1SP4B

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
RVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCNKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
total genus 49
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1sp4B00
1PCIA 4OEMA 1PPDA 1KFUL 1Q6KA 2B1MA 1U9WA 1BGOA 1SP4B 1M6DA 4YYVA 1VJVA 3S3QA 4YYSA 1BP4A 4I07A 1MEMA 1ZCMA 2IPPB 1MDWA 4Q8HA 2CIOA 2R9NA 1YALA 3P5VA 5FPWA 2DC9A 5J94A 2H7JA 4MZOA 1GCBA 2PNSA 5EF4A 1QOLA 2PREA 4CDDB 1MHWA 1U9QX 2E03A 1F2AA 2Y6EA 4CDCB 1CVZA 4PI3A 3V6EA 3I3TA 4X6HA 1AIMA 4AXLA 4BQVA 1ATKA 1F2CA 2YJBA 2HHNA 4YYQA 3PDFA 3S3RA 2CB5A 1AU2A 3CH2X 3BPMA 1EWMA 1U9XA 2DC7A 2NQDB 3P5XA 2PADA 3V6CA 4DMXA 4PADA 2O6XA 2DC8A 2AS8A 1YK7A 4RY2A 3TNXA 4Q8GA 3LXSA 5CHTA 1GLOA 1Y08A 4P6EA 3WXFA 2E00A 1AYVA 4BS5A 3OVXA 1PE6A 3F75A 3MORA 2XU4A 4MZSA 1U5IA 1ME3A 3WXGA 2JQFR 3ZUAA 1AYWA 1POPA 1IWDA 3HD3A 2FQ9A 1AYUA 1PIPA 2DCAA 3KSEA 3F5VA 3MHHA 2R9FA 2R9CA 4XR7A 1ITOA 3U8EA 3C9EA 2FRAA 2R9MA 2R6NA 3HHIA 2PBHA 3BC3A 1CTEA 1PPOA 2XU5A 1QMYA 2VHFA 3DF0A 4BS6A 5PADA 1KXRA 3O1GA 4QRVA 3QSDA 4W5BA 9PAPA 5K16A 2FYEA 1BY8A 2BDZA 4G54A 1CJLA 3CBJA 4BSQA 3H8BA 3D6SA 1STFE 3CH3X 2GHUA 3OISA 1DF0A 4K7CA 1K3BB 4QBBA 1KHPA 3M99A 1PBHA 3RVVA 5JH3A 2G8EA 4OELA 1NB3A 3KFQA 4BPVA 3BCNA 4N4ZA 3N3GA 4N79A 4PP1A 3RVWA 1CQDA 2P0RA 1AU4A 3IOQA 4FIPA 3WXEA 4CDEB 2DC6A 4YVAA 2OP3A 3E1ZB 3MHSA 1GECE 1S4VA 2IBIA 4YYRA 2VHSA 4AXMA 2XU1A 2ARYA 1YK8A 1F29A 2NQGA 3USVA 3CBKA 3PNRA 2AUZA 1AECA 3MTNA 1YT7A 1CS8A 3LFYA 1THEA 8PCHA 3B79A 5CVNB 2FO5A 4CZWA 4I05A 1PADA 1U9VA 3KX1A 3N4CA 2AVWA 1NL6A 1F2BA 3K24A 3K8UA 5JA7A 2FUDA 1QXPA 2AUXA 3H6SA 4X6IA 1X9YA 2Y5BA 2C0YA 1PPPA 2ACTA 1ZIVA 3RVXA 1EF7A 4PP2E 2AYOA 3KWBX 1CPJA 3N3KA 3OF8A 2WBFX 1MEGA 1ICFA 2FTDA 3PW3A 2AYNA 1ME4A 2DZZA 3P5WA 7PCKA 3BOWA 1A6RA 4FK5A 4FJCA 3O0UA 4X6JA 1EWLA 1HUCB 4WA6A 2F7DA 4W5CA 3HWNA 3KWZA 4CDFB 3H8CA 3BWKA 2G8JA 3AI8A 3HHAA 2YJ2A 6PADA 3QJ3A 2F1GA 3IHPA 2R9OA 4YV8A 2G6DA 3IV2A 1PXVA 1DEUA 2OZ2A 3BPFA 3IMAA 3GCBA 1EWOA 2YJ8A 3H89A 1FH0A 1QDQA 4YYUA 4QRGA 1YVBA 2YJ9A 2DCDA 1EWPA 1CV8A 1KFXL 1NLJA 2B1NA 4KLBA 4QH6A 1GMYA 4QRXA 2FRQA 2P86A 1CSBB 2AIMA 3PBHA 3P5UA 2HXZA 2ATOA 4HWYA 2OULA 2BDLA 1PPNA 4N8WA 5CHVA 2DZYA 3OVZA 2XU3A 2NQAA 4MSXA 4XUIA 1NPZA 3QT4A 1TU6A 2YJCA 5CVMA 3K9MA 1Y4HA 2AU1A 3KW9A 2HD5A 3H7DA 4YYWA 1VSNA 2DCCA 4I04A 1KHQA 1SNKA 4P6GA 1NQCA 4ZUXU 2E02A 1JQPA 5CVOB 5F02A 3KKUA 3ERVA 1BQIA 2DJFB 1MIRA 4DMYA 4W4UA 1XKGA 3OF9A 1MS6A 1O0EA 2JQGR 1CB5A 1TL9A 1TLOA 2GFOA 5EGWA 3I06A 5A24A 1NB5A 3IEJA 2DCBA 2NQIA 2P7UA 3IUTA 2FT2A 3NHEA 1AU0A 2DJGB 2E01A 2HH5A 1AU3A 2G7YA
