1SP4B

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
RVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCNKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
total genus 49
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1sp4B00
2C0YA 4YVAA 3PBHA 2PBHA 4XR7A 1CJLA 2HD5A 1JQPA 4I04A 5CHTA 3S3RA 2FUDA 3HD3A 2BDLA 1QMYA 1PPPA 2OP3A 3IUTA 3K9MA 2VHFA 4YYVA 4HWYA 1THEA 1BP4A 2XU4A 3RVXA 2E03A 1PPOA 1BQIA 3BCNA 9PAPA 3N3KA 4BPVA 4I05A 3ERVA 1KFUL 1AYWA 1NL6A 2FT2A 2WBFX 1KXRA 3CH3X 1XKGA 4P6GA 3DF0A 2R9OA 2GFOA 4MSXA 3HHAA 3IV2A 2JQGR 2P7UA 4CDEB 4QRGA 1VJVA 1ZIVA 5A24A 4X6HA 1CB5A 1GMYA 3TNXA 4CDFB 4I07A 3WXEA 1NB3A 2R9CA 1U9XA 3O0UA 3PW3A 1CSBB 5PADA 2ACTA 3V6EA 1NLJA 2R6NA 2DC6A 1EWPA 3CBKA 4FIPA 1YK7A 4RY2A 1NQCA 3USVA 3I3TA 3E1ZB 3OF8A 1EWLA 5F02A 3MTNA 4N4ZA 2BDZA 2R9MA 1YALA 2R9NA 4QH6A 3RVVA 4FJCA 4BS5A 3BPMA 3HWNA 4MZSA 2PADA 5CVNB 3KFQA 1PBHA 5J94A 2FYEA 3PNRA 3H7DA 1MHWA 3F5VA 1VSNA 2AVWA 3IEJA 1O0EA 1S4VA 1POPA 3QT4A 4K7CA 1PADA 1QOLA 1IWDA 4MZOA 3KWZA 2GHUA 2F1GA 1TLOA 2FQ9A 2HH5A 3ZUAA 1K3BB 4CDDB 1U9WA 2Y5BA 4W5CA 2NQIA 5JH3A 3BWKA 2DJFB 1PPDA 1GCBA 1BY8A 2P86A 2E00A 2VHSA 3KX1A 7PCKA 1AYVA 1KHQA 4W4UA 2DC7A 3OVXA 2NQAA 4YYUA 5CVMA 1Y4HA 1CPJA 2PNSA 3OVZA 4CZWA 1Q6KA 1MEGA 1SP4B 2FRQA 5EGWA 4YYQA 4YYRA 4OELA 2HXZA 2O6XA 3MHHA 2FTDA 3U8EA 3WXGA 2ATOA 3GCBA 3KKUA 4W5BA 2AYNA 1ITOA 4Q8HA 2FRAA 3H8CA 2AS8A 2AU1A 2DCBA 2G6DA 2DCCA 2E02A 1ICFA 1CTEA 1PCIA 2DJGB 1AIMA 1DEUA 1EF7A 1PIPA 4N8WA 3IHPA 2JQFR 3BPFA 3IOQA 2XU1A 1FH0A 1QXPA 1ATKA 1NB5A 4AXMA 2DZZA 2F7DA 2IBIA 5CHVA 2R9FA 3I06A 3MORA 3BOWA 4YV8A 4N79A 1PXVA 2B1NA 1CVZA 4QBBA 4PI3A 3MHSA 1MEMA 2NQDB 1F29A 5EF4A 2YJ2A 3S3QA 4PADA 1BGOA 1ME3A 2YJBA 2XU5A 1ME4A 1QDQA 1YK8A 4ZUXU 3K8UA 4YYSA 1AYUA 1F2BA 1AU4A 4P6EA 2YJ9A 2PREA 5K16A 1TU6A 3P5VA 1CS8A 1U9VA 2DC9A 1EWMA 3CH2X 1STFE 1YT7A 3PDFA 3QJ3A 3N3GA 2HHNA 1MS6A 2E01A 3P5WA 2H7JA 3KW9A 1A6RA 4BSQA 2NQGA 4QRVA 2G8EA 2Y6EA 2B1MA 3F75A 6PADA 3HHIA 2YJ8A 4BQVA 3AI8A 3C9EA 4PP1A 4QRXA 1U9QX 3LFYA 3WXFA 1MDWA 1GECE 2AUZA 3OISA 3D6SA 4WA6A 1Y08A 3RVWA 2G7YA 1SNKA 5FPWA 4PP2E 3KSEA 2AYOA 1AU3A 1MIRA 3N4CA 3O1GA 1TL9A 2P0RA 1DF0A 4XUIA 1U5IA 1KFXL 4OEMA 4AXLA 1F2CA 3BC3A 4DMYA 1M6DA 4KLBA 2OZ2A 5JA7A 2DZYA 1PE6A 1CQDA 2DC8A 4X6JA 1AU0A 4Q8GA 1EWOA 3IMAA 2FO5A 4CDCB 4FK5A 3H6SA 3V6CA 3OF9A 2YJCA 1YVBA 3P5UA 2IPPB 2DCDA 2ARYA 1F2AA 2OULA 2AUXA 2XU3A 2CB5A 3LXSA 4DMXA 4X6IA 8PCHA 3K24A 3KWBX 1AECA 4G54A 3B79A 2AIMA 3P5XA 1AU2A 3M99A 3NHEA 2CIOA 2DCAA 3H89A 1CV8A 2G8JA 1ZCMA 1NPZA 1KHPA 1X9YA 1PPNA 3QSDA 4BS6A 3CBJA 1HUCB 5CVOB 1GLOA 4YYWA 3H8BA
