3O0UA 5KO3A 2PREA 2AGAA 3ZUAA 1U5IA 2FT2A 1EWOA 2YJCA 1TU6A 1ME3A 3K24A 1BQIA 4FIPA 2AIMA 4M0WA 3GCBA 2H7JA 1PPDA 4YYVA 1DF0A 2NQDB 1AECA 1BGOA 1PIPA 4Q8HA 3W31A 3I3TA 2DC7A 3HHAA 1QDQA 1YK7A 4X6HA 4G54A 3P5UA 3RVWA 1CV8A 1EWPA 1MS6A 4YYSA 2J7QC 2PADA 3OQCA 1KHPA 1PVJA 2JTCA 1HUCB 4BOQA 3MHSA 2JQGR 1XKGA 3I06A 2AUZA 2R9OA 3P5WA 2DC6A 1YT7A 1PXVA 3IOQA 4DMYA 4AXLA 4GUAA 4YYQA
chains in the Genus database with same CATH topology
1MEGA 1U9XA 4PP2E 2VFBA 2CIOA 5JH3A 3H8CA 2AYOA 1PPPA 3BC3A 2G8JA 3H7DA 3PW3A 2B1NA 3KWBX 2R9NA 1CB5A 2CB5A 2DC9A 1F2AA 2DCDA 1AU4A 2Y6EA 1DEUA 2XU4A 4P6GA 3BPMA 4BGFA 1NPZA 1CSBB 4OEMA 3WXEA 4OELA 3BOWA 2YJ2A 3OVZA 3OF9A 5CVOB 4CZWA 1AYVA 1JQPA 5CVMA 3OISA 4PI3A 4I07A 4BQVA 1ITOA 2FO5A 1TL9A 1ATKA 3DF0A 8PCHA 1YALA 2GHUA 3C9EA 2R9CA 5JA7A 3WXGA 4MZSA 4QRXA 1KXRA 3OF8A 2E03A 3P5XA 2E01A 4N8WA 3D9WA 1PBHA 2VHSA 4P6EA 1CQDA 1CS8A 4BS5A 1ZIVA 3U8EA 1POPA 4BS6A 2E00A 4CDDB 2DC8A 1ICFA 1MEMA 1GMYA 2R6NA 2DJFB 3BCNA 4DMXA 2P0RA 2XU1A 4CDFB 4RY2A 1GX3A 4W5CA 3F75A 1PPOA 2G7YA 1CPJA 2HXZA 4QRVA 4W4UA 1EWMA 3HHIA 1GCBA 4I04A 2B1MA 4NV8A 2IBIA 1IWDA 4PADA 2YJ8A 4NV7A 1SP4B 2DCBA 1AU3A 2BDLA 1U9WA 4ZUXU 1PE6A 3S3RA 2AS8A 1F29A 1O0EA 1SNKA 1MHWA 4B55A 4YYWA 2FYEA 5K16A 4GUZA 5CVNB 1MDWA 3QJ3A 3H89A 1KFUL 1S4VA 2OP3A 4CDCB 4FK5A 1NB3A 4YYRA 1F2BA 1E2TA 2YJBA 3IEJA 3RVXA 2XU5A 2VFCA 3H6SA 1QOLA 2NQGA 3H8BA 1STFE 3K8UA 3PDFA 5FPWA 3WXFA 2R9FA 3V6EA 2Y5BA 4I05A 1U9QX 3B79A 5EF4A 4QRGA 2HH5A 3MTNA 1NL6A 3CBKA 3F5VA 1EWLA 3MORA 3K9MA 4N4ZA 2FTDA 2FRQA 3O1GA 1CJLA 2HD5A 2R9MA 3USVA 2PBHA 2ARYA 4Q8GA 2AUXA 4YYUA 4X6IA 2VHFA 3TNXA 1Y08A 3MHHA 1U9VA 2O6XA 4BPVA 6PADA 3V6CA 3KWZA 1PCIA 1Q6KA 4CDEB 2FUDA 2BDZA 3N3GA 1QXPA 5EGWA 1BP4A 4HWYA 2AU1A 3D6SA 1NLJA 2DZZA 1CTEA 4MZOA 3CH2X 3AI8A 2E02A 4MSXA 1BY8A 1YK8A 3KW9A 1KHQA 2F7DA 4XR7A 1X9YA 2HHNA 3OVXA 2FRAA 1F2CA 3E1ZB 4QBBA 4WA6A 2IPPB 1FH0A 2YJ9A 2DCAA 1YVBA 2PNSA 3CH3X 5J94A 4K7CA 1ZCMA 1K3BB 1MIRA 2NQAA 3PNRA 3LFYA 1AU0A 2JQFR 3IHPA 1A6RA 4KLBA 1THEA 4PP1A 1TLOA 2DZYA 3NHEA 4FJCA 4AXMA 3KSEA 2P86A 1CVZA 1NQCA 