4X6JA

Development of n-(functionalized benzoyl)-homocycloleucyl-glycinonitriles as potent cathepsin k inhibitors.
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin K
publication title Development of N-(Functionalized benzoyl)-homocycloleucyl-glycinonitriles as Potent Cathepsin K Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 3.4.22.38: Cathepsin K.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 4x6jA00
4HWYA 4YYSA 1PPOA 3E1ZB 2FTDA 5CHTA 2AUXA 2XU3A 1NB3A 2FUDA 2DCCA 4Q8HA 1YALA 3IUTA 3N4CA 1GLOA 1PXVA 3I3TA 2B1NA 2YJCA 5CVNB 2AIMA 2VHFA 4P6GA 1SP4B 1Y08A 1ZCMA 4YYQA 2PREA 4CDEB 2ACTA 3KX1A 2O6XA 1GCBA 1DEUA 3QT4A 3QJ3A 1MDWA 3ERVA 3OVZA 8PCHA 2DCBA 3DF0A 2YJ2A 4QRVA 1AIMA 1PCIA 1KHQA 4YV8A 2WBFX 2XU1A 3BOWA 4P6EA 4X6JA 4XR7A 1PIPA 2GFOA 4I04A 2AYOA 2H7JA 2PADA 3HWNA 5CHVA 3BWKA 1U9QX 3HHAA 1CTEA 1CPJA 1NLJA 3IOQA 4X6IA 3K9MA 3PNRA 4I07A 7PCKA 4N8WA 4PP2E 3RVWA 2C0YA 2R9CA 3B79A 1DF0A 2G7YA 1PE6A 1ITOA 3IMAA 1AYUA 1HUCB 2CB5A 1MIRA 1CSBB 3TNXA 4X6HA 1O0EA 1F2BA 2ATOA 5JH3A 5J94A 1CV8A 1NPZA 2DJFB 3KFQA 3PDFA 4PADA 1AU0A 5A24A 2AU1A 2DCDA 3MTNA 3MHSA 2P86A 1Q6KA 4DMYA 3CBKA 4CDCB 3I06A 1K3BB 2G8EA 1TU6A 2DC8A 3BPMA 3IHPA 1ME4A 1S4VA 4BSQA 2XU4A 2OULA 1YVBA 3PW3A 3H7DA 4OEMA 3IEJA 4BS6A 2P0RA 2E00A 3ZUAA 2NQDB 3N3KA 1AECA 4OELA 2FT2A 3CH2X 3HD3A 4DMXA 3C9EA 4CZWA 1QMYA 1KFUL 4BPVA 1MHWA 3P5WA 2DC7A 1QOLA 4ZUXU 2R9NA 6PADA 3WXFA 2E01A 4BQVA 1IWDA 3S3RA 2G8JA 2JQFR 3LFYA 2R9OA 3MHHA 2ARYA 3CH3X 1NL6A 4PI3A 9PAPA 4W5BA 3S3QA 1AYWA 5CVMA 3RVVA 2B1MA 2E02A 3OISA 1ZIVA 3QSDA 3P5UA 3IV2A 1BY8A 3KSEA 3KW9A 4MZOA 2R9MA 1ATKA 2DZYA 1PPNA 1X9YA 1XKGA 2FRAA 3WXGA 1M6DA 2AYNA 1F29A 2BDZA 3P5XA 2JQGR 2FQ9A 1KXRA 2DCAA 3LXSA 4YYRA 5EGWA 3V6EA 4N4ZA 3OF8A 4I05A 3AI8A 1U5IA 2BDLA 4BS5A 1TLOA 2HHNA 2Y5BA 1EF7A 1FH0A 3OVXA 3H89A 1SNKA 4RY2A 2F7DA 3CBJA 4W4UA 3N3GA 3PBHA 1F2CA 1CVZA 2NQAA 1BQIA 1A6RA 2F1GA 2OZ2A 2DZZA 3BPFA 2HH5A 2YJ9A 3V6CA 1AU2A 4AXLA 4KLBA 3F75A 2VHSA 3O1GA 3KWBX 3BC3A 2IBIA 1VSNA 4XUIA 2G6DA 1KHPA 3WXEA 3F5VA 5JA7A 1CJLA 2OP3A 3OF9A 1CS8A 1AYVA 1BGOA 2YJ8A 1GMYA 4K7CA 4Q8GA 1MEGA 4FJCA 2HXZA 5CVOB 5F02A 4CDFB 4QRXA 1PBHA 3M99A 2PNSA 3BCNA 4MSXA 1STFE 4QH6A 4YYWA 1QDQA 4N79A 4W5CA 5PADA 2R9FA 4QRGA 3P5VA 2R6NA 1U9WA 2FYEA 2E03A 2AVWA 4QBBA 3RVXA 1POPA 1NQCA 3O0UA 5EF4A 3D6SA 1EWMA 4FIPA 3H6SA 1AU4A 1F2AA 4WA6A 5K16A 2FO5A 3USVA 1TL9A 1JQPA 3U8EA 3NHEA 1PPPA 2P7UA 1ME3A 2AS8A 1THEA 3HHIA 1ICFA 2XU5A 2DC6A 4PP1A 2NQGA 3H8CA 1MS6A 1YK8A 1YK7A 2DC9A 1GECE 1BP4A 1U9XA 3H8BA 1YT7A 2PBHA 4AXMA 5FPWA 4YVAA 1U9VA 4YYUA 1AU3A 4MZSA 1CB5A 1Y4HA 1EWPA 2DJGB 1EWLA 1CQDA 2HD5A 3KKUA 3K24A 1NB5A 1MEMA 1VJVA 2CIOA 1PPDA 1EWOA 4FK5A 3KWZA 1KFXL 2Y6EA 3MORA 1PADA 2AUZA 2IPPB 3K8UA 1QXPA 2NQIA 2GHUA 4G54A 3GCBA 4CDDB 4YYVA 2YJBA 2FRQA