chains in the Genus database with same CATH superfamily
2C0YA 4WURA 3E9SA 4YVAA 3PBHA 2PBHA 4XR7A 1CJLA 2HD5A 4HXDB 1JQPA 2AGAA 4D8IA 4I04A 5CHTA 3S3RA 4GUAA 2FUDA 3HD3A 2BDLA 1QMYA 1PPPA 2OP3A 3IUTA 3K9MA 2VHFA 4YYVA 4HWYA 1THEA 1BP4A 2XU4A 2BU3A 1DKIA 3RVXA 2E03A 4OVZA 4RKXA 1PPOA 1BQIA 3BCNA 9PAPA 3N3KA 4BPVA 4I05A 3ERVA 1KFUL 1AYWA 1NL6A 2WBFX 2FT2A 1KXRA 3CH3X 1XKGA 4P6GA 4BOSA 5EZSA 3DF0A 2R9OA 2GFOA 4MSXA 3HHAA 3IV2A 2JQGR 2P7UA 4CDEB 4QRGA 1VJVA 1ZIVA 5A24A 4X6HA 3PHXA 1CB5A 1GMYA 3TNXA 4CDFB 4I07A 3WXEA 1NB3A 2BTWA 2R9CA 1U9XA 3O0UA 3PW3A 1CSBB 5PADA 2ACTA 3V6EA 1NLJA 2R6NA 2DC6A 3W31A 1EWPA 3CBKA 4FIPA 1YK7A 4RY2A 1NQCA 3USVA 3I3TA 3E1ZB 3OF8A 1EWLA 5F02A 3PSEA 3MTNA 4N4ZA 2BDZA 2R9MA 1YALA 2R9NA 4QH6A 3RVVA 4P16A 4FJCA 4BS5A 3C0RA 3BPMA 3HWNA 4MZSA 2PADA 5CVNB 3KFQA 1PBHA 5J94A 2FYEA 1UKFA 3BBAA 3PNRA 3H7DA 1MHWA 3F5VA 1VSNA 4OW0A 2BTWB 2AVWA 3IEJA 1O0EA 3PHWA 1S4VA 1POPA 3QT4A 4K7CA 4BOZA 1PADA 1QOLA 1IWDA 2DOSA 4MZOA 3KWZA 4D8EA 2GHUA 2F1GA 1TLOA 2FQ9A 2HH5A 5JZEA 3ZUAA 1K3BB 4CDDB 1U9WA 1PVJA 2Y5BA 5E6JA 4W5CA 2NQIA 5JH3A 3BWKA 4REZA 3PRPA 2DJFB 1PPDA 1GCBA 1BY8A 2P86A 2E00A 2VHSA 3KX1A 7PCKA 1AYVA 1KHQA 4W4UA 2DC7A 3OVXA 2NQAA 4IP3A 4A5UA 4YYUA 5CVMA 1Y4HA 1CPJA 2PNSA 3OVZA 4CZWA 1Q6KA 1MEGA 1SP4B 2FRQA 5EGWA 4YYQA 4YYRA 4OELA 3OQCA 2HXZA 2O6XA 3MHHA 3O65A 2FTDA 4D8BA 3U8EA 4XZXA 3WXGA 5KO3A 2ATOA 3GCBA 3KKUA 4W5BA 2AYNA 1ITOA 4Q8HA 2FRAA 3H8CA 2AS8A 2AU1A 2DCBA 2G6DA 2DCCA 2E02A 1ICFA 1CTEA 1PCIA 2DJGB 1AIMA 1DEUA 1EF7A 1PIPA 4N8WA 3IHPA 2JQFR 3BPFA 5EZQA 3IOQA 2Z84A 2XU1A 4RNAA 1FH0A 4OVZB 1QXPA 3PHUA 1ATKA 1NB5A 4AXMA 2DZZA 2F7DA 2IBIA 5CHVA 2R9FA 3I06A 3MORA 3BOWA 4MI7A 4YV8A 4N79A 1PXVA 2B1NA 4BOPA 1CVZA 4QBBA 4PI3A 3MHSA 1MEMA 2NQDB 1F29A 5EF4A 2YJ2A 4BOUA 3S3QA 4PADA 2J7QC 3B21A 1BGOA 1ME3A 2YJBA 2XU5A 1ME4A 1QDQA 1YK8A 4ZUXU 4MM3B 3K8UA 4YYSA 1AYUA 1F2BA 1AU4A 4P6EA 2YJ9A 4ZTBA 2PREA 5K16A 1TU6A 3P5VA 3RNVA 3IFUA 4PT5A 2HWKA 1CS8A 4RF0A 1U9VA 2DC9A 1EWMA 3CH2X 1STFE 1YT7A 2JRIA 4IUMA 4M0WA 3PDFA 3QJ3A 3N3GA 2HHNA 1MS6A 2E01A 3P5WA 4R3DA 2H7JA 3KW9A 1A6RA 4BSQA 2NQGA 4QRVA 2G8EA 2Y6EA 2B1MA 3F75A 6PADA 3HHIA 2YJ8A 4BQVA 3AI8A 3BB7A 3C9EA 3TRKA 4PP1A 4QRXA 1U9QX 3LFYA 3WXFA 3PT2A 1MDWA 1GECE 2AUZA 3OISA 3D6SA 2J7QA 4WA6A 1Y08A 3RVWA 2G7YA 3PRMA 1SNKA 5FPWA 