2DJGB 4XUIA 4X6JA 4QH6A 1PPNA 4BSQA 1EF7A 1AYWA 1AU2A 1VSNA 3M99A 5CHTA 2OULA 2C0YA 3BPFA 9PAPA 1AIMA 3IV2A 2AYNA 2F1GA 3N3KA 1M6DA 2GFOA 3KKUA 1ME4A 5PADA 3IMAA 3QT4A 4YVAA 7PCKA 3ERVA 1VJVA 2ATOA 1W4TA 3HWNA 3N4CA 2P7UA 4W5BA 1QMYA 3BWKA 2OZ2A 1KFXL 2G6DA 2ACTA 3CBJA 1GLOA 3PBHA 3QSDA 2XU3A 1Y4HA 5F02A 2NQIA 2G8EA 2AVWA 2WBFX 3LXSA 3RVVA 3P5VA 3KFQA 3LTWA 5CHVA 1GECE 4N79A 3HD3A 2DCCA 3S3QA 3KX1A 2BSZA 1AYUA 4YV8A 5A24A 1NB5A 1PADA 2FQ9A 3IUTA 3O0UA 2PREA 3ZUAA 1U5IA 2FT2A 1EWOA 2YJCA 1TU6A 1ME3A 3K24A 1BQIA 4FIPA 2AIMA 1W5RA 3GCBA 2H7JA 1PPDA 4YYVA 1DF0A 2NQDB 1AECA 1BGOA 1PIPA 4Q8HA 3I3TA 2DC7A 3HHAA 1QDQA 1YK7A 4X6HA 4G54A 3P5UA 3RVWA 1CV8A 1EWPA 1MS6A 4C5PA 4YYSA 2PADA 1W6FA 1KHPA 1HUCB 3MHSA 2JQGR 1XKGA 3I06A 2AUZA 2R9OA 3P5WA 2DC6A 1YT7A 1PXVA 3IOQA 4DMYA 4AXLA 4YYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MEG A;  1U9X A;  4PP2 E;  2CIO A;  5JH3 A;  3H8C A;  2AYO A;  1PPP A;  3BC3 A;  2G8J A;  3H7D A;  3PW3 A;  2B1N A;  3KWB X;  2R9N A;  1CB5 A;  2CB5 A;  2DC9 A;  1F2A A;  2DCD A;  1AU4 A;  2Y6E A;  1DEU A;  2XU4 A;  4P6G A;  3BPM A;  1NPZ A;  1CSB B;  4OEM A;  3WXE A;  4OEL A;  3BOW A;  2YJ2 A;  3OVZ A;  3OF9 A;  5CVO B;  4CZW A;  1AYV A;  1JQP A;  5CVM A;  3OIS A;  4PI3 A;  4I07 A;  4BQV A;  1ITO A;  2FO5 A;  1TL9 A;  1ATK A;  3DF0 A;  8PCH A;  1YAL A;  2GHU A;  3C9E A;  2R9C A;  5JA7 A;  3WXG A;  4MZS A;  4QRX A;  1KXR A;  3OF8 A;  2E03 A;  3P5X A;  2E01 A;  4N8W A;  1PBH A;  2VHS A;  4P6E A;  1CQD A;  1CS8 A;  4BS5 A;  1ZIV A;  3U8E A;  1POP A;  4BS6 A;  2E00 A;  4CDD B;  2DC8 A;  1ICF A;  1MEM A;  1GMY A;  2R6N A;  2DJF B;  3BCN A;  4DMX A;  2P0R A;  2XU1 A;  4CDF B;  4RY2 A;  4W5C A;  3F75 A;  1PPO A;  2G7Y A;  1CPJ A;  2HXZ A;  4QRV A;  4W4U A;  1EWM A;  3HHI A;  1GCB A;  4I04 A;  2B1M A;  2IBI A;  1IWD A;  4PAD A;  2YJ8 A;  1SP4 B;  2DCB A;  1AU3 A;  2BDL A;  1U9W A;  4ZUX U;  1PE6 A;  3S3R A;  2AS8 A;  1F29 A;  1O0E A;  1SNK A;  1MHW A;  4YYW A;  2FYE A;  5K16 A;  5CVN B;  1MDW A;  3QJ3 A;  3H89 A;  1KFU L;  1S4V A;  2OP3 A;  4CDC B;  