3F75A

Activated toxoplasma gondii cathepsin l (tgcpl) in complex with its propeptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
223
structure length
223
Chain Sequence
b'VLPSELPAGVDWRSRGCVTPVKDQRDCGSCWAFSTTGALEGAHCAKTGKLVSLSEQELMDCSRAEGNQSCSGGEMNDAFQYVLDSGGICSEDAYPYLARDEECRAQSCEKVVKILGFKDVPRRSEAAMKAALAKSPVSIAIEADQMPFQFYHEGVFDASCGTDLDHGVLLVGYGTDKESKKDFWIMKNSWGTGWGRDGYMYMAMHKGEEGQCGLLLDASFPVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin L Protease
publication title Toxoplasma gondii cathepsin L is the primary target of the invasion-inhibitory compound morpholinurea-leucyl-homophenyl-vinyl sulfone phenyl.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Hydrolase
total genus 67
structure length 223
sequence length 223
ec nomenclature ec 3.4.22.15: Cathepsin L.
pdb deposition date 2008-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 3f75A00
1X9YA 3MTNA 2HHNA 4X6IA 4BS5A 3BPMA 5F02A 3PDFA 2PNSA 2NQIA 4P6GA 2FQ9A 1MDWA 4X6JA 4RY2A 4MZOA 2DC6A 1TLOA 1SP4B 4CDDB 2AUZA 3IEJA 2B1MA 2C0YA 3QJ3A 3PBHA 2ARYA 4YYRA 2FUDA 4X6HA 2OULA 3P5UA 1YT7A 3OISA 4BS6A 2JQFR 3CH3X 2DCDA 2R9OA 1EWMA 2F1GA 2XU5A 2VHFA 1ZCMA 1XKGA 2G8EA 1KFXL 1Q6KA 2XU1A 4AXMA 3PW3A 3E1ZB 1CSBB 3PNRA 4MSXA 5CHVA 2ATOA 3BOWA 5K16A 1DEUA 2R9FA 7PCKA 1CB5A 4FIPA 2DCCA 3WXGA 4CDCB 4DMXA 1QOLA 4Q8GA 3KWZA 3OF8A 3V6CA 1U9WA 2CB5A 3BWKA 3MHSA 3GCBA 5PADA 3DF0A 2G8JA 3KWBX 3IHPA 1POPA 1EWLA 3I06A 4PADA 3BC3A 1PPNA 1DF0A 2DC9A 3IMAA 4YYWA 1KXRA 1MHWA 3M99A 5EF4A 5CVMA 2DZZA 1MEMA 4HWYA 1AECA 1PE6A 1F2BA 4QRXA 3F5VA 3QT4A 1JQPA 1AU0A 1HUCB 1U9VA 4QRVA 1ZIVA 4PI3A 1YVBA 2ACTA 2NQAA 1MEGA 1AIMA 3RVXA 2G6DA 2AIMA 4N79A 1EWPA 4PP1A 3K9MA 1NQCA 1MS6A 5FPWA 3HWNA 1PPPA 2JQGR 4CZWA 2FRQA 2DC7A 1AYUA 2H7JA 2HXZA 1NB5A 2YJ8A 2E01A 3C9EA 1A6RA 2P86A 1KHPA 2Y6EA 3V6EA 2VHSA 4PP2E 4DMYA 1YALA 2YJ2A 3LFYA 1ME4A 4I07A 4YV8A 2O6XA 2E03A 1PBHA 5JH3A 1PIPA 1PXVA 2BDZA 2F7DA 4YYSA 3RVWA 2FRAA 4YVAA 2FYEA 1CPJA 3P5XA 2AYNA 3QSDA 1S4VA 1PADA 2XU3A 1BGOA 4G54A 4CDEB 1STFE 3OVZA 3I3TA 5CHTA 4QRGA 3H89A 1BP4A 3USVA 1NPZA 3LXSA 4WA6A 3AI8A 4Q8HA 2HD5A 4YYVA 2E00A 4QBBA 1K3BB 5J94A 1YK8A 3N3GA 1KHQA 2G7YA 4OEMA 3OF9A 5CVOB 2E02A 3KX1A 3HHIA 1O0EA 2OP3A 6PADA 2R6NA 2DCAA 1BQIA 3ERVA 5EGWA 3D6SA 1BY8A 2DC8A 8PCHA 1EWOA 2B1NA 1PCIA 3MORA 4W5BA 2FT2A 1QDQA 4YYQA 5A24A 4W5CA 3H8BA 1U9QX 9PAPA 2P0RA 1GECE 2FTDA 3KW9A 4N8WA 3HHAA 2GHUA 1CVZA 1PPDA 5JA7A 2AYOA 1YK7A 4KLBA 4YYUA 1KFUL 3KFQA 1M6DA 1TL9A 2DCBA 3K8UA 3KSEA 2AVWA 2R9CA 2OZ2A 4K7CA 2XU4A 1NL6A 4N4ZA 