4PP2E 3KSEA 2FE8A 3W30A 3MTVA 2AYOA 1AU3A 1MIRA 3N4CA 3TMPA 3MJ5A 3O1GA 1TL9A 2P0RA 1DF0A 3ZNHA 4XUIA 1U5IA 1YZBA 1KFXL 4OEMA 4AXLA 1F2CA 3BC3A 4DMYA 1M6DA 4KLBA 2OZ2A 5JA7A 2DZYA 1PE6A 1CQDA 2DC8A 4X6JA 1AU0A 4Q8GA 1EWOA 3IMAA 2FO5A 4CDCB 3MP2A 4FK5A 3H6SA 3V6CA 3OF9A 2YJCA 1YVBA 3P5UA 2IPPB 2JTCA 2DCDA 4BOQA 2ARYA 1F2AA 2OULA 2AUXA 2XU3A 2CB5A 3LXSA 4DMXA 4X6IA 3BY4A 8PCHA 3K24A 3KWBX 1AECA 4G54A 3B79A 2AIMA 3P5XA 1AU2A 3M99A 3NHEA 2CIOA 2DCAA 3H89A 1CV8A 2G8JA 1ZCMA 1NPZA 1KHPA 1X9YA 1PPNA 3QSDA 4BS6A 3CBJA 2UZJA 4RF1A 1HUCB 5CVOB 1GLOA 4YYWA 3H8BA
chains in the Genus database with same CATH topology
2C0YA 4YVAA 3PBHA 2PBHA 4XR7A 1CJLA 2HD5A 1JQPA 4I04A 5CHTA 3S3RA 2FUDA 3HD3A 2BDLA 1QMYA 1PPPA 2OP3A 3IUTA 3K9MA 2VHFA 4YYVA 4HWYA 1THEA 1BP4A 2XU4A 2BSZA 3RVXA 2E03A 1PPOA 1BQIA 3BCNA 9PAPA 3N3KA 4BPVA 4I05A 3ERVA 1KFUL 1AYWA 1NL6A 2FT2A 2WBFX 1KXRA 3CH3X 1XKGA 4P6GA 1W6FA 3DF0A 2R9OA 2GFOA 4MSXA 3HHAA 3IV2A 2JQGR 2P7UA 4CDEB 4QRGA 1VJVA 1ZIVA 5A24A 4X6HA 1CB5A 1GMYA 3TNXA 4CDFB 4I07A 3WXEA 1NB3A 2R9CA 1U9XA 3O0UA 3PW3A 1CSBB 5PADA 2ACTA 3V6EA 1NLJA 2R6NA 2DC6A 1EWPA 3CBKA 4FIPA 1YK7A 4RY2A 1NQCA 3USVA 3I3TA 3E1ZB 3OF8A 1EWLA 5F02A 3MTNA 2VFCA 4N4ZA 2BDZA 2R9MA 1YALA 2R9NA 4QH6A 4BGFA 3RVVA 4FJCA 4BS5A 3BPMA 3HWNA 4MZSA 1W4TA 2PADA 5CVNB 3KFQA 1PBHA 5J94A 2FYEA 4C5PA 3PNRA 3H7DA 4NV7A 1MHWA 3F5VA 1VSNA 2AVWA 3IEJA 1O0EA 1S4VA 1POPA 3QT4A 4K7CA 1PADA 1QOLA 1IWDA 4MZOA 3KWZA 2GHUA 2F1GA 1TLOA 2FQ9A 2HH5A 3ZUAA 1K3BB 4CDDB 1U9WA 2Y5BA 3D9WA 4W5CA 2NQIA 4NV8A 5JH3A 3BWKA 2DJFB 1PPDA 1GCBA 1BY8A 2P86A 2E00A 2VHSA 3KX1A 7PCKA 1AYVA 1KHQA 4W4UA 2DC7A 3OVXA 2NQAA 4YYUA 5CVMA 1Y4HA 1CPJA 2PNSA 3OVZA 4CZWA 1Q6KA 1MEGA 1SP4B 2FRQA 5EGWA 4YYQA 4YYRA 4OELA 2HXZA 2O6XA 3MHHA 2FTDA 3U8EA 3WXGA 2ATOA 3GCBA 3KKUA 4W5BA 2AYNA 1ITOA 4Q8HA 2FRAA 3H8CA 2AS8A 2AU1A 2DCBA 2G6DA 2DCCA 2E02A 1ICFA 1CTEA 1PCIA 2DJGB 1AIMA 1DEUA 1EF7A 1PIPA 4N8WA 3IHPA 2JQFR 3BPFA 3IOQA 2XU1A 1FH0A 1QXPA 1ATKA 1NB5A 4AXMA 2DZZA 2F7DA 2IBIA 5CHVA 2R9FA 3I06A 3MORA 3BOWA 4YV8A 4N79A 1PXVA 2B1NA 1CVZA 4QBBA 4PI3A 3MHSA 1MEMA 2NQDB 1F29A 5EF4A 2YJ2A 3S3QA 4PADA 1BGOA 1ME3A 2YJBA 2XU5A 1ME4A 1QDQA 1YK8A 4ZUXU 3K8UA 3LTWA 4YYSA 1AYUA 1F2BA 1AU4A 4P6EA 2YJ9A 2PREA 5K16A 1TU6A 3P5VA 1CS8A 1U9VA 2DC9A 1EWMA 3CH2X 1STFE 1YT7A 3PDFA 3QJ3A 3N3GA 2HHNA 1MS6A 2E01A 3P5WA 2H7JA 3KW9A 1A6RA 4BSQA 2NQGA 4QRVA 2G8EA 2Y6EA 2B1MA 3F75A 6PADA 3HHIA 2YJ8A 4BQVA 3AI8A 3C9EA 4PP1A 