chains in the Genus database with same CATH superfamily
4HWYA 4YYSA 3W30A 1PPOA 3E1ZB 2FTDA 5CHTA 2AUXA 2XU3A 1NB3A 2FUDA 3E9SA 3MTVA 2DCCA 4Q8HA 1YALA 3IUTA 3N4CA 4D8EA 1GLOA 1PXVA 3I3TA 2B1NA 2YJCA 5CVNB 2AIMA 2VHFA 4P6GA 1SP4B 1Y08A 1ZCMA 4YYQA 2PREA 4CDEB 2DOSA 2ACTA 3KX1A 2O6XA 1GCBA 4BOUA 1DEUA 3QT4A 3O65A 3QJ3A 1MDWA 3ERVA 3OVZA 8PCHA 1YZBA 2DCBA 3DF0A 2BU3A 2YJ2A 4QRVA 1AIMA 1PCIA 1KHQA 4YV8A 2WBFX 4D8BA 2XU1A 3BOWA 4P6EA 4X6JA 4XR7A 1PIPA 2GFOA 4I04A 2AYOA 2H7JA 2PADA 3HWNA 5CHVA 3BWKA 1U9QX 3HHAA 1CTEA 4MI7A 1CPJA 1NLJA 5E6JA 4A5UA 3IOQA 4X6IA 3K9MA 3PNRA 4I07A 7PCKA 3PRMA 4N8WA 5KO3A 4PP2E 2HWKA 3RVWA 2C0YA 2R9CA 3B79A 1DF0A 2G7YA 1PE6A 1ITOA 3IMAA 1AYUA 1HUCB 2CB5A 1MIRA 1CSBB 3TNXA 4X6HA 1O0EA 1F2BA 2ATOA 5JH3A 1PVJA 5J94A 1CV8A 1NPZA 2DJFB 3KFQA 4P16A 4PT5A 3PDFA 4PADA 1AU0A 3ZNHA 5A24A 2AU1A 2DCDA 3MTNA 3MHSA 2P86A 1Q6KA 4DMYA 3CBKA 4CDCB 3I06A 1K3BB 2G8EA 1TU6A 2DC8A 3BPMA 3IHPA 1ME4A 1S4VA 4BSQA 2XU4A 2OULA 1YVBA 3PW3A 3H7DA 4REZA 4OEMA 3IEJA 4RNAA 4BS6A 2P0RA 2BTWB 2E00A 3MP2A 3ZUAA 2NQDB 3N3KA 3C0RA 1AECA 3PHUA 4OELA 2FT2A 3CH2X 3HD3A 4DMXA 3C9EA 4CZWA 4BOPA 1QMYA 1KFUL 4BPVA 1MHWA 3P5WA 2DC7A 1QOLA 4ZUXU 4OVZA 2R9NA 6PADA 3WXFA 2E01A 4BQVA 1IWDA 3S3RA 2G8JA 3BY4A 2JQFR 3LFYA 2R9OA 3MHHA 4ZTBA 3TMPA 1DKIA 2ARYA 3CH3X 2AGAA 1NL6A 4PI3A 9PAPA 4W5BA 3S3QA 1AYWA 5CVMA 3RVVA 2B1MA 4RF0A 2E02A 3OISA 1ZIVA 3PHWA 3QSDA 3OQCA 3P5UA 3IV2A 1BY8A 3KSEA 3KW9A 4MZOA 2R9MA 1ATKA 2DZYA 1PPNA 3PHXA 1X9YA 4OW0A 1XKGA 2FRAA 3WXGA 1M6DA 2AYNA 1F29A 2BDZA 3P5XA 2JQGR 2FQ9A 1KXRA 2DCAA 3B21A 3LXSA 5EGWA 3V6EA 4YYRA 4N4ZA 3OF8A 3IFUA 4I05A 3AI8A 4BOZA 1U5IA 2BDLA 4BS5A 1TLOA 2HHNA 2Y5BA 1EF7A 2J7QC 1FH0A 3OVXA 3H89A 4MM3B 1SNKA 4RY2A 2F7DA 3CBJA 4W4UA 3N3GA 3PBHA 1F2CA 1CVZA 2NQAA 1BQIA 1A6RA 2F1GA 2OZ2A 3W31A 2DZZA 2FE8A 3MJ5A 3BPFA 2HH5A 2YJ9A 3V6CA 1AU2A 4AXLA 4KLBA 1UKFA 3F75A 4GUAA 2VHSA 3O1GA 3KWBX 3BC3A 2IBIA 1VSNA 4XUIA 2G6DA 1KHPA 3WXEA 3F5VA 5JA7A 1CJLA 2OP3A 3OF9A 4D8IA 1CS8A 1AYVA 1BGOA 2YJ8A 1GMYA 4HXDB 2JTCA 4IUMA 4K7CA 4Q8GA 1MEGA 4FJCA 4IP3A 2HXZA 5CVOB 5F02A 4CDFB 4QRXA 1PBHA 3M99A 2PNSA 3BCNA 2JRIA 4MSXA 1STFE 3BB7A 4QH6A 4XZXA 4YYWA 