chains in the Genus database with same CATH superfamily
1PCIA 4OEMA 1PPDA 1KFUL 1Q6KA 2B1MA 1U9WA 1BGOA 4BOUA 1SP4B 1M6DA 4YYVA 1VJVA 4PT5A 3S3QA 4YYSA 1BP4A 4I07A 1MEMA 1ZCMA 2IPPB 1MDWA 4Q8HA 2CIOA 2R9NA 1YALA 4BOPA 3P5VA 5FPWA 2DC9A 5EZQA 5J94A 2H7JA 4MZOA 1GCBA 2PNSA 3PRMA 5EF4A 1QOLA 2PREA 1DKIA 4CDDB 1MHWA 1U9QX 3W30A 2E03A 1F2AA 2Y6EA 4CDCB 1CVZA 4PI3A 3V6EA 3I3TA 4X6HA 1AIMA 4AXLA 4BQVA 1ATKA 1F2CA 3PT2A 2AGAA 2YJBA 2HHNA 3PRPA 4YYQA 3B21A 3PDFA 2BTWA 3S3RA 2CB5A 1AU2A 3CH2X 3BPMA 1EWMA 1U9XA 2DC7A 2NQDB 3P5XA 2PADA 3V6CA 4DMXA 4PADA 2O6XA 2DC8A 2AS8A 1YK7A 2DOSA 2HWKA 4RY2A 3PHXA 4Q8GA 3TNXA 3LXSA 5CHTA 1GLOA 4MI7A 1Y08A 4OVZB 3C0RA 4P6EA 3WXFA 2E00A 3MJ5A 1AYVA 4BS5A 3OVXA 1PE6A 3F75A 4HXDB 3MORA 2XU4A 4MZSA 2Z84A 1U5IA 1ME3A 3WXGA 4IUMA 2JQFR 4REZA 4D8EA 3ZUAA 1AYWA 1POPA 1IWDA 3HD3A 2FQ9A 1AYUA 1PIPA 2DCAA 3KSEA 3F5VA 3MHHA 2R9FA 4ZTBA 2R9CA 4XR7A 1ITOA 3U8EA 4BOZA 3C9EA 2FRAA 2R9MA 4OW0A 2R6NA 3HHIA 2PBHA 3BC3A 5KO3A 1CTEA 1PPOA 2XU5A 1QMYA 2VHFA 2FE8A 4D8BA 3DF0A 4BS6A 5PADA 3MTVA 3BB7A 1KXRA 3O1GA 4QRVA 3QSDA 4W5BA 9PAPA 5K16A 2FYEA 1BY8A 2BDZA 4G54A 1CJLA 3CBJA 4BSQA 3H8BA 3D6SA 1STFE 3CH3X 2GHUA 3OISA 1DF0A 4K7CA 1K3BB 4QBBA 1KHPA 3M99A 1PBHA 3RVVA 5JH3A 2G8EA 4OELA 1NB3A 3KFQA 4WURA 4BPVA 3BCNA 2JTCA 4N4ZA 3N3GA 4N79A 4PP1A 3RVWA 1CQDA 2P0RA 1AU4A 3IOQA 4RF1A 4FIPA 3WXEA 4CDEB 2DC6A 4YVAA 2OP3A 3E1ZB 3MHSA 1GECE 1S4VA 2IBIA 4YYRA 1PVJA 2VHSA 3O65A 4AXMA 2XU1A 4P16A 2ARYA 1YK8A 2JRIA 1F29A 2NQGA 3USVA 4XZXA 3CBKA 3PNRA 2AUZA 5E6JA 4A5UA 1AECA 3MTNA 1YT7A 1CS8A 3LFYA 1THEA 8PCHA 3B79A 4R3DA 5CVNB 2FO5A 2BTWB 4CZWA 4I05A 1PADA 1U9VA 3KX1A 3N4CA 2AVWA 1YZBA 3TMPA 1NL6A 1F2BA 4IP3A 3K24A 3K8UA 5JA7A 3PHUA 2J7QC 3OQCA 2FUDA 2BU3A 4RNAA 4OVZA 1QXPA 2AUXA 3H6SA 4X6IA 1X9YA 2Y5BA 2C0YA 1PPPA 2ACTA 1ZIVA 3RVXA 1EF7A 4PP2E 2AYOA 3KWBX 1CPJA 3ZNHA 3N3KA 3OF8A 2WBFX 3BY4A 1MEGA 3MP2A 1ICFA 2FTDA 3PW3A 2AYNA 1ME4A 2DZZA 3P5WA 4MM3B 7PCKA 3BOWA 1A6RA 4FK5A 4FJCA 3O0UA 4X6JA 3RNVA 1EWLA 1HUCB 4WA6A 2F7DA 4W5CA 3HWNA 3KWZA 4CDFB 3H8CA 3BWKA 2G8JA 3AI8A 3HHAA 3BBAA 2YJ2A 6PADA 3E9SA 3QJ3A 2F1GA 3IHPA 2R9OA 4YV8A 2G6DA 3IV2A 1PXVA 1DEUA 2OZ2A 3BPFA 3W31A 3IMAA 3GCBA 1EWOA 4M0WA 2YJ8A 3H89A 1FH0A 1QDQA 4YYUA 4QRGA 4RKXA 1YVBA 2YJ9A 2DCDA 5JZEA 1EWPA 1CV8A 3PHWA 1KFXL 1NLJA 2B1NA 