4QRXA 1U9QX 3LFYA 3WXFA 1MDWA 1GECE 2AUZA 3OISA 3D6SA 4WA6A 1Y08A 3RVWA 2G7YA 1SNKA 5FPWA 4PP2E 3KSEA 2AYOA 1AU3A 1E2TA 1GX3A 1MIRA 3N4CA 3O1GA 1TL9A 2P0RA 1DF0A 4XUIA 1U5IA 1KFXL 4OEMA 1W5RA 4AXLA 1F2CA 3BC3A 4DMYA 1M6DA 4KLBA 2OZ2A 5JA7A 2DZYA 1PE6A 1CQDA 2DC8A 4X6JA 1AU0A 4Q8GA 1EWOA 3IMAA 2FO5A 4CDCB 4FK5A 3H6SA 3V6CA 3OF9A 2YJCA 1YVBA 3P5UA 2IPPB 2DCDA 2ARYA 1F2AA 2OULA 2AUXA 2XU3A 2CB5A 3LXSA 4DMXA 4X6IA 8PCHA 3K24A 3KWBX 1AECA 4G54A 3B79A 2AIMA 4GUZA 3P5XA 1AU2A 3M99A 3NHEA 2CIOA 2DCAA 3H89A 1CV8A 2G8JA 1ZCMA 1NPZA 4B55A 2VFBA 1KHPA 1X9YA 1PPNA 3QSDA 4BS6A 3CBJA 1HUCB 5CVOB 1GLOA 4YYWA 3H8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0Y A;  4YVA A;  3PBH A;  2PBH A;  4XR7 A;  1CJL A;  2HD5 A;  1JQP A;  4I04 A;  5CHT A;  3S3R A;  2FUD A;  3HD3 A;  2BDL A;  1QMY A;  1PPP A;  2OP3 A;  3IUT A;  3K9M A;  2VHF A;  4YYV A;  4HWY A;  1THE A;  1BP4 A;  2XU4 A;  3RVX A;  2E03 A;  1PPO A;  1BQI A;  3BCN A;  9PAP A;  3N3K A;  4BPV A;  4I05 A;  3ERV A;  1KFU L;  1AYW A;  1NL6 A;  2FT2 A;  2WBF X;  1KXR A;  3CH3 X;  1XKG A;  4P6G A;  3DF0 A;  2R9O A;  2GFO A;  4MSX A;  3HHA A;  3IV2 A;  2JQG R;  2P7U A;  4CDE B;  4QRG A;  1VJV A;  1ZIV A;  5A24 A;  4X6H A;  1CB5 A;  1GMY A;  3TNX A;  4CDF B;  4I07 A;  3WXE A;  1NB3 A;  2R9C A;  1U9X A;  3O0U A;  3PW3 A;  1CSB B;  5PAD A;  2ACT A;  3V6E A;  1NLJ A;  2R6N A;  2DC6 A;  1EWP A;  3CBK A;  4FIP A;  1YK7 A;  4RY2 A;  1NQC A;  3USV A;  3I3T A;  3E1Z B;  3OF8 A;  1EWL A;  5F02 A;  3MTN A;  4N4Z A;  2BDZ A;  2R9M A;  1YAL A;  2R9N A;  4QH6 A;  3RVV A;  4FJC A;  4BS5 A;  3BPM A;  3HWN A;  4MZS A;  2PAD A;  5CVN B;  3KFQ A;  1PBH A;  5J94 A;  2FYE A;  3PNR A;  3H7D A;  1MHW A;  3F5V A;  1VSN A;  2AVW A;  3IEJ A;  1O0E A;  1S4V A;  1POP A;  3QT4 A;  4K7C A;  1PAD A;  1QOL A;  1IWD A;  4MZO A;  3KWZ A;  2GHU A;  2F1G A;  1TLO A;  2FQ9 A;  2HH5 A;  3ZUA A;  1K3B B;  4CDD B;  1U9W A;  2Y5B A;  4W5C A;  2NQI A;  5JH3 A;  3BWK A;  2DJF B;  1PPD A;  1GCB A;  1BY8 A;  2P86 A;  2E00 A;  2VHS A;  3KX1 A;  7PCK A;  1AYV A;  1KHQ A;  4W4U A;  2DC7 A;  3OVX A;  2NQA A;  4YYU A;  5CVM A;  1Y4H A;  1CPJ A;  2PNS A;  3OVZ A;  4CZW A;  1Q6K A;  1MEG A;  1SP4 B;  2FRQ A;  5EGW A;  4YYQ A;  4YYR A;  4OEL A;  2HXZ A;  2O6X A;  3MHH A;  2FTD A;  3U8E A;  3WXG A;  2ATO A;  3GCB A;  3KKU A;  4W5B A;  2AYN A;  1ITO A;  4Q8H A;  2FRA A;  3H8C A;  2AS8 A;  2AU1 A;  2DCB A;  2G6D A;  2DCC A;  2E02 A;  1ICF A;  