4FK5 A;  1NB3 A;  4YYR A;  1F2B A;  2YJB A;  3IEJ A;  3RVX A;  2XU5 A;  3H6S A;  1QOL A;  2NQG A;  3H8B A;  1STF E;  3K8U A;  3PDF A;  5FPW A;  3WXF A;  2R9F A;  3V6E A;  2Y5B A;  4I05 A;  1U9Q X;  3B79 A;  5EF4 A;  4QRG A;  2HH5 A;  3MTN A;  1NL6 A;  3CBK A;  3F5V A;  1EWL A;  3MOR A;  3K9M A;  4N4Z A;  2FTD A;  2FRQ A;  3O1G A;  1CJL A;  2HD5 A;  2R9M A;  3USV A;  2PBH A;  2ARY A;  4Q8G A;  2AUX A;  4YYU A;  4X6I A;  2VHF A;  3TNX A;  1Y08 A;  3MHH A;  1U9V A;  2O6X A;  4BPV A;  6PAD A;  3V6C A;  3KWZ A;  1PCI A;  1Q6K A;  4CDE B;  2FUD A;  2BDZ A;  3N3G A;  1QXP A;  5EGW A;  1BP4 A;  4HWY A;  2AU1 A;  3D6S A;  1NLJ A;  2DZZ A;  1CTE A;  4MZO A;  3CH2 X;  3AI8 A;  2E02 A;  4MSX A;  1BY8 A;  1YK8 A;  3KW9 A;  1KHQ A;  2F7D A;  4XR7 A;  1X9Y A;  2HHN A;  3OVX A;  2FRA A;  1F2C A;  3E1Z B;  4QBB A;  4WA6 A;  2IPP B;  1FH0 A;  2YJ9 A;  2DCA A;  1YVB A;  2PNS A;  3CH3 X;  5J94 A;  4K7C A;  1ZCM A;  1K3B B;  1MIR A;  2NQA A;  3PNR A;  3LFY A;  1AU0 A;  2JQF R;  3IHP A;  1A6R A;  4KLB A;  1THE A;  4PP1 A;  1TLO A;  2DZY A;  3NHE A;  4FJC A;  4AXM A;  3KSE A;  2P86 A;  1CVZ A;  1NQC A;  2DJG B;  4XUI A;  4X6J A;  4QH6 A;  1PPN A;  4BSQ A;  1EF7 A;  1AYW A;  1AU2 A;  1VSN A;  3M99 A;  5CHT A;  2OUL A;  2C0Y A;  3BPF A;  9PAP A;  1AIM A;  3IV2 A;  2AYN A;  2F1G A;  3N3K A;  1M6D A;  2GFO A;  3KKU A;  1ME4 A;  5PAD A;  3IMA A;  3QT4 A;  4YVA A;  7PCK A;  3ERV A;  1VJV A;  2ATO A;  3HWN A;  3N4C A;  2P7U A;  4W5B A;  1QMY A;  3BWK A;  2OZ2 A;  1KFX L;  2G6D A;  2ACT A;  3CBJ A;  1GLO A;  3PBH A;  3QSD A;  2XU3 A;  1Y4H A;  5F02 A;  2NQI A;  2G8E A;  2AVW A;  2WBF X;  3LXS A;  3RVV A;  3P5V A;  3KFQ A;  5CHV A;  1GEC E;  4N79 A;  3HD3 A;  2DCC A;  3S3Q A;  3KX1 A;  1AYU A;  4YV8 A;  5A24 A;  1NB5 A;  1PAD A;  2FQ9 A;  3IUT A;  3O0U A;  2PRE A;  3ZUA A;  1U5I A;  2FT2 A;  1EWO A;  2YJC A;  1TU6 A;  1ME3 A;  3K24 A;  1BQI A;  4FIP A;  2AIM A;  3GCB A;  2H7J A;  1PPD A;  4YYV A;  1DF0 A;  2NQD B;  1AEC A;  1BGO A;  1PIP A;  4Q8H A;  3I3T A;  2DC7 A;  3HHA A;  1QDQ A;  1YK7 A;  4X6H A;  4G54 A;  3P5U A;  3RVW A;  1CV8 A;  1EWP A;  1MS6 A;  4YYS A;  2PAD A;  1KHP A;  1HUC B;  3MHS A;  2JQG R;  1XKG A;  3I06 A;  2AUZ A;  2R9O A;  3P5W A;  2DC6 A;  1YT7 A;  1PXV A;  3IOQ A;  4DMY A;  4AXL A;  4YYQ A; 