4KLBA 4QH6A 1GMYA 4QRXA 2FRQA 2P86A 1CSBB 2AIMA 3PBHA 2UZJA 1UKFA 3P5UA 2HXZA 2ATOA 4HWYA 2OULA 2BDLA 1PPNA 4N8WA 5CHVA 2DZYA 3OVZA 2XU3A 2NQAA 4MSXA 4XUIA 1NPZA 3IFUA 3QT4A 1TU6A 2YJCA 5CVMA 3K9MA 1Y4HA 2AU1A 3KW9A 2HD5A 3H7DA 4YYWA 1VSNA 2DCCA 3PSEA 4I04A 1KHQA 1SNKA 4P6GA 1NQCA 3TRKA 4ZUXU 2E02A 1JQPA 5CVOB 5F02A 3KKUA 4BOSA 3ERVA 1BQIA 2DJFB 1MIRA 4RF0A 4GUAA 4DMYA 4W4UA 1XKGA 3OF9A 1MS6A 1O0EA 2JQGR 1CB5A 1TL9A 1TLOA 2GFOA 5EGWA 4D8IA 5EZSA 3I06A 4BOQA 2J7QA 5A24A 1NB5A 3IEJA 2DCBA 2NQIA 2P7UA 3IUTA 2FT2A 3NHEA 1AU0A 2DJGB 2E01A 2HH5A 1AU3A 2G7YA
chains in the Genus database with same CATH topology
1PCIA 4OEMA 1PPDA 1KFUL 1Q6KA 2B1MA 1U9WA 1BGOA 1SP4B 1M6DA 4YYVA 1VJVA 3S3QA 4YYSA 1BP4A 4I07A 1MEMA 1ZCMA 2IPPB 1MDWA 4Q8HA 2CIOA 2R9NA 1YALA 1W5RA 3P5VA 5FPWA 2DC9A 5J94A 2H7JA 4MZOA 1GCBA 2PNSA 5EF4A 1QOLA 2PREA 4CDDB 1MHWA 1U9QX 2E03A 1F2AA 2Y6EA 4CDCB 1CVZA 2BSZA 4PI3A 3V6EA 3I3TA 4X6HA 1AIMA 4NV7A 4AXLA 4BQVA 1ATKA 1F2CA 2YJBA 2HHNA 4YYQA 3PDFA 3S3RA 2CB5A 1AU2A 3CH2X 3BPMA 1EWMA 1U9XA 2DC7A 2NQDB 3P5XA 2PADA 3V6CA 4DMXA 4PADA 2O6XA 2DC8A 2AS8A 1YK7A 4RY2A 4Q8GA 3TNXA 3LXSA 5CHTA 1GLOA 1Y08A 4P6EA 3WXFA 2E00A 1AYVA 4BS5A 3OVXA 1PE6A 3F75A 3MORA 2XU4A 4MZSA 1U5IA 1ME3A 3WXGA 2JQFR 3ZUAA 1AYWA 1POPA 1IWDA 3HD3A 2FQ9A 1AYUA 1PIPA 2DCAA 3KSEA 3F5VA 3MHHA 2R9FA 2R9CA 4XR7A 1ITOA 3U8EA 3C9EA 2FRAA 2R9MA 2R6NA 3HHIA 2PBHA 3BC3A 1CTEA 1PPOA 2XU5A 1QMYA 2VHFA 3DF0A 4BS6A 5PADA 1KXRA 1GX3A 3O1GA 4QRVA 3QSDA 4W5BA 9PAPA 5K16A 2FYEA 1BY8A 2BDZA 4G54A 1CJLA 3CBJA 4BSQA 3H8BA 3D6SA 1STFE 3CH3X 2GHUA 3OISA 1DF0A 4K7CA 1K3BB 4QBBA 1KHPA 3M99A 1PBHA 3RVVA 5JH3A 2G8EA 4OELA 1NB3A 4NV8A 3KFQA 4BPVA 3BCNA 4N4ZA 3N3GA 4N79A 4PP1A 3RVWA 1CQDA 2P0RA 1AU4A 3IOQA 4B55A 4FIPA 3WXEA 4CDEB 2DC6A 4YVAA 2OP3A 3E1ZB 3MHSA 1GECE 1S4VA 2IBIA 4YYRA 2VHSA 4C5PA 4AXMA 2XU1A 2ARYA 1YK8A 1F29A 2NQGA 3USVA 3CBKA 3PNRA 2AUZA 4BGFA 1AECA 3MTNA 1YT7A 1CS8A 3LFYA 1THEA 8PCHA 3B79A 5CVNB 2FO5A 4CZWA 4I05A 4GUZA 1PADA 1U9VA 3KX1A 3N4CA 2AVWA 1NL6A 1F2BA 3K24A 3K8UA 5JA7A 2FUDA 1QXPA 2AUXA 3H6SA 4X6IA 1X9YA 2Y5BA 2C0YA 1E2TA 1PPPA 2ACTA 1ZIVA 3RVXA 1EF7A 4PP2E 2AYOA 3KWBX 1CPJA 2VFCA 3N3KA 3OF8A 2WBFX 1MEGA 1ICFA 2FTDA 3PW3A 2AYNA 1ME4A 2DZZA 3P5WA 7PCKA 3BOWA 1A6RA 4FK5A 4FJCA 3O0UA 4X6JA 3D9WA 1EWLA 1HUCB 4WA6A 2F7DA 4W5CA 3HWNA 3KWZA 4CDFB 3H8CA 3BWKA 2VFBA 2G8JA 3AI8A 3HHAA 2YJ2A 6PADA 3QJ3A 2F1GA 3IHPA 2R9OA 4YV8A 2G6DA 3IV2A 1PXVA 1DEUA 2OZ2A 3BPFA 