1QDQA 4N79A 3BBAA 4W5CA 5PADA 2R9FA 4RKXA 4QRGA 2UZJA 3P5VA 2R6NA 1U9WA 2FYEA 2E03A 2AVWA 4OVZB 4QBBA 3PSEA 3RVXA 1POPA 1NQCA 3O0UA 5EF4A 3D6SA 1EWMA 4FIPA 4WURA 3H6SA 1AU4A 1F2AA 4WA6A 5EZQA 5K16A 2FO5A 3USVA 1TL9A 1JQPA 3U8EA 3NHEA 1PPPA 2P7UA 4R3DA 1ME3A 2AS8A 1THEA 3HHIA 3RNVA 1ICFA 2XU5A 2DC6A 4PP1A 2NQGA 3H8CA 1MS6A 1YK8A 4BOSA 1YK7A 2DC9A 1GECE 1BP4A 1U9XA 3H8BA 1YT7A 2Z84A 2PBHA 4AXMA 5FPWA 4YVAA 3PT2A 1U9VA 4YYUA 1AU3A 4MZSA 1CB5A 1Y4HA 1EWPA 2DJGB 1EWLA 3TRKA 1CQDA 2HD5A 3KKUA 3K24A 1NB5A 1MEMA 1VJVA 5EZSA 2CIOA 1PPDA 1EWOA 2J7QA 4FK5A 3KWZA 1KFXL 2Y6EA 3MORA 1PADA 2AUZA 2IPPB 3K8UA 1QXPA 2NQIA 4RF1A 5JZEA 2GHUA 4G54A 3GCBA 4M0WA 4BOQA 4CDDB 4YYVA 2BTWA 2YJBA 3PRPA 2FRQA
chains in the Genus database with same CATH topology
4HWYA 4YYSA 1PPOA 3E1ZB 2FTDA 5CHTA 2AUXA 2XU3A 1NB3A 2FUDA 2DCCA 2BSZA 4Q8HA 1YALA 4BGFA 3IUTA 2VFBA 3N4CA 1GLOA 1PXVA 3I3TA 1W5RA 2B1NA 2YJCA 5CVNB 2AIMA 2VHFA 4P6GA 1SP4B 1Y08A 1ZCMA 4YYQA 2PREA 4CDEB 2ACTA 3KX1A 2O6XA 1GCBA 1DEUA 3QT4A 3QJ3A 1MDWA 3ERVA 3OVZA 8PCHA 2DCBA 3DF0A 2YJ2A 4QRVA 4B55A 1AIMA 1PCIA 1KHQA 4YV8A 2WBFX 2XU1A 3BOWA 4P6EA 4X6JA 4XR7A 1PIPA 1E2TA 2GFOA 4I04A 2AYOA 2H7JA 4NV7A 2PADA 3HWNA 5CHVA 3BWKA 1U9QX 3HHAA 1CTEA 1CPJA 1NLJA 3IOQA 4X6IA 3K9MA 3PNRA 4I07A 7PCKA 4N8WA 4PP2E 3RVWA 2C0YA 2R9CA 3B79A 1DF0A 2G7YA 1PE6A 1ITOA 3IMAA 1W4TA 1AYUA 1HUCB 2CB5A 1MIRA 1CSBB 3TNXA 4X6HA 1O0EA 1F2BA 2ATOA 5JH3A 5J94A 3D9WA 1CV8A 1NPZA 2DJFB 3KFQA 3PDFA 4GUZA 4PADA 1AU0A 5A24A 2AU1A 2DCDA 3MTNA 3MHSA 2P86A 1Q6KA 4DMYA 3CBKA 4CDCB 3I06A 1K3BB 2G8EA 1TU6A 2DC8A 3BPMA 3IHPA 1ME4A 1S4VA 4BSQA 2XU4A 2OULA 1YVBA 3PW3A 3H7DA 4OEMA 3IEJA 3LTWA 4BS6A 2P0RA 2E00A 3ZUAA 2NQDB 3N3KA 1AECA 4OELA 2FT2A 3CH2X 3HD3A 4DMXA 3C9EA 4CZWA 1QMYA 1KFUL 4BPVA 1MHWA 3P5WA 2DC7A 1QOLA 4ZUXU 2R9NA 6PADA 3WXFA 2E01A 4BQVA 1IWDA 3S3RA 2G8JA 2JQFR 3LFYA 2R9OA 3MHHA 2ARYA 3CH3X 1NL6A 4PI3A 9PAPA 4W5BA 3S3QA 1AYWA 5CVMA 3RVVA 2B1MA 2E02A 3OISA 1ZIVA 3QSDA 3P5UA 3IV2A 1BY8A 3KSEA 3KW9A 4MZOA 2R9MA 1ATKA 2DZYA 1PPNA 1X9YA 1XKGA 2FRAA 3WXGA 1M6DA 2AYNA 1F29A 2BDZA 3P5XA 2JQGR 2FQ9A 1KXRA 2DCAA 3LXSA 4YYRA 5EGWA 3V6EA 4N4ZA 3OF8A 4I05A 3AI8A 1U5IA 4NV8A 2BDLA 4BS5A 1TLOA 2HHNA 2Y5BA 1EF7A 1FH0A 3OVXA 3H89A 1SNKA 4RY2A 2F7DA 3CBJA 4W4UA 3N3GA 3PBHA 1F2CA 1CVZA 2NQAA 1BQIA 1A6RA 2F1GA 2OZ2A 2DZZA 4C5PA 3BPFA 2HH5A 2YJ9A 3V6CA 1AU2A 4AXLA 4KLBA 3F75A 2VHSA 3O1GA 3KWBX 3BC3A 2IBIA 1VSNA 4XUIA 2G6DA 1KHPA 3WXEA 3F5VA 5JA7A 1CJLA 2OP3A 3OF9A 