#chains in the Genus database with same CATH topology
 1MEG A;  2BTW A;  1U9X A;  4PP2 E;  2CIO A;  5JH3 A;  3H8C A;  5E6J A;  2AYO A;  1PPP A;  3BC3 A;  2G8J A;  3H7D A;  3PHX A;  3PW3 A;  2B1N A;  3KWB X;  2R9N A;  4PT5 A;  1CB5 A;  2CB5 A;  2DC9 A;  1F2A A;  2DCD A;  1AU4 A;  2Y6E A;  4IUM A;  1DEU A;  2XU4 A;  4P6G A;  2BTW B;  4P16 A;  3BPM A;  1UKF A;  1NPZ A;  1CSB B;  4D8B A;  4OEM A;  3WXE A;  4OEL A;  3BOW A;  4IP3 A;  2YJ2 A;  3OVZ A;  3OF9 A;  5CVO B;  4CZW A;  1AYV A;  1JQP A;  5CVM A;  3OIS A;  4PI3 A;  4I07 A;  4BQV A;  1ITO A;  2FO5 A;  1TL9 A;  1ATK A;  3DF0 A;  8PCH A;  1YAL A;  2GHU A;  3C9E A;  2R9C A;  5JA7 A;  3WXG A;  4MZS A;  4QRX A;  1KXR A;  3MTV A;  3OF8 A;  2E03 A;  3P5X A;  2E01 A;  4N8W A;  1PBH A;  2VHS A;  4P6E A;  1CQD A;  3C0R A;  1CS8 A;  4BOU A;  4BS5 A;  1ZIV A;  3U8E A;  1POP A;  5EZQ A;  4BS6 A;  2E00 A;  4CDD B;  1YZB A;  2DC8 A;  1ICF A;  1MEM A;  1GMY A;  2R6N A;  4BOS A;  2DJF B;  3BCN A;  4DMX A;  2P0R A;  2XU1 A;  4CDF B;  4RY2 A;  4W5C A;  3F75 A;  1PPO A;  2G7Y A;  1CPJ A;  2FE8 A;  2HXZ A;  4HXD B;  4QRV A;  4W4U A;  1EWM A;  3HHI A;  1GCB A;  4I04 A;  2B1M A;  2IBI A;  1IWD A;  4PAD A;  2YJ8 A;  3PHW A;  1SP4 B;  2DCB A;  2BU3 A;  4OW0 A;  4R3D A;  1AU3 A;  2BDL A;  1U9W A;  4ZUX U;  1PE6 A;  3S3R A;  2AS8 A;  1F29 A;  1O0E A;  1SNK A;  1MHW A;  4YYW A;  2FYE A;  5K16 A;  5CVN B;  1MDW A;  2Z84 A;  3QJ3 A;  3H89 A;  1KFU L;  1S4V A;  2OP3 A;  4CDC B;  4FK5 A;  1NB3 A;  4YYR A;  1F2B A;  2YJB A;  3BB7 A;  4OVZ A;  4WUR A;  3IEJ A;  3RVX A;  2XU5 A;  3RNV A;  3H6S A;  1QOL A;  2NQG A;  4D8I A;  3H8B A;  1STF E;  4MM3 B;  3W30 A;  3K8U A;  3PDF A;  5FPW A;  3WXF A;  2R9F A;  5JZE A;  3V6E A;  2Y5B A;  4I05 A;  1U9Q X;  3B79 A;  5EF4 A;  4QRG A;  4OVZ B;  2HH5 A;  3MTN A;  1NL6 A;  3CBK A;  3F5V A;  