3IMAA 3GCBA 1EWOA 2YJ8A 3H89A 1FH0A 1QDQA 4YYUA 4QRGA 1YVBA 2YJ9A 2DCDA 1EWPA 1CV8A 1KFXL 1NLJA 2B1NA 4KLBA 4QH6A 1GMYA 4QRXA 2FRQA 2P86A 1CSBB 2AIMA 3PBHA 3P5UA 2HXZA 2ATOA 4HWYA 2OULA 2BDLA 1PPNA 4N8WA 5CHVA 2DZYA 3OVZA 2XU3A 2NQAA 4MSXA 4XUIA 1NPZA 3QT4A 1TU6A 2YJCA 5CVMA 3K9MA 1Y4HA 2AU1A 3KW9A 2HD5A 3H7DA 4YYWA 1VSNA 2DCCA 4I04A 1KHQA 1SNKA 3LTWA 4P6GA 1NQCA 4ZUXU 2E02A 1W6FA 1JQPA 5CVOB 5F02A 3KKUA 3ERVA 1BQIA 2DJFB 1MIRA 4DMYA 4W4UA 1XKGA 3OF9A 1MS6A 1O0EA 2JQGR 1CB5A 1TL9A 1TLOA 2GFOA 5EGWA 3I06A 5A24A 1NB5A 3IEJA 2DCBA 2NQIA 2P7UA 3IUTA 2FT2A 3NHEA 1AU0A 1W4TA 2DJGB 2E01A 2HH5A 1AU3A 2G7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCI A;  4OEM A;  1PPD A;  1KFU L;  1Q6K A;  2B1M A;  1U9W A;  1BGO A;  1SP4 B;  1M6D A;  4YYV A;  1VJV A;  3S3Q A;  4YYS A;  1BP4 A;  4I07 A;  1MEM A;  1ZCM A;  2IPP B;  1MDW A;  4Q8H A;  2CIO A;  2R9N A;  1YAL A;  3P5V A;  5FPW A;  2DC9 A;  5J94 A;  2H7J A;  4MZO A;  1GCB A;  2PNS A;  5EF4 A;  1QOL A;  2PRE A;  4CDD B;  1MHW A;  1U9Q X;  2E03 A;  1F2A A;  2Y6E A;  4CDC B;  1CVZ A;  4PI3 A;  3V6E A;  3I3T A;  4X6H A;  1AIM A;  4AXL A;  4BQV A;  1ATK A;  1F2C A;  2YJB A;  2HHN A;  4YYQ A;  3PDF A;  3S3R A;  2CB5 A;  1AU2 A;  3CH2 X;  3BPM A;  1EWM A;  1U9X A;  2DC7 A;  2NQD B;  3P5X A;  2PAD A;  3V6C A;  4DMX A;  4PAD A;  2O6X A;  2DC8 A;  2AS8 A;  1YK7 A;  4RY2 A;  3TNX A;  4Q8G A;  3LXS A;  5CHT A;  1GLO A;  1Y08 A;  4P6E A;  3WXF A;  2E00 A;  1AYV A;  4BS5 A;  3OVX A;  1PE6 A;  3F75 A;  3MOR A;  2XU4 A;  4MZS A;  1U5I A;  1ME3 A;  3WXG A;  2JQF R;  3ZUA A;  1AYW A;  1POP A;  1IWD A;  3HD3 A;  2FQ9 A;  1AYU A;  1PIP A;  2DCA A;  3KSE A;  3F5V A;  3MHH A;  2R9F A;  2R9C A;  4XR7 A;  1ITO A;  3U8E A;  3C9E A;  2FRA A;  2R9M A;  2R6N A;  3HHI A;  2PBH A;  3BC3 A;  1CTE A;  1PPO A;  2XU5 A;  1QMY A;  2VHF A;  3DF0 A;  4BS6 A;  5PAD A;  1KXR A;  3O1G A;  4QRV A;  3QSD A;  4W5B A;  9PAP A;  5K16 A;  2FYE A;  1BY8 A;  2BDZ A;  4G54 A;  1CJL A;  3CBJ A;  4BSQ A;  3H8B A;  3D6S A;  1STF E;  3CH3 X;  2GHU A;  3OIS A;  1DF0 A;  4K7C A;  1K3B B;  4QBB A;  1KHP A;  3M99 A;  1PBH A;  3RVV A;  5JH3 A;  2G8E A;  4OEL A;  1NB3 A;  3KFQ A;  4BPV A;  3BCN A;  4N4Z A;  3N3G A;  4N79 A;  4PP1 A;  3RVW A;  1CQD A;  2P0R A;  1AU4 A;  3IOQ A;  4FIP A;  3WXE A;  4CDE B;  2DC6 A;  4YVA A;  2OP3 A;  3E1Z B;  3MHS A;  1GEC E;  1S4V A;  2IBI A;  4YYR A;  2VHS A;  4AXM A;  2XU1 A;  2ARY A;  1YK8 A;  1F29 A;  