1CS8A 1AYVA 1BGOA 2YJ8A 1GMYA 4K7CA 4Q8GA 1MEGA 4FJCA 2HXZA 5CVOB 5F02A 4CDFB 4QRXA 1PBHA 3M99A 2PNSA 3BCNA 4MSXA 1STFE 4QH6A 4YYWA 1QDQA 4N79A 4W5CA 5PADA 1W6FA 2R9FA 4QRGA 3P5VA 2R6NA 1U9WA 2FYEA 2E03A 2AVWA 4QBBA 3RVXA 1POPA 1NQCA 3O0UA 5EF4A 2VFCA 3D6SA 1EWMA 4FIPA 3H6SA 1AU4A 1F2AA 4WA6A 5K16A 2FO5A 3USVA 1TL9A 1JQPA 3U8EA 3NHEA 1PPPA 2P7UA 1ME3A 2AS8A 1THEA 3HHIA 1ICFA 2XU5A 2DC6A 4PP1A 2NQGA 3H8CA 1MS6A 1YK8A 1YK7A 2DC9A 1GECE 1BP4A 1U9XA 3H8BA 1YT7A 2PBHA 4AXMA 5FPWA 4YVAA 1U9VA 4YYUA 1AU3A 4MZSA 1CB5A 1Y4HA 1EWPA 2DJGB 1EWLA 1GX3A 1CQDA 2HD5A 3KKUA 3K24A 1NB5A 1MEMA 1VJVA 2CIOA 1PPDA 1EWOA 4FK5A 3KWZA 1KFXL 2Y6EA 3MORA 1PADA 2AUZA 2IPPB 3K8UA 1QXPA 2NQIA 2GHUA 4G54A 3GCBA 4CDDB 4YYVA 2YJBA 2FRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWY A;  4YYS A;  1PPO A;  3E1Z B;  2FTD A;  5CHT A;  2AUX A;  2XU3 A;  1NB3 A;  2FUD A;  2DCC A;  4Q8H A;  1YAL A;  3IUT A;  3N4C A;  1GLO A;  1PXV A;  3I3T A;  2B1N A;  2YJC A;  5CVN B;  2AIM A;  2VHF A;  4P6G A;  1SP4 B;  1Y08 A;  1ZCM A;  4YYQ A;  2PRE A;  4CDE B;  2ACT A;  3KX1 A;  2O6X A;  1GCB A;  1DEU A;  3QT4 A;  3QJ3 A;  1MDW A;  3ERV A;  3OVZ A;  8PCH A;  2DCB A;  3DF0 A;  2YJ2 A;  4QRV A;  1AIM A;  1PCI A;  1KHQ A;  4YV8 A;  2WBF X;  2XU1 A;  3BOW A;  4P6E A;  4X6J A;  4XR7 A;  1PIP A;  2GFO A;  4I04 A;  2AYO A;  2H7J A;  2PAD A;  3HWN A;  5CHV A;  3BWK A;  1U9Q X;  3HHA A;  1CTE A;  1CPJ A;  1NLJ A;  3IOQ A;  4X6I A;  3K9M A;  3PNR A;  4I07 A;  7PCK A;  4N8W A;  4PP2 E;  3RVW A;  2C0Y A;  2R9C A;  3B79 A;  1DF0 A;  2G7Y A;  1PE6 A;  1ITO A;  3IMA A;  1AYU A;  1HUC B;  2CB5 A;  1MIR A;  1CSB B;  3TNX A;  4X6H A;  1O0E A;  1F2B A;  2ATO A;  5JH3 A;  5J94 A;  1CV8 A;  1NPZ A;  2DJF B;  3KFQ A;  3PDF A;  4PAD A;  1AU0 A;  5A24 A;  2AU1 A;  2DCD A;  3MTN A;  3MHS A;  2P86 A;  1Q6K A;  4DMY A;  3CBK A;  4CDC B;  3I06 A;  1K3B B;  2G8E A;  1TU6 A;  2DC8 A;  3BPM A;  3IHP A;  1ME4 A;  1S4V A;  4BSQ A;  2XU4 A;  2OUL A;  1YVB A;  3PW3 A;  3H7D A;  4OEM A;  3IEJ A;  4BS6 A;  2P0R A;  2E00 A;  3ZUA A;  2NQD B;  3N3K A;  1AEC A;  4OEL A;  2FT2 A;  3CH2 X;  3HD3 A;  4DMX A;  3C9E A;  4CZW A;  1QMY A;  1KFU L;  4BPV A;  1MHW A;  3P5W A;  2DC7 A;  1QOL A;  4ZUX U;  2R9N A;  6PAD A;  3WXF A;  2E01 A;  4BQV A;  1IWD A;  3S3R A;  2G8J A;  2JQF R;  3LFY A;  2R9O A;  3MHH A;  2ARY A;  3CH3 X;  1NL6 A;  4PI3 A;  9PAP A;  4W5B A;  3S3Q A;  1AYW A;  5CVM A;  3RVV A;  2B1M A;  2E02 A;  3OIS A;  1ZIV A;  