1EWL A;  3MOR A;  3K9M A;  3MJ5 A;  4N4Z A;  2FTD A;  2FRQ A;  3O1G A;  1CJL A;  4RF0 A;  2HD5 A;  2R9M A;  3USV A;  2PBH A;  2ARY A;  4Q8G A;  4XZX A;  2AUX A;  4YYU A;  4RNA A;  4X6I A;  2JRI A;  2VHF A;  4RF1 A;  3PRP A;  3TNX A;  5EZS A;  3O65 A;  1Y08 A;  3MHH A;  1U9V A;  2O6X A;  4BOP A;  4BPV A;  6PAD A;  3V6C A;  3KWZ A;  1PCI A;  1Q6K A;  3TRK A;  3PSE A;  4CDE B;  2FUD A;  2BDZ A;  3B21 A;  3N3G A;  1QXP A;  5EGW A;  1BP4 A;  4HWY A;  2AU1 A;  3D6S A;  1NLJ A;  2DZZ A;  1CTE A;  4MZO A;  3CH2 X;  3AI8 A;  4MI7 A;  2E02 A;  4MSX A;  1BY8 A;  1YK8 A;  3KW9 A;  1KHQ A;  2F7D A;  4XR7 A;  1X9Y A;  2HHN A;  3OVX A;  2FRA A;  1F2C A;  3E1Z B;  4QBB A;  4WA6 A;  2IPP B;  3PRM A;  1FH0 A;  2YJ9 A;  2DOS A;  3PT2 A;  2DCA A;  1YVB A;  2PNS A;  3CH3 X;  5J94 A;  4K7C A;  1ZCM A;  4A5U A;  1K3B B;  1MIR A;  2NQA A;  3PNR A;  3LFY A;  3IFU A;  1AU0 A;  2HWK A;  2JQF R;  3E9S A;  1A6R A;  3IHP A;  4KLB A;  1THE A;  4PP1 A;  1TLO A;  2DZY A;  3NHE A;  4FJC A;  4AXM A;  4D8E A;  3KSE A;  2P86 A;  1CVZ A;  3BBA A;  1NQC A;  2DJG B;  4XUI A;  4X6J A;  3BY4 A;  4QH6 A;  1PPN A;  4BSQ A;  1EF7 A;  1AYW A;  1AU2 A;  1VSN A;  3M99 A;  5CHT A;  4RKX A;  2OUL A;  3TMP A;  2C0Y A;  3BPF A;  4REZ A;  9PAP A;  1AIM A;  3MP2 A;  3IV2 A;  2AYN A;  2F1G A;  3N3K A;  1M6D A;  2GFO A;  3KKU A;  1ME4 A;  1DKI A;  5PAD A;  3IMA A;  3QT4 A;  4YVA A;  7PCK A;  3ERV A;  1VJV A;  2ATO A;  3HWN A;  3N4C A;  2P7U A;  4W5B A;  1QMY A;  3BWK A;  2OZ2 A;  1KFX L;  2G6D A;  2ACT A;  3CBJ A;  1GLO A;  3PBH A;  3QSD A;  2XU3 A;  4ZTB A;  2J7Q A;  1Y4H A;  5F02 A;  2NQI A;  2G8E A;  2AVW A;  2WBF X;  3LXS A;  3RVV A;  3P5V A;  3KFQ A;  5CHV A;  1GEC E;  4N79 A;  3HD3 A;  4BOZ A;  2DCC A;  3S3Q A;  3KX1 A;  3PHU A;  1AYU A;  4YV8 A;  5A24 A;  3ZNH A;  1NB5 A;  1PAD A;  2FQ9 A;  2UZJ A;  3IUT A;  3O0U A;  5KO3 A;  2PRE A;  2AGA A;  3ZUA A;  1U5I A;  2FT2 A;  1EWO A;  2YJC A;  1TU6 A;  1ME3 A;  3K24 A;  1BQI A;  4FIP A;  2AIM A;  4M0W A;  3GCB A;  2H7J A;  1PPD A;  4YYV A;  1DF0 A;  2NQD B;  1AEC A;  