4W4UA 2PREA 4FK5A 2WBFX 3U8EA 2R9NA 3CH2X 1ATKA 2IPPB 4OELA 2BDLA 1AU3A 3WXEA 1GLOA 1NLJA 3N3KA 1EF7A 4XUIA 1QMYA 3F75A 1IWDA 1ME3A 3IV2A 2NQDB 1THEA 3H8CA 1CQDA 3TNXA 1FH0A 3S3QA 3IUTA 3KKUA 2DZYA 4BPVA 2PBHA 4AXLA 1Y08A 3S3RA 1AYVA 1U5IA 4BSQA 4QH6A 4CDFB 1AU4A 2P7UA 1MIRA 2DJGB 1CV8A 1SNKA 3RVVA 5CVNB 3HD3A 1ITOA 1Y4HA 1VSNA 1QXPA 2YJCA 3H7DA 1GCBA 2HH5A 3CBJA 3P5WA 3OVXA 1TU6A 2AUXA 2NQGA 2Y5BA 2YJ9A 2YJBA 3WXFA 1VJVA 2IBIA 3BCNA 4I05A 3N4CA 3H6SA 1NB3A 4FJCA 3BPFA 2FO5A 2PADA 1CTEA 2AS8A 2GFOA 1F2CA 4P6EA 1AYWA 4XR7A 3K24A 3B79A 3NHEA 1F29A 1GMYA 4MZSA 4ZUXU 3ZUAA 3P5VA 1F2AA 2AU1A 4I04A 1CS8A 1U9XA 2DJFB 1CJLA 3IOQA 3MHHA 1AU2A 1ICFA 3O1GA 4BQVA 3O0UA 1PPOA 2R9MA 3CBKA 2CIOA
chains in the Genus database with same CATH superfamily
1X9YA 3MTNA 2HHNA 4X6IA 4BS5A 3BPMA 5F02A 3PDFA 2PNSA 4OVZA 2NQIA 4P6GA 2FQ9A 4MM3B 1MDWA 4X6JA 4RY2A 4BOQA 3BB7A 4MZOA 2AGAA 2DC6A 1TLOA 1SP4B 4REZA 4CDDB 3TMPA 1PVJA 2AUZA 3IEJA 2B1MA 2C0YA 3QJ3A 3PBHA 4BOSA 2ARYA 4YYRA 2DOSA 1DKIA 3C0RA 3PT2A 2FUDA 4X6HA 2OULA 3PRPA 3P5UA 3MTVA 4P16A 1YT7A 3OISA 4BS6A 2JQFR 3CH3X 2DCDA 2R9OA 1EWMA 1UKFA 2F1GA 2XU5A 2VHFA 1ZCMA 1XKGA 2G8EA 1KFXL 1Q6KA 3PSEA 2XU1A 4AXMA 3PW3A 3E1ZB 1CSBB 4OVZB 3PNRA 4MSXA 5CHVA 2ATOA 3BOWA 5K16A 1DEUA 2R9FA 7PCKA 1YZBA 1CB5A 4FIPA 2DCCA 3WXGA 4CDCB 4DMXA 1QOLA 4Q8GA 3KWZA 3OF8A 3V6CA 1U9WA 2CB5A 3BBAA 4D8BA 3BWKA 3MHSA 3MP2A 3GCBA 5PADA 3DF0A 2G8JA 3KWBX 3IHPA 1POPA 1EWLA 3I06A 4PADA 3BC3A 4A5UA 1PPNA 1DF0A 2DC9A 3IMAA 4YYWA 3IFUA 3TRKA 3BY4A 1KXRA 1MHWA 3M99A 5EF4A 5CVMA 2Z84A 2DZZA 1MEMA 4HWYA 1AECA 1PE6A 1F2BA 4QRXA 3F5VA 3QT4A 1JQPA 1AU0A 1HUCB 3OQCA 1U9VA 4QRVA 2JTCA 1ZIVA 4MI7A 4PI3A 1YVBA 2ACTA 2NQAA 4GUAA 1MEGA 1AIMA 3RVXA 2G6DA 2AIMA 4D8IA 4N79A 1EWPA 4PP1A 2UZJA 3K9MA 1NQCA 1MS6A 5FPWA 3HWNA 1PPPA 2JQGR 3ZNHA 4CZWA 4RKXA 2FRQA 5KO3A 3B21A 2DC7A 1AYUA 2H7JA 2HXZA 1NB5A 2BTWA 2YJ8A 2E01A 2JRIA 3C9EA 1A6RA 2P86A 1KHPA 2Y6EA 3V6EA 2VHSA 3PHUA 4PP2E 4DMYA 1YALA 2YJ2A 3LFYA 1ME4A 4I07A 4YV8A 2O6XA 2E03A 1PBHA 4RF1A 5JH3A 1PIPA 4BOZA 1PXVA 2BDZA 2F7DA 4YYSA 3W30A 3RVWA 2FRAA 4D8EA 4YVAA 2FYEA 1CPJA 3P5XA 2AYNA 3QSDA 1S4VA 1PADA 2XU3A 1BGOA 4G54A 4CDEB 1STFE 3OVZA 3I3TA 5CHTA 4QRGA 4BOPA 3H89A 4RF0A 1BP4A 3USVA 1NPZA 3LXSA 4WA6A 3PHWA 3AI8A 2BTWB 4Q8HA 2HD5A 4YYVA 2E00A 4QBBA 1K3BB 5J94A 1YK8A 3N3GA 5EZQA 1KHQA 2G7YA 4OEMA 3OF9A 5CVOB 2E02A 3KX1A 3HHIA 1O0EA 2BU3A 2OP3A 6PADA 2R6NA 2DCAA 1BQIA 3ERVA 5EGWA 3D6SA 5EZSA 1BY8A 2DC8A 8PCHA 2HWKA 1EWOA 2B1NA 1PCIA 3MORA 3MJ5A 4W5BA 2FT2A 1QDQA 4YYQA 