1CTE A;  1PCI A;  2DJG B;  1AIM A;  1DEU A;  1EF7 A;  1PIP A;  4N8W A;  3IHP A;  2JQF R;  3BPF A;  3IOQ A;  2XU1 A;  1FH0 A;  1QXP A;  1ATK A;  1NB5 A;  4AXM A;  2DZZ A;  2F7D A;  2IBI A;  5CHV A;  2R9F A;  3I06 A;  3MOR A;  3BOW A;  4YV8 A;  4N79 A;  1PXV A;  2B1N A;  1CVZ A;  4QBB A;  4PI3 A;  3MHS A;  1MEM A;  2NQD B;  1F29 A;  5EF4 A;  2YJ2 A;  3S3Q A;  4PAD A;  1BGO A;  1ME3 A;  2YJB A;  2XU5 A;  1ME4 A;  1QDQ A;  1YK8 A;  4ZUX U;  3K8U A;  4YYS A;  1AYU A;  1F2B A;  1AU4 A;  4P6E A;  2YJ9 A;  2PRE A;  5K16 A;  1TU6 A;  3P5V A;  1CS8 A;  1U9V A;  2DC9 A;  1EWM A;  3CH2 X;  1STF E;  1YT7 A;  3PDF A;  3QJ3 A;  3N3G A;  2HHN A;  1MS6 A;  2E01 A;  3P5W A;  2H7J A;  3KW9 A;  1A6R A;  4BSQ A;  2NQG A;  4QRV A;  2G8E A;  2Y6E A;  2B1M A;  3F75 A;  6PAD A;  3HHI A;  2YJ8 A;  4BQV A;  3AI8 A;  3C9E A;  4PP1 A;  4QRX A;  1U9Q X;  3LFY A;  3WXF A;  1MDW A;  1GEC E;  2AUZ A;  3OIS A;  3D6S A;  4WA6 A;  1Y08 A;  3RVW A;  2G7Y A;  1SNK A;  5FPW A;  4PP2 E;  3KSE A;  2AYO A;  1AU3 A;  1MIR A;  3N4C A;  3O1G A;  1TL9 A;  2P0R A;  1DF0 A;  4XUI A;  1U5I A;  1KFX L;  4OEM A;  4AXL A;  1F2C A;  3BC3 A;  4DMY A;  1M6D A;  4KLB A;  2OZ2 A;  5JA7 A;  2DZY A;  1PE6 A;  1CQD A;  2DC8 A;  4X6J A;  1AU0 A;  4Q8G A;  1EWO A;  3IMA A;  2FO5 A;  4CDC B;  4FK5 A;  3H6S A;  3V6C A;  3OF9 A;  2YJC A;  1YVB A;  3P5U A;  2IPP B;  2DCD A;  2ARY A;  1F2A A;  2OUL A;  2AUX A;  2XU3 A;  2CB5 A;  3LXS A;  4DMX A;  4X6I A;  8PCH A;  3K24 A;  3KWB X;  1AEC A;  4G54 A;  3B79 A;  2AIM A;  3P5X A;  1AU2 A;  3M99 A;  3NHE A;  2CIO A;  2DCA A;  3H89 A;  1CV8 A;  2G8J A;  1ZCM A;  1NPZ A;  1KHP A;  1X9Y A;  1PPN A;  3QSD A;  4BS6 A;  3CBJ A;  1HUC B;  5CVO B;  1GLO A;  4YYW A;  3H8B A; 
#chains in the Genus database with same CATH topology
 2C0Y A;  4WUR A;  3E9S A;  4YVA A;  3PBH A;  2PBH A;  4XR7 A;  1CJL A;  2HD5 A;  4HXD B;  1JQP A;  2AGA A;  4D8I A;  4I04 A;  5CHT A;  3S3R A;  4GUA A;  2FUD A;  3HD3 A;  2BDL A;  1QMY A;  1PPP A;  2OP3 A;  3IUT A;  3K9M A;  2VHF A;  4YYV A;  4HWY A;  1THE A;  1BP4 A;  2XU4 A;  2BU3 A;  1DKI A;  3RVX A;  2E03 A;  4OVZ A;  4RKX A;  1PPO A;  1BQI A;  3BCN A;  9PAP A;  3N3K A;  4BPV A;  4I05 A;  3ERV A;  1KFU L;  1AYW A;  1NL6 A;  2WBF X;  2FT2 A;  1KXR A;  3CH3 X;  1XKG A;  4P6G A;  4BOS A;  5EZS A;  3DF0 A;  2R9O A;  2GFO A;  4MSX A;  3HHA A;  3IV2 A;  2JQG R;  2P7U A;  4CDE B;  4QRG A;  1VJV A;  1ZIV A;  5A24 A;  4X6H A;  