1BGO A;  1PIP A;  4Q8H A;  3W31 A;  3I3T A;  2DC7 A;  3HHA A;  1QDQ A;  1YK7 A;  4X6H A;  4G54 A;  3P5U A;  3RVW A;  1CV8 A;  1EWP A;  1MS6 A;  4YYS A;  2J7Q C;  2PAD A;  3OQC A;  1KHP A;  1PVJ A;  2JTC A;  1HUC B;  4BOQ A;  3MHS A;  2JQG R;  1XKG A;  3I06 A;  2AUZ A;  2R9O A;  3P5W A;  2DC6 A;  1YT7 A;  1PXV A;  3IOQ A;  4DMY A;  4AXL A;  4GUA A;  4YYQ A; 
#chains in the Genus database with same CATH homology
 1MEG A;  1U9X A;  4PP2 E;  2VFB A;  2CIO A;  5JH3 A;  3H8C A;  2AYO A;  1PPP A;  3BC3 A;  2G8J A;  3H7D A;  3PW3 A;  2B1N A;  3KWB X;  2R9N A;  1CB5 A;  2CB5 A;  2DC9 A;  1F2A A;  2DCD A;  1AU4 A;  2Y6E A;  1DEU A;  2XU4 A;  4P6G A;  3BPM A;  4BGF A;  1NPZ A;  1CSB B;  4OEM A;  3WXE A;  4OEL A;  3BOW A;  2YJ2 A;  3OVZ A;  3OF9 A;  5CVO B;  4CZW A;  1AYV A;  1JQP A;  5CVM A;  3OIS A;  4PI3 A;  4I07 A;  4BQV A;  1ITO A;  2FO5 A;  1TL9 A;  1ATK A;  3DF0 A;  8PCH A;  1YAL A;  2GHU A;  3C9E A;  2R9C A;  5JA7 A;  3WXG A;  4MZS A;  4QRX A;  1KXR A;  3OF8 A;  2E03 A;  3P5X A;  2E01 A;  4N8W A;  3D9W A;  1PBH A;  2VHS A;  4P6E A;  1CQD A;  1CS8 A;  4BS5 A;  1ZIV A;  3U8E A;  1POP A;  4BS6 A;  2E00 A;  4CDD B;  2DC8 A;  1ICF A;  1MEM A;  1GMY A;  2R6N A;  2DJF B;  3BCN A;  4DMX A;  2P0R A;  2XU1 A;  4CDF B;  4RY2 A;  1GX3 A;  4W5C A;  3F75 A;  1PPO A;  2G7Y A;  1CPJ A;  2HXZ A;  4QRV A;  4W4U A;  1EWM A;  3HHI A;  1GCB A;  4I04 A;  2B1M A;  4NV8 A;  2IBI A;  1IWD A;  4PAD A;  2YJ8 A;  4NV7 A;  1SP4 B;  2DCB A;  1AU3 A;  2BDL A;  1U9W A;  4ZUX U;  1PE6 A;  3S3R A;  2AS8 A;  1F29 A;  1O0E A;  1SNK A;  1MHW A;  4B55 A;  4YYW A;  2FYE A;  5K16 A;  4GUZ A;  5CVN B;  1MDW A;  3QJ3 A;  3H89 A;  1KFU L;  1S4V A;  2OP3 A;  4CDC B;  4FK5 A;  1NB3 A;  4YYR A;  1F2B A;  1E2T A;  2YJB A;  3IEJ A;  3RVX A;  2XU5 A;  2VFC A;  3H6S A;  1QOL A;  2NQG A;  3H8B A;  1STF E;  3K8U A;  3PDF A;  5FPW A;  3WXF A;  2R9F A;  3V6E A;  2Y5B A;  4I05 A;  1U9Q X;  3B79 A;  5EF4 A;  4QRG A;  2HH5 A;  3MTN A;  1NL6 A;  3CBK A;  3F5V A;  1EWL A;  3MOR A;  3K9M A;  4N4Z A;  2FTD A;  2FRQ A;  3O1G