3QSD A;  3P5U A;  3IV2 A;  1BY8 A;  3KSE A;  3KW9 A;  4MZO A;  2R9M A;  1ATK A;  2DZY A;  1PPN A;  1X9Y A;  1XKG A;  2FRA A;  3WXG A;  1M6D A;  2AYN A;  1F29 A;  2BDZ A;  3P5X A;  2JQG R;  2FQ9 A;  1KXR A;  2DCA A;  3LXS A;  4YYR A;  5EGW A;  3V6E A;  4N4Z A;  3OF8 A;  4I05 A;  3AI8 A;  1U5I A;  2BDL A;  4BS5 A;  1TLO A;  2HHN A;  2Y5B A;  1EF7 A;  1FH0 A;  3OVX A;  3H89 A;  1SNK A;  4RY2 A;  2F7D A;  3CBJ A;  4W4U A;  3N3G A;  3PBH A;  1F2C A;  1CVZ A;  2NQA A;  1BQI A;  1A6R A;  2F1G A;  2OZ2 A;  2DZZ A;  3BPF A;  2HH5 A;  2YJ9 A;  3V6C A;  1AU2 A;  4AXL A;  4KLB A;  3F75 A;  2VHS A;  3O1G A;  3KWB X;  3BC3 A;  2IBI A;  1VSN A;  4XUI A;  2G6D A;  1KHP A;  3WXE A;  3F5V A;  5JA7 A;  1CJL A;  2OP3 A;  3OF9 A;  1CS8 A;  1AYV A;  1BGO A;  2YJ8 A;  1GMY A;  4K7C A;  4Q8G A;  1MEG A;  4FJC A;  2HXZ A;  5CVO B;  5F02 A;  4CDF B;  4QRX A;  1PBH A;  3M99 A;  2PNS A;  3BCN A;  4MSX A;  1STF E;  4QH6 A;  4YYW A;  1QDQ A;  4N79 A;  4W5C A;  5PAD A;  2R9F A;  4QRG A;  3P5V A;  2R6N A;  1U9W A;  2FYE A;  2E03 A;  2AVW A;  4QBB A;  3RVX A;  1POP A;  1NQC A;  3O0U A;  5EF4 A;  3D6S A;  1EWM A;  4FIP A;  3H6S A;  1AU4 A;  1F2A A;  4WA6 A;  5K16 A;  2FO5 A;  3USV A;  1TL9 A;  1JQP A;  3U8E A;  3NHE A;  1PPP A;  2P7U A;  1ME3 A;  2AS8 A;  1THE A;  3HHI A;  1ICF A;  2XU5 A;  2DC6 A;  4PP1 A;  2NQG A;  3H8C A;  1MS6 A;  1YK8 A;  1YK7 A;  2DC9 A;  1GEC E;  1BP4 A;  1U9X A;  3H8B A;  1YT7 A;  2PBH A;  4AXM A;  5FPW A;  4YVA A;  1U9V A;  4YYU A;  1AU3 A;  4MZS A;  1CB5 A;  1Y4H A;  1EWP A;  2DJG B;  1EWL A;  1CQD A;  2HD5 A;  3KKU A;  3K24 A;  1NB5 A;  1MEM A;  1VJV A;  2CIO A;  1PPD A;  1EWO A;  4FK5 A;  3KWZ A;  1KFX L;  2Y6E A;  3MOR A;  1PAD A;  2AUZ A;  2IPP B;  3K8U A;  1QXP A;  2NQI A;  2GHU A;  4G54 A;  3GCB A;  4CDD B;  4YYV A;  2YJB A;  2FRQ A; 
#chains in the Genus database with same CATH topology
 4HWY A;  4YYS A;  3W30 A;  1PPO A;  3E1Z B;  2FTD A;  5CHT A;  2AUX A;  2XU3 A;  1NB3 A;  2FUD A;  3E9S A;  3MTV A;  2DCC A;  4Q8H A;  1YAL A;  3IUT A;  3N4C A;  4D8E A;  1GLO A;  1PXV A;  3I3T A;  2B1N A;  2YJC A;  5CVN B;  2AIM A;  2VHF A;  4P6G A;  1SP4 B;  1Y08 A;  1ZCM A;  4YYQ A;  2PRE A;  4CDE B;  2DOS A;  2ACT A;  3KX1 A;  2O6X A;  1GCB A;  4BOU A;  1DEU A;  3QT4 A;  3O65 A;  3QJ3 A;  1MDW A;  3ERV A;  3OVZ A;  8PCH A;  1YZB A;  2DCB A;  3DF0 A;  2BU3 A;  2YJ2 A;  4QRV A;  1AIM A;  1PCI A;  1KHQ A;  4YV8 A;  2WBF X;  4D8B A;  2XU1 A;  3BOW A;  4P6E