5A24A 4R3DA 4W5CA 3RNVA 3E9SA 3H8BA 1U9QX 9PAPA 2P0RA 1GECE 2FTDA 3KW9A 2FE8A 4N8WA 3HHAA 2GHUA 1CVZA 1PPDA 5JA7A 2AYOA 1YK7A 4KLBA 4YYUA 1KFUL 3KFQA 1M6DA 1TL9A 2DCBA 3K8UA 3KSEA 2AVWA 2R9CA 2OZ2A 4K7CA 2XU4A 2J7QC 1NL6A 4N4ZA 4M0WA 4W4UA 2PREA 4FK5A 2WBFX 3U8EA 2R9NA 3CH2X 1ATKA 2IPPB 4OELA 3PRMA 2BDLA 2J7QA 1AU3A 3WXEA 1GLOA 1NLJA 3N3KA 1EF7A 4ZTBA 4XUIA 1QMYA 3F75A 1IWDA 1ME3A 3IV2A 2NQDB 1THEA 3H8CA 1CQDA 3TNXA 1FH0A 4PT5A 4WURA 4HXDB 3S3QA 3IUTA 3KKUA 2DZYA 4BPVA 2PBHA 4AXLA 1Y08A 3S3RA 1AYVA 4RNAA 4OW0A 1U5IA 4BSQA 4QH6A 5JZEA 3PHXA 4CDFB 1AU4A 2P7UA 1MIRA 2DJGB 1CV8A 1SNKA 3RVVA 5CVNB 3HD3A 1ITOA 4BOUA 5E6JA 1Y4HA 1VSNA 1QXPA 2YJCA 3H7DA 1GCBA 2HH5A 3CBJA 3P5WA 3OVXA 1TU6A 2AUXA 2NQGA 2Y5BA 2YJ9A 2YJBA 3WXFA 4IP3A 1VJVA 2IBIA 3BCNA 4I05A 3N4CA 3H6SA 1NB3A 4FJCA 3BPFA 2FO5A 2PADA 1CTEA 2AS8A 2GFOA 4IUMA 3W31A 1F2CA 4P6EA 1AYWA 4XR7A 3K24A 3B79A 3NHEA 1F29A 4XZXA 1GMYA 4MZSA 4ZUXU 3ZUAA 3P5VA 1F2AA 2AU1A 4I04A 1CS8A 1U9XA 2DJFB 1CJLA 3IOQA 3O65A 3MHHA 1AU2A 1ICFA 3O1GA 4BQVA 3O0UA 1PPOA 2R9MA 3CBKA 2CIOA
chains in the Genus database with same CATH topology
1X9YA 3MTNA 2HHNA 4X6IA 4BS5A 3BPMA 5F02A 3PDFA 2PNSA 2NQIA 4P6GA 2FQ9A 1MDWA 4X6JA 4RY2A 4MZOA 2DC6A 1TLOA 1SP4B 4CDDB 4NV8A 2AUZA 3IEJA 2B1MA 2C0YA 3QJ3A 3PBHA 2ARYA 4YYRA 2FUDA 4X6HA 2OULA 3D9WA 3P5UA 1YT7A 3OISA 4BS6A 2JQFR 3CH3X 2DCDA 2R9OA 1EWMA 2F1GA 2XU5A 2VHFA 1ZCMA 1XKGA 2G8EA 1KFXL 1Q6KA 2XU1A 4B55A 4AXMA 1W4TA 3PW3A 3E1ZB 1CSBB 3PNRA 4MSXA 5CHVA 2ATOA 3BOWA 5K16A 1DEUA 2R9FA 7PCKA 1CB5A 4FIPA 2DCCA 3WXGA 4BGFA 4CDCB 4DMXA 1QOLA 4Q8GA 3KWZA 3OF8A 4GUZA 3V6CA 1U9WA 2CB5A 3BWKA 3MHSA 3GCBA 1W6FA 5PADA 3DF0A 2G8JA 3KWBX 3IHPA 1POPA 1EWLA 3I06A 4PADA 3BC3A 1PPNA 1DF0A 2DC9A 3IMAA 4YYWA 1KXRA 1MHWA 3M99A 5EF4A 5CVMA 2DZZA 1MEMA 4HWYA 1AECA 1PE6A 1F2BA 4QRXA 3F5VA 3QT4A 1JQPA 1AU0A 1HUCB 1U9VA 4QRVA 1E2TA 1ZIVA 4PI3A 1YVBA 2ACTA 1W5RA 2NQAA 1MEGA 1AIMA 3RVXA 2G6DA 2AIMA 4N79A 1EWPA 4PP1A 3K9MA 1NQCA 1MS6A 5FPWA 3HWNA 1PPPA 2JQGR 4CZWA 2FRQA 2DC7A 1AYUA 2H7JA 2HXZA 1NB5A 2YJ8A 2E01A 3C9EA 1A6RA 2BSZA 2P86A 1KHPA 2Y6EA 3V6EA 2VHSA 4PP2E 4DMYA 1YALA 2YJ2A 3LFYA 1ME4A 4I07A 4YV8A 2O6XA 2E03A 1PBHA 5JH3A 1PIPA 4NV7A 1PXVA 2BDZA 2F7DA 4YYSA 3RVWA 2FRAA 4YVAA 2FYEA 1CPJA 3P5XA 2AYNA 3QSDA 1S4VA 1PADA 2XU3A 1BGOA 4G54A 4CDEB 1STFE 3OVZA 3I3TA 5CHTA 4QRGA 3H89A 1BP4A 3USVA 1NPZA 3LXSA 4WA6A 3AI8A 4Q8HA 2HD5A 4YYVA 2E00A 4QBBA 1K3BB 5J94A 1YK8A 3N3GA 1KHQA 2G7YA 4OEMA 3OF9A 5CVOB 2E02A 3KX1A 3HHIA 1O0EA 2OP3A 6PADA 2R6NA 2DCAA 1BQIA 3ERVA 