3PHX A;  1CB5 A;  1GMY A;  3TNX A;  4CDF B;  4I07 A;  3WXE A;  1NB3 A;  2BTW A;  2R9C A;  1U9X A;  3O0U A;  3PW3 A;  1CSB B;  5PAD A;  2ACT A;  3V6E A;  1NLJ A;  2R6N A;  2DC6 A;  3W31 A;  1EWP A;  3CBK A;  4FIP A;  1YK7 A;  4RY2 A;  1NQC A;  3USV A;  3I3T A;  3E1Z B;  3OF8 A;  1EWL A;  5F02 A;  3PSE A;  3MTN A;  4N4Z A;  2BDZ A;  2R9M A;  1YAL A;  2R9N A;  4QH6 A;  3RVV A;  4P16 A;  4FJC A;  4BS5 A;  3C0R A;  3BPM A;  3HWN A;  4MZS A;  2PAD A;  5CVN B;  3KFQ A;  1PBH A;  5J94 A;  2FYE A;  1UKF A;  3BBA A;  3PNR A;  3H7D A;  1MHW A;  3F5V A;  1VSN A;  4OW0 A;  2BTW B;  2AVW A;  3IEJ A;  1O0E A;  3PHW A;  1S4V A;  1POP A;  3QT4 A;  4K7C A;  4BOZ A;  1PAD A;  1QOL A;  1IWD A;  2DOS A;  4MZO A;  3KWZ A;  4D8E A;  2GHU A;  2F1G A;  1TLO A;  2FQ9 A;  2HH5 A;  5JZE A;  3ZUA A;  1K3B B;  4CDD B;  1U9W A;  1PVJ A;  2Y5B A;  5E6J A;  4W5C A;  2NQI A;  5JH3 A;  3BWK A;  4REZ A;  3PRP A;  2DJF B;  1PPD A;  1GCB A;  1BY8 A;  2P86 A;  2E00 A;  2VHS A;  3KX1 A;  7PCK A;  1AYV A;  1KHQ A;  4W4U A;  2DC7 A;  3OVX A;  2NQA A;  4IP3 A;  4A5U A;  4YYU A;  5CVM A;  1Y4H A;  1CPJ A;  2PNS A;  3OVZ A;  4CZW A;  1Q6K A;  1MEG A;  1SP4 B;  2FRQ A;  5EGW A;  4YYQ A;  4YYR A;  4OEL A;  3OQC A;  2HXZ A;  2O6X A;  3MHH A;  3O65 A;  2FTD A;  4D8B A;  3U8E A;  4XZX A;  3WXG A;  5KO3 A;  2ATO A;  3GCB A;  3KKU A;  4W5B A;  2AYN A;  1ITO A;  4Q8H A;  2FRA A;  3H8C A;  2AS8 A;  2AU1 A;  2DCB A;  2G6D A;  2DCC A;  2E02 A;  1ICF A;  1CTE A;  1PCI A;  2DJG B;  1AIM A;  1DEU A;  1EF7 A;  1PIP A;  4N8W A;  3IHP A;  2JQF R;  3BPF A;  5EZQ A;  3IOQ A;  2Z84 A;  2XU1 A;  4RNA A;  1FH0 A;  4OVZ B;  1QXP A;  3PHU A;  1ATK A;  1NB5 A;  4AXM A;  2DZZ A;  2F7D A;  2IBI A;  5CHV A;  2R9F A;  3I06 A;  3MOR A;  3BOW A;  4MI7 A;  4YV8 A;  4N79 A;  1PXV A;  2B1N A;  4BOP A;  1CVZ A;  4QBB A;  4PI3 A;  3MHS A;  1MEM A;  2NQD B;  1F29 A;  5EF4 A;  2YJ2 A;  4BOU A;  3S3Q A;  4PAD A;  2J7Q C;  3B21 A;  1BGO A;  1ME3 A;  2YJB A;  2XU5 A;  1ME4 A;  1QDQ A;  1YK8 A;  4ZUX U;  4MM3 B;  3K8U A;  4YYS A;  1AYU A;  1F2B A;  1AU4 A;  4P6E A;  2YJ9 A;  4ZTB A;  2PRE A;  5K16 A;  1TU6 A;  3P5V A;  3RNV A;  3IFU A;  4PT5 A;  2HWK A;  1CS8 A;  4RF0 A;  1U9V A;  2DC9 A;  1EWM A;  3CH2 X;  1STF E;  1YT7 A;  2JRI A;  4IUM A;  4M0W A;  3PDF A;  3QJ3 A;  3N3G A;  2HHN A;  1MS6 A;  2E01 A;  3P5W A;  4R3D A;  2H7J A;  3KW9 A;  1A6R A;  4BSQ A;  2NQG A;  4QRV A;  2G8E A;  2Y6E A;  2B1M A;  