A;  4X6J A;  4XR7 A;  1PIP A;  2GFO A;  4I04 A;  2AYO A;  2H7J A;  2PAD A;  3HWN A;  5CHV A;  3BWK A;  1U9Q X;  3HHA A;  1CTE A;  4MI7 A;  1CPJ A;  1NLJ A;  5E6J A;  4A5U A;  3IOQ A;  4X6I A;  3K9M A;  3PNR A;  4I07 A;  7PCK A;  3PRM A;  4N8W A;  5KO3 A;  4PP2 E;  2HWK A;  3RVW A;  2C0Y A;  2R9C A;  3B79 A;  1DF0 A;  2G7Y A;  1PE6 A;  1ITO A;  3IMA A;  1AYU A;  1HUC B;  2CB5 A;  1MIR A;  1CSB B;  3TNX A;  4X6H A;  1O0E A;  1F2B A;  2ATO A;  5JH3 A;  1PVJ A;  5J94 A;  1CV8 A;  1NPZ A;  2DJF B;  3KFQ A;  4P16 A;  4PT5 A;  3PDF A;  4PAD A;  1AU0 A;  3ZNH A;  5A24 A;  2AU1 A;  2DCD A;  3MTN A;  3MHS A;  2P86 A;  1Q6K A;  4DMY A;  3CBK A;  4CDC B;  3I06 A;  1K3B B;  2G8E A;  1TU6 A;  2DC8 A;  3BPM A;  3IHP A;  1ME4 A;  1S4V A;  4BSQ A;  2XU4 A;  2OUL A;  1YVB A;  3PW3 A;  3H7D A;  4REZ A;  4OEM A;  3IEJ A;  4RNA A;  4BS6 A;  2P0R A;  2BTW B;  2E00 A;  3MP2 A;  3ZUA A;  2NQD B;  3N3K A;  3C0R A;  1AEC A;  3PHU A;  4OEL A;  2FT2 A;  3CH2 X;  3HD3 A;  4DMX A;  3C9E A;  4CZW A;  4BOP A;  1QMY A;  1KFU L;  4BPV A;  1MHW A;  3P5W A;  2DC7 A;  1QOL A;  4ZUX U;  4OVZ A;  2R9N A;  6PAD A;  3WXF A;  2E01 A;  4BQV A;  1IWD A;  3S3R A;  2G8J A;  3BY4 A;  2JQF R;  3LFY A;  2R9O A;  3MHH A;  4ZTB A;  3TMP A;  1DKI A;  2ARY A;  3CH3 X;  2AGA A;  1NL6 A;  4PI3 A;  9PAP A;  4W5B A;  3S3Q A;  1AYW A;  5CVM A;  3RVV A;  2B1M A;  4RF0 A;  2E02 A;  3OIS A;  1ZIV A;  3PHW A;  3QSD A;  3OQC A;  3P5U A;  3IV2 A;  1BY8 A;  3KSE A;  3KW9 A;  4MZO A;  2R9M A;  1ATK A;  2DZY A;  1PPN A;  3PHX A;  1X9Y A;  4OW0 A;  1XKG A;  2FRA A;  3WXG A;  1M6D A;  2AYN A;  1F29 A;  2BDZ A;  3P5X A;  2JQG R;  2FQ9 A;  1KXR A;  2DCA A;  3B21 A;  3LXS A;  5EGW A;  3V6E A;  4YYR A;  4N4Z A;  3OF8 A;  3IFU A;  4I05 A;  3AI8 A;  4BOZ A;  1U5I A;  2BDL A;  4BS5 A;  1TLO A;  2HHN A;  2Y5B A;  1EF7 A;  2J7Q C;  1FH0 A;  3OVX A;  3H89 A;  4MM3 B;  1SNK A;  4RY2 A;  2F7D A;  3CBJ A;  4W4U A;  3N3G A;  3PBH A;  1F2C A;  1CVZ A;  2NQA A;  1BQI A;  1A6R A;  2F1G A;  2OZ2 A;  3W31 A;  2DZZ A;  2FE8 A;  3MJ5 A;  3BPF A;  2HH5 A;  2YJ9 A;  3V6C A;  1AU2 A;  4AXL A;  4KLB A;  1UKF A;  3F75 A;  4GUA A;  2VHS A;  3O1G A;  3KWB X;  3BC3 A;  2IBI A;  1VSN A;  4XUI A;  2G6D A;  1KHP A;  3WXE A;  3F5V A;  5JA7 A;  1CJL A;  2OP3 A;  3OF9 A;  4D8I A;  1CS8 A;  1AYV A;  1BGO A;  2YJ8 A;  1GMY A;  4HXD B;  2JTC A;  4IUM A;  4K7C A;  4Q8G A;  1MEG A;  4FJC A;  4IP3 A;  2HXZ A;  5CVO B;  5F02 A;  4CDF B;  4QRX A;  1PBH