5EGWA 3D6SA 1BY8A 2DC8A 8PCHA 1EWOA 2B1NA 1PCIA 3MORA 4W5BA 2FT2A 1QDQA 4YYQA 5A24A 4W5CA 3H8BA 1U9QX 9PAPA 2P0RA 1GX3A 1GECE 2FTDA 3KW9A 4N8WA 3HHAA 2GHUA 1CVZA 1PPDA 5JA7A 2AYOA 1YK7A 4KLBA 4YYUA 1KFUL 3KFQA 1M6DA 1TL9A 2DCBA 3K8UA 3KSEA 2AVWA 2R9CA 2OZ2A 4K7CA 2XU4A 1NL6A 4N4ZA 4W4UA 2PREA 4FK5A 2WBFX 4C5PA 3U8EA 2R9NA 3CH2X 1ATKA 2IPPB 4OELA 2BDLA 1AU3A 3WXEA 1GLOA 1NLJA 3N3KA 1EF7A 4XUIA 1QMYA 3F75A 1IWDA 1ME3A 3IV2A 2NQDB 1THEA 3H8CA 1CQDA 3TNXA 1FH0A 3S3QA 3IUTA 3KKUA 2VFBA 2DZYA 4BPVA 2PBHA 4AXLA 1Y08A 3S3RA 1AYVA 1U5IA 4BSQA 4QH6A 4CDFB 1AU4A 2P7UA 1MIRA 2DJGB 1CV8A 1SNKA 3RVVA 5CVNB 3HD3A 1ITOA 1Y4HA 1VSNA 1QXPA 2YJCA 3H7DA 1GCBA 2HH5A 3CBJA 3P5WA 3OVXA 1TU6A 2AUXA 2NQGA 2Y5BA 2YJ9A 2YJBA 3WXFA 1VJVA 2IBIA 3BCNA 4I05A 3N4CA 3H6SA 1NB3A 4FJCA 3BPFA 2FO5A 2PADA 1CTEA 2AS8A 2GFOA 1F2CA 4P6EA 1AYWA 4XR7A 3K24A 3B79A 3NHEA 1F29A 1GMYA 4MZSA 4ZUXU 3ZUAA 3P5VA 1F2AA 2AU1A 2VFCA 4I04A 1CS8A 1U9XA 2DJFB 1CJLA 3IOQA 3MHHA 3LTWA 1AU2A 1ICFA 3O1GA 4BQVA 3O0UA 1PPOA 2R9MA 3CBKA 2CIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9Y A;  3MTN A;  2HHN A;  4X6I A;  4BS5 A;  3BPM A;  5F02 A;  3PDF A;  2PNS A;  2NQI A;  4P6G A;  2FQ9 A;  1MDW A;  4X6J A;  4RY2 A;  4MZO A;  2DC6 A;  1TLO A;  1SP4 B;  4CDD B;  2AUZ A;  3IEJ A;  2B1M A;  2C0Y A;  3QJ3 A;  3PBH A;  2ARY A;  4YYR A;  2FUD A;  4X6H A;  2OUL A;  3P5U A;  1YT7 A;  3OIS A;  4BS6 A;  2JQF R;  3CH3 X;  2DCD A;  2R9O A;  1EWM A;  2F1G A;  2XU5 A;  2VHF A;  1ZCM A;  1XKG A;  2G8E A;  1KFX L;  1Q6K A;  2XU1 A;  4AXM A;  3PW3 A;  3E1Z B;  1CSB B;  3PNR A;  4MSX A;  5CHV A;  2ATO A;  3BOW A;  5K16 A;  1DEU A;  2R9F A;  7PCK A;  1CB5 A;  4FIP A;  2DCC A;  3WXG A;  4CDC B;  4DMX A;  1QOL A;  4Q8G A;  3KWZ A;  3OF8 A;  3V6C A;  1U9W A;  2CB5 A;  3BWK A;  3MHS A;  3GCB A;  5PAD A;  3DF0 A;  2G8J A;  3KWB X;  3IHP A;  1POP A;  1EWL A;  3I06 A;  4PAD A;  3BC3 A;  1PPN A;  1DF0 A;  2DC9 A;  3IMA A;  4YYW A;  1KXR A;  1MHW A;  3M99 A;  5EF4 A;  5CVM A;  2DZZ A;  1MEM A;  4HWY A;  1AEC A;  1PE6 A;  1F2B A;  4QRX A;  3F5V A;  3QT4 A;  1JQP A;  1AU0 A;  1HUC B;  1U9V A;  4QRV A;  1ZIV A;  4PI3 A;  1YVB A;  2ACT A;  2NQA A;  1MEG A;  1AIM A;  3RVX A;  2G6D A;  2AIM A;  4N79 A;  1EWP A;  4PP1 A;  3K9M A;  1NQC A;  1MS6 A;  5FPW A;  3HWN A;  1PPP A;  2JQG R;  4CZW A;  2FRQ A;  2DC7 A;  1AYU A;  2H7J A;  2HXZ A;  1NB5 A;  2YJ8 A;  2E01 A;  3C9E A;  1A6R A;  2P86 A;  1KHP A;  2Y6E A;  3V6E A;  2VHS A;  4PP2 E;  4DMY A;  1YAL A;  2YJ2 A;  3LFY A;  1ME4 A;  4I07 A;  