2NQG A;  3USV A;  3CBK A;  3PNR A;  2AUZ A;  1AEC A;  3MTN A;  1YT7 A;  1CS8 A;  3LFY A;  1THE A;  8PCH A;  3B79 A;  5CVN B;  2FO5 A;  4CZW A;  4I05 A;  1PAD A;  1U9V A;  3KX1 A;  3N4C A;  2AVW A;  1NL6 A;  1F2B A;  3K24 A;  3K8U A;  5JA7 A;  2FUD A;  1QXP A;  2AUX A;  3H6S A;  4X6I A;  1X9Y A;  2Y5B A;  2C0Y A;  1PPP A;  2ACT A;  1ZIV A;  3RVX A;  1EF7 A;  4PP2 E;  2AYO A;  3KWB X;  1CPJ A;  3N3K A;  3OF8 A;  2WBF X;  1MEG A;  1ICF A;  2FTD A;  3PW3 A;  2AYN A;  1ME4 A;  2DZZ A;  3P5W A;  7PCK A;  3BOW A;  1A6R A;  4FK5 A;  4FJC A;  3O0U A;  4X6J A;  1EWL A;  1HUC B;  4WA6 A;  2F7D A;  4W5C A;  3HWN A;  3KWZ A;  4CDF B;  3H8C A;  3BWK A;  2G8J A;  3AI8 A;  3HHA A;  2YJ2 A;  6PAD A;  3QJ3 A;  2F1G A;  3IHP A;  2R9O A;  4YV8 A;  2G6D A;  3IV2 A;  1PXV A;  1DEU A;  2OZ2 A;  3BPF A;  3IMA A;  3GCB A;  1EWO A;  2YJ8 A;  3H89 A;  1FH0 A;  1QDQ A;  4YYU A;  4QRG A;  1YVB A;  2YJ9 A;  2DCD A;  1EWP A;  1CV8 A;  1KFX L;  1NLJ A;  2B1N A;  4KLB A;  4QH6 A;  1GMY A;  4QRX A;  2FRQ A;  2P86 A;  1CSB B;  2AIM A;  3PBH A;  3P5U A;  2HXZ A;  2ATO A;  4HWY A;  2OUL A;  2BDL A;  1PPN A;  4N8W A;  5CHV A;  2DZY A;  3OVZ A;  2XU3 A;  2NQA A;  4MSX A;  4XUI A;  1NPZ A;  3QT4 A;  1TU6 A;  2YJC A;  5CVM A;  3K9M A;  1Y4H A;  2AU1 A;  3KW9 A;  2HD5 A;  3H7D A;  4YYW A;  1VSN A;  2DCC A;  4I04 A;  1KHQ A;  1SNK A;  4P6G A;  1NQC A;  4ZUX U;  2E02 A;  1JQP A;  5CVO B;  5F02 A;  3KKU A;  3ERV A;  1BQI A;  2DJF B;  1MIR A;  4DMY A;  4W4U A;  1XKG A;  3OF9 A;  1MS6 A;  1O0E A;  2JQG R;  1CB5 A;  1TL9 A;  1TLO A;  2GFO A;  5EGW A;  3I06 A;  5A24 A;  1NB5 A;  3IEJ A;  2DCB A;  2NQI A;  2P7U A;  3IUT A;  2FT2 A;  3NHE A;  1AU0 A;  2DJG B;  2E01 A;  2HH5 A;  1AU3 A;  2G7Y A; 
#chains in the Genus database with same CATH topology
 1PCI A;  4OEM A;  1PPD A;  1KFU L;  1Q6K A;  2B1M A;  1U9W A;  1BGO A;  4BOU A;  1SP4 B;  1M6D A;  4YYV A;  1VJV A;  4PT5 A;  3S3Q A;  4YYS A;  1BP4 A;  4I07 A;  1MEM A;  1ZCM A;  2IPP B;  1MDW A;  4Q8H A;  2CIO A;  2R9N A;  1YAL A;  4BOP A;  3P5V A;  5FPW A;  2DC9 A;  5EZQ A;  5J94 A;  2H7J A;  4MZO A;  1GCB A;  2PNS A;  3PRM A;  5EF4 A;  1QOL A;  2PRE A;  1DKI A;  4CDD B;  1MHW A;  1U9Q X;  3W30 A;  2E03 A;  1F2A A;  2Y6E A;  4CDC B;  1CVZ A;  4PI3 A;  3V6E A;  3I3T A;  4X6H A;  1AIM A;  4AXL A;  4BQV A;  1ATK A;  1F2C A;  3PT2 A;  2AGA A;  2YJB A;  2HHN A;  3PRP A;  4YYQ A;  3B21 A;  3PDF A;  2BTW A;  3S3R A;  2CB5 A;  