A;  3M99 A;  2PNS A;  3BCN A;  2JRI A;  4MSX A;  1STF E;  3BB7 A;  4QH6 A;  4XZX A;  4YYW A;  1QDQ A;  4N79 A;  3BBA A;  4W5C A;  5PAD A;  2R9F A;  4RKX A;  4QRG A;  2UZJ A;  3P5V A;  2R6N A;  1U9W A;  2FYE A;  2E03 A;  2AVW A;  4OVZ B;  4QBB A;  3PSE A;  3RVX A;  1POP A;  1NQC A;  3O0U A;  5EF4 A;  3D6S A;  1EWM A;  4FIP A;  4WUR A;  3H6S A;  1AU4 A;  1F2A A;  4WA6 A;  5EZQ A;  5K16 A;  2FO5 A;  3USV A;  1TL9 A;  1JQP A;  3U8E A;  3NHE A;  1PPP A;  2P7U A;  4R3D A;  1ME3 A;  2AS8 A;  1THE A;  3HHI A;  3RNV A;  1ICF A;  2XU5 A;  2DC6 A;  4PP1 A;  2NQG A;  3H8C A;  1MS6 A;  1YK8 A;  4BOS A;  1YK7 A;  2DC9 A;  1GEC E;  1BP4 A;  1U9X A;  3H8B A;  1YT7 A;  2Z84 A;  2PBH A;  4AXM A;  5FPW A;  4YVA A;  3PT2 A;  1U9V A;  4YYU A;  1AU3 A;  4MZS A;  1CB5 A;  1Y4H A;  1EWP A;  2DJG B;  1EWL A;  3TRK A;  1CQD A;  2HD5 A;  3KKU A;  3K24 A;  1NB5 A;  1MEM A;  1VJV A;  5EZS A;  2CIO A;  1PPD A;  1EWO A;  2J7Q A;  4FK5 A;  3KWZ A;  1KFX L;  2Y6E A;  3MOR A;  1PAD A;  2AUZ A;  2IPP B;  3K8U A;  1QXP A;  2NQI A;  4RF1 A;  5JZE A;  2GHU A;  4G54 A;  3GCB A;  4M0W A;  4BOQ A;  4CDD B;  4YYV A;  2BTW A;  2YJB A;  3PRP A;  2FRQ A; 
#chains in the Genus database with same CATH homology
 4HWY A;  4YYS A;  1PPO A;  3E1Z B;  2FTD A;  5CHT A;  2AUX A;  2XU3 A;  1NB3 A;  2FUD A;  2DCC A;  2BSZ A;  4Q8H A;  1YAL A;  4BGF A;  3IUT A;  2VFB A;  3N4C A;  1GLO A;  1PXV A;  3I3T A;  1W5R A;  2B1N A;  2YJC A;  5CVN B;  2AIM A;  2VHF A;  4P6G A;  1SP4 B;  1Y08 A;  1ZCM A;  4YYQ A;  2PRE A;  4CDE B;  2ACT A;  3KX1 A;  2O6X A;  1GCB A;  1DEU A;  3QT4 A;  3QJ3 A;  1MDW A;  3ERV A;  3OVZ A;  8PCH A;  2DCB A;  3DF0 A;  2YJ2 A;  4QRV A;  4B55 A;  1AIM A;  1PCI A;  1KHQ A;  4YV8 A;  2WBF X;  2XU1 A;  3BOW A;  4P6E A;  4X6J A;  4XR7 A;  1PIP A;  1E2T A;  2GFO A;  4I04 A;  2AYO A;  2H7J A;  4NV7 A;  2PAD A;  3HWN A;  5CHV A;  3BWK A;  1U9Q X;  3HHA A;  1CTE A;  1CPJ A;  1NLJ A;  3IOQ A;  4X6I A;  3K9M A;  3PNR A;  4I07 A;  7PCK A;  4N8W A;  4PP2 E;  3RVW A;  2C0Y A;  2R9C A;  3B79 A;  1DF0 A;  2G7Y A;  1PE6 A;  1ITO A;  3IMA A;  1W4T A;  1AYU A;  1HUC B;  2CB5 A;  1MIR A;  1CSB B;  3TNX A;  4X6H A;  1O0E A;  1F2B A;  2ATO A;  5JH3 A;  5J94 A;  3D9W A;  1CV8 A;  1NPZ A;  2DJF B;  3KFQ A;  3PDF A;  4GUZ A;  4PAD A;  1AU0 A;  5A24 A;  2AU1 A;  2DCD A;  3MTN A;  3MHS A;  2P86 A;  1Q6K A;  4DMY A;  3CBK A;  4CDC B;  3I06 A;  1K3B B;  2G8E A;  1TU6 A;  2DC8 A;  3BPM A;  3IHP A;  1ME4 A;  