4YV8 A;  2O6X A;  2E03 A;  1PBH A;  5JH3 A;  1PIP A;  1PXV A;  2BDZ A;  2F7D A;  4YYS A;  3RVW A;  2FRA A;  4YVA A;  2FYE A;  1CPJ A;  3P5X A;  2AYN A;  3QSD A;  1S4V A;  1PAD A;  2XU3 A;  1BGO A;  4G54 A;  4CDE B;  1STF E;  3OVZ A;  3I3T A;  5CHT A;  4QRG A;  3H89 A;  1BP4 A;  3USV A;  1NPZ A;  3LXS A;  4WA6 A;  3AI8 A;  4Q8H A;  2HD5 A;  4YYV A;  2E00 A;  4QBB A;  1K3B B;  5J94 A;  1YK8 A;  3N3G A;  1KHQ A;  2G7Y A;  4OEM A;  3OF9 A;  5CVO B;  2E02 A;  3KX1 A;  3HHI A;  1O0E A;  2OP3 A;  6PAD A;  2R6N A;  2DCA A;  1BQI A;  3ERV A;  5EGW A;  3D6S A;  1BY8 A;  2DC8 A;  8PCH A;  1EWO A;  2B1N A;  1PCI A;  3MOR A;  4W5B A;  2FT2 A;  1QDQ A;  4YYQ A;  5A24 A;  4W5C A;  3H8B A;  1U9Q X;  9PAP A;  2P0R A;  1GEC E;  2FTD A;  3KW9 A;  4N8W A;  3HHA A;  2GHU A;  1CVZ A;  1PPD A;  5JA7 A;  2AYO A;  1YK7 A;  4KLB A;  4YYU A;  1KFU L;  3KFQ A;  1M6D A;  1TL9 A;  2DCB A;  3K8U A;  3KSE A;  2AVW A;  2R9C A;  2OZ2 A;  4K7C A;  2XU4 A;  1NL6 A;  4N4Z A;  4W4U A;  2PRE A;  4FK5 A;  2WBF X;  3U8E A;  2R9N A;  3CH2 X;  1ATK A;  2IPP B;  4OEL A;  2BDL A;  1AU3 A;  3WXE A;  1GLO A;  1NLJ A;  3N3K A;  1EF7 A;  4XUI A;  1QMY A;  3F75 A;  1IWD A;  1ME3 A;  3IV2 A;  2NQD B;  1THE A;  3H8C A;  1CQD A;  3TNX A;  1FH0 A;  3S3Q A;  3IUT A;  3KKU A;  2DZY A;  4BPV A;  2PBH A;  4AXL A;  1Y08 A;  3S3R A;  1AYV A;  1U5I A;  4BSQ A;  4QH6 A;  4CDF B;  1AU4 A;  2P7U A;  1MIR A;  2DJG B;  1CV8 A;  1SNK A;  3RVV A;  5CVN B;  3HD3 A;  1ITO A;  1Y4H A;  1VSN A;  1QXP A;  2YJC A;  3H7D A;  1GCB A;  2HH5 A;  3CBJ A;  3P5W A;  3OVX A;  1TU6 A;  2AUX A;  2NQG A;  2Y5B A;  2YJ9 A;  2YJB A;  3WXF A;  1VJV A;  2IBI A;  3BCN A;  4I05 A;  3N4C A;  3H6S A;  1NB3 A;  4FJC A;  3BPF A;  2FO5 A;  2PAD A;  1CTE A;  2AS8 A;  2GFO A;  1F2C A;  4P6E A;  1AYW A;  4XR7 A;  3K24 A;  3B79 A;  3NHE A;  1F29 A;  1GMY A;  4MZS A;  4ZUX U;  3ZUA A;  3P5V A;  1F2A A;  2AU1 A;  4I04 A;  1CS8 A;  1U9X A;  2DJF B;  1CJL A;  3IOQ A;  3MHH A;  1AU2 A;  1ICF A;  3O1G A;  4BQV A;  3O0U A;  1PPO A;  2R9M A;  3CBK A;  2CIO A; 
#chains in the Genus database with same CATH topology
 1X9Y A;  3MTN A;  2HHN A;  4X6I A;  4BS5 A;  3BPM A;  5F02 A;  3PDF A;  2PNS A;  4OVZ A;  2NQI A;  4P6G A;  2FQ9 A;  4MM3 B;  1MDW A;  4X6J A;  4RY2 A;  4BOQ A;  3BB7 A;  4MZO A;  2AGA A;  2DC6 A;  1TLO A;  1SP4 B;  4REZ A;  4CDD B;  3TMP A;  1PVJ A;  2AUZ A;  3IEJ A;  2B1M A;  2C0Y A;  3QJ3 A;  3PBH A;  4BOS A;  2ARY A;  4YYR A;  2DOS A;  1DKI A;  3C0R A;  3PT2 A;  2FUD A;  4X6H A;  2OUL A;  