1AU2 A;  3CH2 X;  3BPM A;  1EWM A;  1U9X A;  2DC7 A;  2NQD B;  3P5X A;  2PAD A;  3V6C A;  4DMX A;  4PAD A;  2O6X A;  2DC8 A;  2AS8 A;  1YK7 A;  2DOS A;  2HWK A;  4RY2 A;  3PHX A;  4Q8G A;  3TNX A;  3LXS A;  5CHT A;  1GLO A;  4MI7 A;  1Y08 A;  4OVZ B;  3C0R A;  4P6E A;  3WXF A;  2E00 A;  3MJ5 A;  1AYV A;  4BS5 A;  3OVX A;  1PE6 A;  3F75 A;  4HXD B;  3MOR A;  2XU4 A;  4MZS A;  2Z84 A;  1U5I A;  1ME3 A;  3WXG A;  4IUM A;  2JQF R;  4REZ A;  4D8E A;  3ZUA A;  1AYW A;  1POP A;  1IWD A;  3HD3 A;  2FQ9 A;  1AYU A;  1PIP A;  2DCA A;  3KSE A;  3F5V A;  3MHH A;  2R9F A;  4ZTB A;  2R9C A;  4XR7 A;  1ITO A;  3U8E A;  4BOZ A;  3C9E A;  2FRA A;  2R9M A;  4OW0 A;  2R6N A;  3HHI A;  2PBH A;  3BC3 A;  5KO3 A;  1CTE A;  1PPO A;  2XU5 A;  1QMY A;  2VHF A;  2FE8 A;  4D8B A;  3DF0 A;  4BS6 A;  5PAD A;  3MTV A;  3BB7 A;  1KXR A;  3O1G A;  4QRV A;  3QSD A;  4W5B A;  9PAP A;  5K16 A;  2FYE A;  1BY8 A;  2BDZ A;  4G54 A;  1CJL A;  3CBJ A;  4BSQ A;  3H8B A;  3D6S A;  1STF E;  3CH3 X;  2GHU A;  3OIS A;  1DF0 A;  4K7C A;  1K3B B;  4QBB A;  1KHP A;  3M99 A;  1PBH A;  3RVV A;  5JH3 A;  2G8E A;  4OEL A;  1NB3 A;  3KFQ A;  4WUR A;  4BPV A;  3BCN A;  2JTC A;  4N4Z A;  3N3G A;  4N79 A;  4PP1 A;  3RVW A;  1CQD A;  2P0R A;  1AU4 A;  3IOQ A;  4RF1 A;  4FIP A;  3WXE A;  4CDE B;  2DC6 A;  4YVA A;  2OP3 A;  3E1Z B;  3MHS A;  1GEC E;  1S4V A;  2IBI A;  4YYR A;  1PVJ A;  2VHS A;  3O65 A;  4AXM A;  2XU1 A;  4P16 A;  2ARY A;  1YK8 A;  2JRI A;  1F29 A;  2NQG A;  3USV A;  4XZX A;  3CBK A;  3PNR A;  2AUZ A;  5E6J A;  4A5U A;  1AEC A;  3MTN A;  1YT7 A;  1CS8 A;  3LFY A;  1THE A;  8PCH A;  3B79 A;  4R3D A;  5CVN B;  2FO5 A;  2BTW B;  4CZW A;  4I05 A;  1PAD A;  1U9V A;  3KX1 A;  3N4C A;  2AVW A;  1YZB A;  3TMP A;  1NL6 A;  1F2B A;  4IP3 A;  3K24 A;  3K8U A;  5JA7 A;  3PHU A;  2J7Q C;  3OQC A;  2FUD A;  2BU3 A;  4RNA A;  4OVZ A;  1QXP A;  2AUX A;  3H6S A;  4X6I A;  1X9Y A;  2Y5B A;  2C0Y A;  1PPP A;  2ACT A;  1ZIV A;  3RVX A;  1EF7 A;  4PP2 E;  2AYO A;  3KWB X;  1CPJ A;  3ZNH A;  3N3K A;  3OF8 A;  2WBF X;  3BY4 A;  1MEG A;  3MP2 A;  1ICF A;  2FTD A;  3PW3 A;  2AYN A;  1ME4 A;  2DZZ A;  3P5W A;  4MM3 B;  7PCK A;  3BOW A;  1A6R A;  4FK5 A;  4FJC A;  3O0U A;  4X6J A;  3RNV A;  1EWL A;  1HUC B;  4WA6 A;  2F7D A;  4W5C A;  3HWN A;  3KWZ A;  4CDF B;  3H8C A;  3BWK A;  2G8J A;  3AI8 A;  3HHA A;  3BBA A;  2YJ2 A;  6PAD A;  3E9S A;  3QJ3 A;  2F1G A;  3IHP A;  2R9O A;  4YV8 A;  