1S4V A;  4BSQ A;  2XU4 A;  2OUL A;  1YVB A;  3PW3 A;  3H7D A;  4OEM A;  3IEJ A;  3LTW A;  4BS6 A;  2P0R A;  2E00 A;  3ZUA A;  2NQD B;  3N3K A;  1AEC A;  4OEL A;  2FT2 A;  3CH2 X;  3HD3 A;  4DMX A;  3C9E A;  4CZW A;  1QMY A;  1KFU L;  4BPV A;  1MHW A;  3P5W A;  2DC7 A;  1QOL A;  4ZUX U;  2R9N A;  6PAD A;  3WXF A;  2E01 A;  4BQV A;  1IWD A;  3S3R A;  2G8J A;  2JQF R;  3LFY A;  2R9O A;  3MHH A;  2ARY A;  3CH3 X;  1NL6 A;  4PI3 A;  9PAP A;  4W5B A;  3S3Q A;  1AYW A;  5CVM A;  3RVV A;  2B1M A;  2E02 A;  3OIS A;  1ZIV A;  3QSD A;  3P5U A;  3IV2 A;  1BY8 A;  3KSE A;  3KW9 A;  4MZO A;  2R9M A;  1ATK A;  2DZY A;  1PPN A;  1X9Y A;  1XKG A;  2FRA A;  3WXG A;  1M6D A;  2AYN A;  1F29 A;  2BDZ A;  3P5X A;  2JQG R;  2FQ9 A;  1KXR A;  2DCA A;  3LXS A;  4YYR A;  5EGW A;  3V6E A;  4N4Z A;  3OF8 A;  4I05 A;  3AI8 A;  1U5I A;  4NV8 A;  2BDL A;  4BS5 A;  1TLO A;  2HHN A;  2Y5B A;  1EF7 A;  1FH0 A;  3OVX A;  3H89 A;  1SNK A;  4RY2 A;  2F7D A;  3CBJ A;  4W4U A;  3N3G A;  3PBH A;  1F2C A;  1CVZ A;  2NQA A;  1BQI A;  1A6R A;  2F1G A;  2OZ2 A;  2DZZ A;  4C5P A;  3BPF A;  2HH5 A;  2YJ9 A;  3V6C A;  1AU2 A;  4AXL A;  4KLB A;  3F75 A;  2VHS A;  3O1G A;  3KWB X;  3BC3 A;  2IBI A;  1VSN A;  4XUI A;  2G6D A;  1KHP A;  3WXE A;  3F5V A;  5JA7 A;  1CJL A;  2OP3 A;  3OF9 A;  1CS8 A;  1AYV A;  1BGO A;  2YJ8 A;  1GMY A;  4K7C A;  4Q8G A;  1MEG A;  4FJC A;  2HXZ A;  5CVO B;  5F02 A;  4CDF B;  4QRX A;  1PBH A;  3M99 A;  2PNS A;  3BCN A;  4MSX A;  1STF E;  4QH6 A;  4YYW A;  1QDQ A;  4N79 A;  4W5C A;  5PAD A;  1W6F A;  2R9F A;  4QRG A;  3P5V A;  2R6N A;  1U9W A;  2FYE A;  2E03 A;  2AVW A;  4QBB A;  3RVX A;  1POP A;  1NQC A;  3O0U A;  5EF4 A;  2VFC A;  3D6S A;  1EWM A;  4FIP A;  3H6S A;  1AU4 A;  1F2A A;  4WA6 A;  5K16 A;  2FO5 A;  3USV A;  1TL9 A;  1JQP A;  3U8E A;  3NHE A;  1PPP A;  2P7U A;  1ME3 A;  2AS8 A;  1THE A;  3HHI A;  1ICF A;  2XU5 A;  2DC6 A;  4PP1 A;  2NQG A;  3H8C A;  1MS6 A;  1YK8 A;  1YK7 A;  2DC9 A;  1GEC E;  1BP4 A;  1U9X A;  3H8B A;  1YT7 A;  2PBH A;  4AXM A;  5FPW A;  4YVA A;  1U9V A;  4YYU A;  1AU3 A;  4MZS A;  1CB5 A;  1Y4H A;  1EWP A;  2DJG B;  1EWL A;  1GX3 A;  1CQD A;  2HD5 A;  3KKU A;  3K24 A;  1NB5 A;  1MEM A;  1VJV A;  2CIO A;  1PPD A;  1EWO A;  4FK5 A;  3KWZ A;  1KFX L;  2Y6E A;  3MOR A;  1PAD A;  2AUZ A;  2IPP B;  3K8U A;  1QXP A;  2NQI A;  2GHU A;  4G54 A;  3GCB A;  4CDD B;  4YYV A;  2YJB A;  2FRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...