3PRP A;  3P5U A;  3MTV A;  4P16 A;  1YT7 A;  3OIS A;  4BS6 A;  2JQF R;  3CH3 X;  2DCD A;  2R9O A;  1EWM A;  1UKF A;  2F1G A;  2XU5 A;  2VHF A;  1ZCM A;  1XKG A;  2G8E A;  1KFX L;  1Q6K A;  3PSE A;  2XU1 A;  4AXM A;  3PW3 A;  3E1Z B;  1CSB B;  4OVZ B;  3PNR A;  4MSX A;  5CHV A;  2ATO A;  3BOW A;  5K16 A;  1DEU A;  2R9F A;  7PCK A;  1YZB A;  1CB5 A;  4FIP A;  2DCC A;  3WXG A;  4CDC B;  4DMX A;  1QOL A;  4Q8G A;  3KWZ A;  3OF8 A;  3V6C A;  1U9W A;  2CB5 A;  3BBA A;  4D8B A;  3BWK A;  3MHS A;  3MP2 A;  3GCB A;  5PAD A;  3DF0 A;  2G8J A;  3KWB X;  3IHP A;  1POP A;  1EWL A;  3I06 A;  4PAD A;  3BC3 A;  4A5U A;  1PPN A;  1DF0 A;  2DC9 A;  3IMA A;  4YYW A;  3IFU A;  3TRK A;  3BY4 A;  1KXR A;  1MHW A;  3M99 A;  5EF4 A;  5CVM A;  2Z84 A;  2DZZ A;  1MEM A;  4HWY A;  1AEC A;  1PE6 A;  1F2B A;  4QRX A;  3F5V A;  3QT4 A;  1JQP A;  1AU0 A;  1HUC B;  3OQC A;  1U9V A;  4QRV A;  2JTC A;  1ZIV A;  4MI7 A;  4PI3 A;  1YVB A;  2ACT A;  2NQA A;  4GUA A;  1MEG A;  1AIM A;  3RVX A;  2G6D A;  2AIM A;  4D8I A;  4N79 A;  1EWP A;  4PP1 A;  2UZJ A;  3K9M A;  1NQC A;  1MS6 A;  5FPW A;  3HWN A;  1PPP A;  2JQG R;  3ZNH A;  4CZW A;  4RKX A;  2FRQ A;  5KO3 A;  3B21 A;  2DC7 A;  1AYU A;  2H7J A;  2HXZ A;  1NB5 A;  2BTW A;  2YJ8 A;  2E01 A;  2JRI A;  3C9E A;  1A6R A;  2P86 A;  1KHP A;  2Y6E A;  3V6E A;  2VHS A;  3PHU A;  4PP2 E;  4DMY A;  1YAL A;  2YJ2 A;  3LFY A;  1ME4 A;  4I07 A;  4YV8 A;  2O6X A;  2E03 A;  1PBH A;  4RF1 A;  5JH3 A;  1PIP A;  4BOZ A;  1PXV A;  2BDZ A;  2F7D A;  4YYS A;  3W30 A;  3RVW A;  2FRA A;  4D8E A;  4YVA A;  2FYE A;  1CPJ A;  3P5X A;  2AYN A;  3QSD A;  1S4V A;  1PAD A;  2XU3 A;  1BGO A;  4G54 A;  4CDE B;  1STF E;  3OVZ A;  3I3T A;  5CHT A;  4QRG A;  4BOP A;  3H89 A;  4RF0 A;  1BP4 A;  3USV A;  1NPZ A;  3LXS A;  4WA6 A;  3PHW A;  3AI8 A;  2BTW B;  4Q8H A;  2HD5 A;  4YYV A;  2E00 A;  4QBB A;  1K3B B;  5J94 A;  1YK8 A;  3N3G A;  5EZQ A;  1KHQ A;  2G7Y A;  4OEM A;  3OF9 A;  5CVO B;  2E02 A;  3KX1 A;  3HHI A;  1O0E A;  2BU3 A;  2OP3 A;  6PAD A;  2R6N A;  2DCA A;  1BQI A;  3ERV A;  5EGW A;  3D6S A;  5EZS A;  1BY8 A;  2DC8 A;  8PCH A;  2HWK A;  1EWO A;  2B1N A;  1PCI A;  3MOR A;  3MJ5 A;  4W5B A;  2FT2 A;  1QDQ A;  4YYQ A;  5A24 A;  4R3D A;  4W5C A;  3RNV A;  3E9S A;  3H8B A;  1U9Q X;  9PAP A;  2P0R A;  1GEC E;  2FTD A;  3KW9 A;  2FE8 A;  4N8W A;  3HHA A;  2GHU A;  1CVZ A;  1PPD A;  5JA7 A;  2AYO A;  1YK7 A;  4KLB A;  4YYU A;  1KFU L;  3KFQ A;  1M6D A;  1TL9 A;  2DCB A;  3K8U A;  3KSE A;  2AVW A;  2R9C A;  2OZ2 A;  