3F75 A;  6PAD A;  3HHI A;  2YJ8 A;  4BQV A;  3AI8 A;  3BB7 A;  3C9E A;  3TRK A;  4PP1 A;  4QRX A;  1U9Q X;  3LFY A;  3WXF A;  3PT2 A;  1MDW A;  1GEC E;  2AUZ A;  3OIS A;  3D6S A;  2J7Q A;  4WA6 A;  1Y08 A;  3RVW A;  2G7Y A;  3PRM A;  1SNK A;  5FPW A;  4PP2 E;  3KSE A;  2FE8 A;  3W30 A;  3MTV A;  2AYO A;  1AU3 A;  1MIR A;  3N4C A;  3TMP A;  3MJ5 A;  3O1G A;  1TL9 A;  2P0R A;  1DF0 A;  3ZNH A;  4XUI A;  1U5I A;  1YZB A;  1KFX L;  4OEM A;  4AXL A;  1F2C A;  3BC3 A;  4DMY A;  1M6D A;  4KLB A;  2OZ2 A;  5JA7 A;  2DZY A;  1PE6 A;  1CQD A;  2DC8 A;  4X6J A;  1AU0 A;  4Q8G A;  1EWO A;  3IMA A;  2FO5 A;  4CDC B;  3MP2 A;  4FK5 A;  3H6S A;  3V6C A;  3OF9 A;  2YJC A;  1YVB A;  3P5U A;  2IPP B;  2JTC A;  2DCD A;  4BOQ A;  2ARY A;  1F2A A;  2OUL A;  2AUX A;  2XU3 A;  2CB5 A;  3LXS A;  4DMX A;  4X6I A;  3BY4 A;  8PCH A;  3K24 A;  3KWB X;  1AEC A;  4G54 A;  3B79 A;  2AIM A;  3P5X A;  1AU2 A;  3M99 A;  3NHE A;  2CIO A;  2DCA A;  3H89 A;  1CV8 A;  2G8J A;  1ZCM A;  1NPZ A;  1KHP A;  1X9Y A;  1PPN A;  3QSD A;  4BS6 A;  3CBJ A;  2UZJ A;  4RF1 A;  1HUC B;  5CVO B;  1GLO A;  4YYW A;  3H8B A; 
#chains in the Genus database with same CATH homology
 2C0Y A;  4YVA A;  3PBH A;  2PBH A;  4XR7 A;  1CJL A;  2HD5 A;  1JQP A;  4I04 A;  5CHT A;  3S3R A;  2FUD A;  3HD3 A;  2BDL A;  1QMY A;  1PPP A;  2OP3 A;  3IUT A;  3K9M A;  2VHF A;  4YYV A;  4HWY A;  1THE A;  1BP4 A;  2XU4 A;  2BSZ A;  3RVX A;  2E03 A;  1PPO A;  1BQI A;  3BCN A;  9PAP A;  3N3K A;  4BPV A;  4I05 A;  3ERV A;  1KFU L;  1AYW A;  1NL6 A;  2FT2 A;  2WBF X;  1KXR A;  3CH3 X;  1XKG A;  4P6G A;  1W6F A;  3DF0 A;  2R9O A;  2GFO A;  4MSX A;  3HHA A;  3IV2 A;  2JQG R;  2P7U A;  4CDE B;  4QRG A;  1VJV A;  1ZIV A;  5A24 A;  4X6H A;  1CB5 A;  1GMY A;  3TNX A;  4CDF B;  4I07 A;  3WXE A;  1NB3 A;  2R9C A;  1U9X A;  3O0U A;  3PW3 A;  1CSB B;  5PAD A;  2ACT A;  3V6E A;  1NLJ A;  2R6N A;  2DC6 A;  1EWP A;  3CBK A;  4FIP A;  1YK7 A;  4RY2 A;  1NQC A;  3USV A;  3I3T A;  3E1Z B;  3OF8 A;  1EWL A;  5F02 A;  3MTN A;  2VFC A;  4N4Z A;  2BDZ A;  2R9M A;  1YAL A;  2R9N A;  4QH6 A;  4BGF A;  3RVV A;  4FJC A;  4BS5 A;  3BPM A;  3HWN A;  4MZS A;  1W4T A;  2PAD A;  5CVN B;  3KFQ A;  1PBH A;  5J94 A;  2FYE A;  4C5P A;  3PNR A;  3H7D A;  4NV7 A;  1MHW A;  3F5V A;  1VSN A;  2AVW A;  3IEJ A;  1O0E A;  1S4V A;  1POP A;  3QT4 A;  4K7C A;  1PAD A;  1QOL A;  1IWD A;  4MZO A;  3KWZ A;  2GHU A;  2F1G A;  1TLO A;  2FQ9 A;  2HH5 