2G6D A;  3IV2 A;  1PXV A;  1DEU A;  2OZ2 A;  3BPF A;  3W31 A;  3IMA A;  3GCB A;  1EWO A;  4M0W A;  2YJ8 A;  3H89 A;  1FH0 A;  1QDQ A;  4YYU A;  4QRG A;  4RKX A;  1YVB A;  2YJ9 A;  2DCD A;  5JZE A;  1EWP A;  1CV8 A;  3PHW A;  1KFX L;  1NLJ A;  2B1N A;  4KLB A;  4QH6 A;  1GMY A;  4QRX A;  2FRQ A;  2P86 A;  1CSB B;  2AIM A;  3PBH A;  2UZJ A;  1UKF A;  3P5U A;  2HXZ A;  2ATO A;  4HWY A;  2OUL A;  2BDL A;  1PPN A;  4N8W A;  5CHV A;  2DZY A;  3OVZ A;  2XU3 A;  2NQA A;  4MSX A;  4XUI A;  1NPZ A;  3IFU A;  3QT4 A;  1TU6 A;  2YJC A;  5CVM A;  3K9M A;  1Y4H A;  2AU1 A;  3KW9 A;  2HD5 A;  3H7D A;  4YYW A;  1VSN A;  2DCC A;  3PSE A;  4I04 A;  1KHQ A;  1SNK A;  4P6G A;  1NQC A;  3TRK A;  4ZUX U;  2E02 A;  1JQP A;  5CVO B;  5F02 A;  3KKU A;  4BOS A;  3ERV A;  1BQI A;  2DJF B;  1MIR A;  4RF0 A;  4GUA A;  4DMY A;  4W4U A;  1XKG A;  3OF9 A;  1MS6 A;  1O0E A;  2JQG R;  1CB5 A;  1TL9 A;  1TLO A;  2GFO A;  5EGW A;  4D8I A;  5EZS A;  3I06 A;  4BOQ A;  2J7Q A;  5A24 A;  1NB5 A;  3IEJ A;  2DCB A;  2NQI A;  2P7U A;  3IUT A;  2FT2 A;  3NHE A;  1AU0 A;  2DJG B;  2E01 A;  2HH5 A;  1AU3 A;  2G7Y A; 
#chains in the Genus database with same CATH homology
 1PCI A;  4OEM A;  1PPD A;  1KFU L;  1Q6K A;  2B1M A;  1U9W A;  1BGO A;  1SP4 B;  1M6D A;  4YYV A;  1VJV A;  3S3Q A;  4YYS A;  1BP4 A;  4I07 A;  1MEM A;  1ZCM A;  2IPP B;  1MDW A;  4Q8H A;  2CIO A;  2R9N A;  1YAL A;  1W5R A;  3P5V A;  5FPW A;  2DC9 A;  5J94 A;  2H7J A;  4MZO A;  1GCB A;  2PNS A;  5EF4 A;  1QOL A;  2PRE A;  4CDD B;  1MHW A;  1U9Q X;  2E03 A;  1F2A A;  2Y6E A;  4CDC B;  1CVZ A;  2BSZ A;  4PI3 A;  3V6E A;  3I3T A;  4X6H A;  1AIM A;  4NV7 A;  4AXL A;  4BQV A;  1ATK A;  1F2C A;  2YJB A;  2HHN A;  4YYQ A;  3PDF A;  3S3R A;  2CB5 A;  1AU2 A;  3CH2 X;  3BPM A;  1EWM A;  1U9X A;  2DC7 A;  2NQD B;  3P5X A;  2PAD A;  3V6C A;  4DMX A;  4PAD A;  2O6X A;  2DC8 A;  2AS8 A;  1YK7 A;  4RY2 A;  4Q8G A;  3TNX A;  3LXS A;  5CHT A;  1GLO A;  1Y08 A;  4P6E A;  3WXF A;  2E00 A;  1AYV A;  4BS5 A;  3OVX A;  1PE6 A;  3F75 A;  3MOR A;  2XU4 A;  4MZS A;  1U5I A;  1ME3 A;  3WXG A;  2JQF R;  3ZUA A;  1AYW A;  1POP A;  1IWD A;  3HD3 A;  2FQ9 A;  1AYU A;  1PIP A;  2DCA A;  3KSE A;  3F5V A;  3MHH A;  2R9F A;  2R9C A;  4XR7 A;  1ITO A;  3U8E A;  3C9E A;  2FRA A;  2R9M A;  2R6N A;  3HHI A;  2PBH A;  3BC3 A;  1CTE A;  1PPO A;  2XU5 A;  1QMY A;  2VHF A;  3DF0 A;  4BS6 A;  5PAD A;  1KXR A;  1GX3 A;  3O1G A;  4QRV A;  3QSD