4K7C A;  2XU4 A;  2J7Q C;  1NL6 A;  4N4Z A;  4M0W A;  4W4U A;  2PRE A;  4FK5 A;  2WBF X;  3U8E A;  2R9N A;  3CH2 X;  1ATK A;  2IPP B;  4OEL A;  3PRM A;  2BDL A;  2J7Q A;  1AU3 A;  3WXE A;  1GLO A;  1NLJ A;  3N3K A;  1EF7 A;  4ZTB A;  4XUI A;  1QMY A;  3F75 A;  1IWD A;  1ME3 A;  3IV2 A;  2NQD B;  1THE A;  3H8C A;  1CQD A;  3TNX A;  1FH0 A;  4PT5 A;  4WUR A;  4HXD B;  3S3Q A;  3IUT A;  3KKU A;  2DZY A;  4BPV A;  2PBH A;  4AXL A;  1Y08 A;  3S3R A;  1AYV A;  4RNA A;  4OW0 A;  1U5I A;  4BSQ A;  4QH6 A;  5JZE A;  3PHX A;  4CDF B;  1AU4 A;  2P7U A;  1MIR A;  2DJG B;  1CV8 A;  1SNK A;  3RVV A;  5CVN B;  3HD3 A;  1ITO A;  4BOU A;  5E6J A;  1Y4H A;  1VSN A;  1QXP A;  2YJC A;  3H7D A;  1GCB A;  2HH5 A;  3CBJ A;  3P5W A;  3OVX A;  1TU6 A;  2AUX A;  2NQG A;  2Y5B A;  2YJ9 A;  2YJB A;  3WXF A;  4IP3 A;  1VJV A;  2IBI A;  3BCN A;  4I05 A;  3N4C A;  3H6S A;  1NB3 A;  4FJC A;  3BPF A;  2FO5 A;  2PAD A;  1CTE A;  2AS8 A;  2GFO A;  4IUM A;  3W31 A;  1F2C A;  4P6E A;  1AYW A;  4XR7 A;  3K24 A;  3B79 A;  3NHE A;  1F29 A;  4XZX A;  1GMY A;  4MZS A;  4ZUX U;  3ZUA A;  3P5V A;  1F2A A;  2AU1 A;  4I04 A;  1CS8 A;  1U9X A;  2DJF B;  1CJL A;  3IOQ A;  3O65 A;  3MHH A;  1AU2 A;  1ICF A;  3O1G A;  4BQV A;  3O0U A;  1PPO A;  2R9M A;  3CBK A;  2CIO A; 
#chains in the Genus database with same CATH homology
 1X9Y A;  3MTN A;  2HHN A;  4X6I A;  4BS5 A;  3BPM A;  5F02 A;  3PDF A;  2PNS A;  2NQI A;  4P6G A;  2FQ9 A;  1MDW A;  4X6J A;  4RY2 A;  4MZO A;  2DC6 A;  1TLO A;  1SP4 B;  4CDD B;  4NV8 A;  2AUZ A;  3IEJ A;  2B1M A;  2C0Y A;  3QJ3 A;  3PBH A;  2ARY A;  4YYR A;  2FUD A;  4X6H A;  2OUL A;  3D9W A;  3P5U A;  1YT7 A;  3OIS A;  4BS6 A;  2JQF R;  3CH3 X;  2DCD A;  2R9O A;  1EWM A;  2F1G A;  2XU5 A;  2VHF A;  1ZCM A;  1XKG A;  2G8E A;  1KFX L;  1Q6K A;  2XU1 A;  4B55 A;  4AXM A;  1W4T A;  3PW3 A;  3E1Z B;  1CSB B;  3PNR A;  4MSX A;  5CHV A;  2ATO A;  3BOW A;  5K16 A;  1DEU A;  2R9F A;  7PCK A;  1CB5 A;  4FIP A;  2DCC A;  3WXG A;  4BGF A;  4CDC B;  4DMX A;  1QOL A;  4Q8G A;  3KWZ A;  3OF8 A;  4GUZ A;  3V6C A;  1U9W A;  2CB5 A;  3BWK A;  3MHS A;  3GCB A;  1W6F A;  5PAD A;  3DF0 A;  2G8J A;  3KWB X;  3IHP A;  1POP A;  1EWL A;  3I06 A;  4PAD A;  3BC3 A;  1PPN A;  1DF0 A;  2DC9 A;  3IMA A;  4YYW A;  1KXR A;  1MHW A;  3M99 A;  5EF4 A;  5CVM A;  2DZZ A;  1MEM A;  4HWY A;  1AEC A;  1PE6 A;  1F2B A;  4QRX A;  3F5V A;  3QT4 A;  1JQP A;  1AU0 A;  1HUC B;  1U9V A;  4QRV A;  1E2T A;  1ZIV A;  4PI3 A;  1YVB A;  2ACT A;  1W5R A;  2NQA A;  1MEG