A;  3ZUA A;  1K3B B;  4CDD B;  1U9W A;  2Y5B A;  3D9W A;  4W5C A;  2NQI A;  4NV8 A;  5JH3 A;  3BWK A;  2DJF B;  1PPD A;  1GCB A;  1BY8 A;  2P86 A;  2E00 A;  2VHS A;  3KX1 A;  7PCK A;  1AYV A;  1KHQ A;  4W4U A;  2DC7 A;  3OVX A;  2NQA A;  4YYU A;  5CVM A;  1Y4H A;  1CPJ A;  2PNS A;  3OVZ A;  4CZW A;  1Q6K A;  1MEG A;  1SP4 B;  2FRQ A;  5EGW A;  4YYQ A;  4YYR A;  4OEL A;  2HXZ A;  2O6X A;  3MHH A;  2FTD A;  3U8E A;  3WXG A;  2ATO A;  3GCB A;  3KKU A;  4W5B A;  2AYN A;  1ITO A;  4Q8H A;  2FRA A;  3H8C A;  2AS8 A;  2AU1 A;  2DCB A;  2G6D A;  2DCC A;  2E02 A;  1ICF A;  1CTE A;  1PCI A;  2DJG B;  1AIM A;  1DEU A;  1EF7 A;  1PIP A;  4N8W A;  3IHP A;  2JQF R;  3BPF A;  3IOQ A;  2XU1 A;  1FH0 A;  1QXP A;  1ATK A;  1NB5 A;  4AXM A;  2DZZ A;  2F7D A;  2IBI A;  5CHV A;  2R9F A;  3I06 A;  3MOR A;  3BOW A;  4YV8 A;  4N79 A;  1PXV A;  2B1N A;  1CVZ A;  4QBB A;  4PI3 A;  3MHS A;  1MEM A;  2NQD B;  1F29 A;  5EF4 A;  2YJ2 A;  3S3Q A;  4PAD A;  1BGO A;  1ME3 A;  2YJB A;  2XU5 A;  1ME4 A;  1QDQ A;  1YK8 A;  4ZUX U;  3K8U A;  3LTW A;  4YYS A;  1AYU A;  1F2B A;  1AU4 A;  4P6E A;  2YJ9 A;  2PRE A;  5K16 A;  1TU6 A;  3P5V A;  1CS8 A;  1U9V A;  2DC9 A;  1EWM A;  3CH2 X;  1STF E;  1YT7 A;  3PDF A;  3QJ3 A;  3N3G A;  2HHN A;  1MS6 A;  2E01 A;  3P5W A;  2H7J A;  3KW9 A;  1A6R A;  4BSQ A;  2NQG A;  4QRV A;  2G8E A;  2Y6E A;  2B1M A;  3F75 A;  6PAD A;  3HHI A;  2YJ8 A;  4BQV A;  3AI8 A;  3C9E A;  4PP1 A;  4QRX A;  1U9Q X;  3LFY A;  3WXF A;  1MDW A;  1GEC E;  2AUZ A;  3OIS A;  3D6S A;  4WA6 A;  1Y08 A;  3RVW A;  2G7Y A;  1SNK A;  5FPW A;  4PP2 E;  3KSE A;  2AYO A;  1AU3 A;  1E2T A;  1GX3 A;  1MIR A;  3N4C A;  3O1G A;  1TL9 A;  2P0R A;  1DF0 A;  4XUI A;  1U5I A;  1KFX L;  4OEM A;  1W5R A;  4AXL A;  1F2C A;  3BC3 A;  4DMY A;  1M6D A;  4KLB A;  2OZ2 A;  5JA7 A;  2DZY A;  1PE6 A;  1CQD A;  2DC8 A;  4X6J A;  1AU0 A;  4Q8G A;  1EWO A;  3IMA A;  2FO5 A;  4CDC B;  4FK5 A;  3H6S A;  3V6C A;  3OF9 A;  2YJC A;  1YVB A;  3P5U A;  2IPP B;  2DCD A;  2ARY A;  1F2A A;  2OUL A;  2AUX A;  2XU3 A;  2CB5 A;  3LXS A;  4DMX A;  4X6I A;  8PCH A;  3K24 A;  3KWB X;  1AEC A;  4G54 A;  3B79 A;  2AIM A;  4GUZ A;  3P5X A;  1AU2 A;  3M99 A;  3NHE A;  2CIO A;  2DCA A;  3H89 A;  1CV8 A;  2G8J A;  1ZCM A;  1NPZ A;  4B55 A;  2VFB A;  1KHP A;  1X9Y A;  1PPN A;  3QSD A;  4BS6 A;  3CBJ A;  1HUC B;  5CVO B;  1GLO A;  4YYW A;  3H8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...