A;  4W5B A;  9PAP A;  5K16 A;  2FYE A;  1BY8 A;  2BDZ A;  4G54 A;  1CJL A;  3CBJ A;  4BSQ A;  3H8B A;  3D6S A;  1STF E;  3CH3 X;  2GHU A;  3OIS A;  1DF0 A;  4K7C A;  1K3B B;  4QBB A;  1KHP A;  3M99 A;  1PBH A;  3RVV A;  5JH3 A;  2G8E A;  4OEL A;  1NB3 A;  4NV8 A;  3KFQ A;  4BPV A;  3BCN A;  4N4Z A;  3N3G A;  4N79 A;  4PP1 A;  3RVW A;  1CQD A;  2P0R A;  1AU4 A;  3IOQ A;  4B55 A;  4FIP A;  3WXE A;  4CDE B;  2DC6 A;  4YVA A;  2OP3 A;  3E1Z B;  3MHS A;  1GEC E;  1S4V A;  2IBI A;  4YYR A;  2VHS A;  4C5P A;  4AXM A;  2XU1 A;  2ARY A;  1YK8 A;  1F29 A;  2NQG A;  3USV A;  3CBK A;  3PNR A;  2AUZ A;  4BGF A;  1AEC A;  3MTN A;  1YT7 A;  1CS8 A;  3LFY A;  1THE A;  8PCH A;  3B79 A;  5CVN B;  2FO5 A;  4CZW A;  4I05 A;  4GUZ A;  1PAD A;  1U9V A;  3KX1 A;  3N4C A;  2AVW A;  1NL6 A;  1F2B A;  3K24 A;  3K8U A;  5JA7 A;  2FUD A;  1QXP A;  2AUX A;  3H6S A;  4X6I A;  1X9Y A;  2Y5B A;  2C0Y A;  1E2T A;  1PPP A;  2ACT A;  1ZIV A;  3RVX A;  1EF7 A;  4PP2 E;  2AYO A;  3KWB X;  1CPJ A;  2VFC A;  3N3K A;  3OF8 A;  2WBF X;  1MEG A;  1ICF A;  2FTD A;  3PW3 A;  2AYN A;  1ME4 A;  2DZZ A;  3P5W A;  7PCK A;  3BOW A;  1A6R A;  4FK5 A;  4FJC A;  3O0U A;  4X6J A;  3D9W A;  1EWL A;  1HUC B;  4WA6 A;  2F7D A;  4W5C A;  3HWN A;  3KWZ A;  4CDF B;  3H8C A;  3BWK A;  2VFB A;  2G8J A;  3AI8 A;  3HHA A;  2YJ2 A;  6PAD A;  3QJ3 A;  2F1G A;  3IHP A;  2R9O A;  4YV8 A;  2G6D A;  3IV2 A;  1PXV A;  1DEU A;  2OZ2 A;  3BPF A;  3IMA A;  3GCB A;  1EWO A;  2YJ8 A;  3H89 A;  1FH0 A;  1QDQ A;  4YYU A;  4QRG A;  1YVB A;  2YJ9 A;  2DCD A;  1EWP A;  1CV8 A;  1KFX L;  1NLJ A;  2B1N A;  4KLB A;  4QH6 A;  1GMY A;  4QRX A;  2FRQ A;  2P86 A;  1CSB B;  2AIM A;  3PBH A;  3P5U A;  2HXZ A;  2ATO A;  4HWY A;  2OUL A;  2BDL A;  1PPN A;  4N8W A;  5CHV A;  2DZY A;  3OVZ A;  2XU3 A;  2NQA A;  4MSX A;  4XUI A;  1NPZ A;  3QT4 A;  1TU6 A;  2YJC A;  5CVM A;  3K9M A;  1Y4H A;  2AU1 A;  3KW9 A;  2HD5 A;  3H7D A;  4YYW A;  1VSN A;  2DCC A;  4I04 A;  1KHQ A;  1SNK A;  3LTW A;  4P6G A;  1NQC A;  4ZUX U;  2E02 A;  1W6F A;  1JQP A;  5CVO B;  5F02 A;  3KKU A;  3ERV A;  1BQI A;  2DJF B;  1MIR A;  4DMY A;  4W4U A;  1XKG A;  3OF9 A;  1MS6 A;  1O0E A;  2JQG R;  1CB5 A;  1TL9 A;  1TLO A;  2GFO A;  5EGW A;  3I06 A;  5A24 A;  1NB5 A;  3IEJ A;  2DCB A;  2NQI A;  2P7U A;  3IUT A;  2FT2 A;  3NHE A;  1AU0 A;  1W4T A;  2DJG B;  2E01 A;  2HH5 A;  1AU3 A;  2G7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...