A;  1AIM A;  3RVX A;  2G6D A;  2AIM A;  4N79 A;  1EWP A;  4PP1 A;  3K9M A;  1NQC A;  1MS6 A;  5FPW A;  3HWN A;  1PPP A;  2JQG R;  4CZW A;  2FRQ A;  2DC7 A;  1AYU A;  2H7J A;  2HXZ A;  1NB5 A;  2YJ8 A;  2E01 A;  3C9E A;  1A6R A;  2BSZ A;  2P86 A;  1KHP A;  2Y6E A;  3V6E A;  2VHS A;  4PP2 E;  4DMY A;  1YAL A;  2YJ2 A;  3LFY A;  1ME4 A;  4I07 A;  4YV8 A;  2O6X A;  2E03 A;  1PBH A;  5JH3 A;  1PIP A;  4NV7 A;  1PXV A;  2BDZ A;  2F7D A;  4YYS A;  3RVW A;  2FRA A;  4YVA A;  2FYE A;  1CPJ A;  3P5X A;  2AYN A;  3QSD A;  1S4V A;  1PAD A;  2XU3 A;  1BGO A;  4G54 A;  4CDE B;  1STF E;  3OVZ A;  3I3T A;  5CHT A;  4QRG A;  3H89 A;  1BP4 A;  3USV A;  1NPZ A;  3LXS A;  4WA6 A;  3AI8 A;  4Q8H A;  2HD5 A;  4YYV A;  2E00 A;  4QBB A;  1K3B B;  5J94 A;  1YK8 A;  3N3G A;  1KHQ A;  2G7Y A;  4OEM A;  3OF9 A;  5CVO B;  2E02 A;  3KX1 A;  3HHI A;  1O0E A;  2OP3 A;  6PAD A;  2R6N A;  2DCA A;  1BQI A;  3ERV A;  5EGW A;  3D6S A;  1BY8 A;  2DC8 A;  8PCH A;  1EWO A;  2B1N A;  1PCI A;  3MOR A;  4W5B A;  2FT2 A;  1QDQ A;  4YYQ A;  5A24 A;  4W5C A;  3H8B A;  1U9Q X;  9PAP A;  2P0R A;  1GX3 A;  1GEC E;  2FTD A;  3KW9 A;  4N8W A;  3HHA A;  2GHU A;  1CVZ A;  1PPD A;  5JA7 A;  2AYO A;  1YK7 A;  4KLB A;  4YYU A;  1KFU L;  3KFQ A;  1M6D A;  1TL9 A;  2DCB A;  3K8U A;  3KSE A;  2AVW A;  2R9C A;  2OZ2 A;  4K7C A;  2XU4 A;  1NL6 A;  4N4Z A;  4W4U A;  2PRE A;  4FK5 A;  2WBF X;  4C5P A;  3U8E A;  2R9N A;  3CH2 X;  1ATK A;  2IPP B;  4OEL A;  2BDL A;  1AU3 A;  3WXE A;  1GLO A;  1NLJ A;  3N3K A;  1EF7 A;  4XUI A;  1QMY A;  3F75 A;  1IWD A;  1ME3 A;  3IV2 A;  2NQD B;  1THE A;  3H8C A;  1CQD A;  3TNX A;  1FH0 A;  3S3Q A;  3IUT A;  3KKU A;  2VFB A;  2DZY A;  4BPV A;  2PBH A;  4AXL A;  1Y08 A;  3S3R A;  1AYV A;  1U5I A;  4BSQ A;  4QH6 A;  4CDF B;  1AU4 A;  2P7U A;  1MIR A;  2DJG B;  1CV8 A;  1SNK A;  3RVV A;  5CVN B;  3HD3 A;  1ITO A;  1Y4H A;  1VSN A;  1QXP A;  2YJC A;  3H7D A;  1GCB A;  2HH5 A;  3CBJ A;  3P5W A;  3OVX A;  1TU6 A;  2AUX A;  2NQG A;  2Y5B A;  2YJ9 A;  2YJB A;  3WXF A;  1VJV A;  2IBI A;  3BCN A;  4I05 A;  3N4C A;  3H6S A;  1NB3 A;  4FJC A;  3BPF A;  2FO5 A;  2PAD A;  1CTE A;  2AS8 A;  2GFO A;  1F2C A;  4P6E A;  1AYW A;  4XR7 A;  3K24 A;  3B79 A;  3NHE A;  1F29 A;  1GMY A;  4MZS A;  4ZUX U;  3ZUA A;  3P5V A;  1F2A A;  2AU1 A;  2VFC A;  4I04 A;  1CS8 A;  1U9X A;  2DJF B;  1CJL A;  3IOQ A;  3MHH A;  3LTW A;  1AU2 A;  1ICF A;  3O1G A;  4BQV A;  3O0U A;  1PPO A;  2R9M A;  3CBK A;  2CIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...