A;  1CJL A;  2HD5 A;  2R9M A;  3USV A;  2PBH A;  2ARY A;  4Q8G A;  2AUX A;  4YYU A;  4X6I A;  2VHF A;  3TNX A;  1Y08 A;  3MHH A;  1U9V A;  2O6X A;  4BPV A;  6PAD A;  3V6C A;  3KWZ A;  1PCI A;  1Q6K A;  4CDE B;  2FUD A;  2BDZ A;  3N3G A;  1QXP A;  5EGW A;  1BP4 A;  4HWY A;  2AU1 A;  3D6S A;  1NLJ A;  2DZZ A;  1CTE A;  4MZO A;  3CH2 X;  3AI8 A;  2E02 A;  4MSX A;  1BY8 A;  1YK8 A;  3KW9 A;  1KHQ A;  2F7D A;  4XR7 A;  1X9Y A;  2HHN A;  3OVX A;  2FRA A;  1F2C A;  3E1Z B;  4QBB A;  4WA6 A;  2IPP B;  1FH0 A;  2YJ9 A;  2DCA A;  1YVB A;  2PNS A;  3CH3 X;  5J94 A;  4K7C A;  1ZCM A;  1K3B B;  1MIR A;  2NQA A;  3PNR A;  3LFY A;  1AU0 A;  2JQF R;  3IHP A;  1A6R A;  4KLB A;  1THE A;  4PP1 A;  1TLO A;  2DZY A;  3NHE A;  4FJC A;  4AXM A;  3KSE A;  2P86 A;  1CVZ A;  1NQC A;  2DJG B;  4XUI A;  4X6J A;  4QH6 A;  1PPN A;  4BSQ A;  1EF7 A;  1AYW A;  1AU2 A;  1VSN A;  3M99 A;  5CHT A;  2OUL A;  2C0Y A;  3BPF A;  9PAP A;  1AIM A;  3IV2 A;  2AYN A;  2F1G A;  3N3K A;  1M6D A;  2GFO A;  3KKU A;  1ME4 A;  5PAD A;  3IMA A;  3QT4 A;  4YVA A;  7PCK A;  3ERV A;  1VJV A;  2ATO A;  1W4T A;  3HWN A;  3N4C A;  2P7U A;  4W5B A;  1QMY A;  3BWK A;  2OZ2 A;  1KFX L;  2G6D A;  2ACT A;  3CBJ A;  1GLO A;  3PBH A;  3QSD A;  2XU3 A;  1Y4H A;  5F02 A;  2NQI A;  2G8E A;  2AVW A;  2WBF X;  3LXS A;  3RVV A;  3P5V A;  3KFQ A;  3LTW A;  5CHV A;  1GEC E;  4N79 A;  3HD3 A;  2DCC A;  3S3Q A;  3KX1 A;  2BSZ A;  1AYU A;  4YV8 A;  5A24 A;  1NB5 A;  1PAD A;  2FQ9 A;  3IUT A;  3O0U A;  2PRE A;  3ZUA A;  1U5I A;  2FT2 A;  1EWO A;  2YJC A;  1TU6 A;  1ME3 A;  3K24 A;  1BQI A;  4FIP A;  2AIM A;  1W5R A;  3GCB A;  2H7J A;  1PPD A;  4YYV A;  1DF0 A;  2NQD B;  1AEC A;  1BGO A;  1PIP A;  4Q8H A;  3I3T A;  2DC7 A;  3HHA A;  1QDQ A;  1YK7 A;  4X6H A;  4G54 A;  3P5U A;  3RVW A;  1CV8 A;  1EWP A;  1MS6 A;  4C5P A;  4YYS A;  2PAD A;  1W6F A;  1KHP A;  1HUC B;  3MHS A;  2JQG R;  1XKG A;  3I06 A;  2AUZ A;  2R9O A;  3P5W A;  2DC6 A;  1YT7 A;  1PXV A;  3IOQ A;  4DMY A;  4AXL A;  4YYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...