1SP4B

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
b'RVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCNKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
molecule tags Hydrolase/hydrolase inhibitor
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
total genus 49
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1sp4B00
4CDEB 3WXEA 4CDCB 4QRXA 3N4CA 3BPFA 1M6DA 4YYVA 1NLJA 2GHUA 3QT4A 4CZWA 3IEJA 4X6IA 1NB3A 1Q6KA 2AYOA 4WA6A 2YJ8A 4QH6A 3KWBX 1SNKA 4YYUA 1NPZA 1ME4A 5CHTA 1MEGA 1ATKA 3N3KA 1CS8A 2GFOA 1KHPA 3V6EA 8PCHA 2AVWA 3HHAA 1PPNA 3IHPA 1KFUL 1STFE 2Y5BA 2YJCA 1PIPA 1F2AA 3DF0A 3H8BA 4OELA 4Q8GA 1CV8A 3HHIA 1QDQA 2E02A 5K16A 3BC3A 1NQCA 2DC6A 2DJFB 3D6SA 1Y08A 3MTNA 2CB5A 3LXSA 2DC7A 4BS5A 2B1MA 3CBKA 3WXGA 4W5CA 1VSNA 3F5VA 2DCCA 3OF9A 6PADA 4YYWA 1BGOA 4W4UA 1MDWA 4P6GA 4K7CA 2PADA 2JQGR 3KWZA 3H8CA 3QJ3A 2NQGA 4N79A 2CIOA 2FTDA 1POPA 1S4VA 2IPPB 1EWOA 1A6RA 2E00A 2FUDA 2XU3A 1F2CA 4FJCA 1CPJA 4YV8A 2FRAA 1TLOA 1BQIA 3MHHA 3PBHA 3P5VA 3OVXA 1ITOA 3C9EA 1CSBB 4X6HA 1KXRA 1YVBA 3AI8A 3GCBA 4N8WA 2B1NA 2DJGB 3RVXA 3H7DA 3BCNA 4BQVA 2FYEA 4ZUXU 1PPPA 1NL6A 2FQ9A 3K8UA 1YT7A 3S3RA 3HD3A 1DF0A 1MHWA 2F7DA 2BDZA 1EWPA 2HHNA 3P5XA 3CH3X 3N3GA 5FPWA 3PW3A 1EF7A 1PE6A 3K9MA 3PDFA 1THEA 1AIMA 2PNSA 5F02A 5JH3A 1EWMA 3F75A 5PADA 4YVAA 1NB5A 2DC8A 1PXVA 1IWDA 2VHSA 2R9NA 2G8JA 2E01A 1KHQA 2DCBA 1DEUA 3K24A 4I04A 1AU2A 4RY2A 2P86A 1SP4B 1ME3A 2G8EA 7PCKA 1O0EA 2C0YA 4BPVA 1AYUA 3HWNA 1Y4HA 4XUIA 1PPOA 1CQDA 1GLOA 5EGWA 2XU1A 1ZIVA 4W5BA 2PREA 3U8EA 2ARYA 3MHSA 1AECA 2YJBA 2O6XA 2YJ9A 2JQFR 2HH5A 2R6NA 4FK5A 2DC9A 2FT2A 2DZYA 4MSXA 3O0UA 1HUCB 1U5IA 2FRQA 2IBIA 3H89A 1GCBA 3IMAA 2R9OA 3TNXA 4AXMA 3OF8A 3E1ZB 9PAPA 1AYWA 4I07A 1YK8A 2FO5A 2WBFX 3QSDA 3M99A 3O1GA 4G54A 2AUXA 4KLBA 1PCIA 4FIPA 2DCAA 3KSEA 2HD5A 2AIMA 4CDFB 3PNRA 1YK7A 3RVWA 5EF4A 4QBBA 3NHEA 3WXFA 2R9FA 1X9YA 4QRVA 3KW9A 1F29A 4AXLA 2XU4A 1JQPA 3KX1A 2DCDA 1ZCMA 1CB5A 2HXZA 3P5WA 2ACTA 4X6JA 2AU1A 1AU0A 3I3TA 1U9XA 5CHVA 3KFQA 1QMYA 2H7JA 3MORA 3RVVA 3P5UA 5CVNB 2R9MA 2AUZA 4XR7A 4BS6A 4PI3A 2G7YA 1BP4A 5JA7A 1F2BA 3IUTA 4DMXA 1XKGA 2BDLA 4YYRA 4YYSA 4PADA 1AYVA 1ICFA 3BWKA 1U9QX 4MZOA 1U9WA 5CVMA 5CVOB 2OP3A 1BY8A 4MZSA 5A24A 1PPDA 4PP1A 2Y6EA 2F1GA 3IOQA 2NQDB 2E03A 3KKUA 3I06A 2DZZA 1PADA 3CBJA 4CDDB 3OISA 4I05A 1CTEA 1YALA 3USVA 2ATOA 2NQIA 3BOWA 3BPMA 4QRGA 1MEMA 2OULA 2OZ2A 2VHFA 1K3BB 1MS6A 1PBHA 2G6DA 4YYQA 2P7UA 3IV2A 4OEMA 1AU3A 2NQAA 4N4ZA 1QXPA 2AYNA 3H6SA 2YJ2A 4Q8HA 3CH2X 4BSQA 1KFXL 4HWYA 1CJLA 1CVZA 3S3QA 2R9CA 2P0RA 3OVZA 3V6CA 1GECE 4P6EA 3ERVA 5J94A 1VJVA 3B79A 2PBHA 1TU6A 3ZUAA 4PP2E 1AU4A 4DMYA 1GMYA 1MIRA 1TL9A 2XU5A 1EWLA 1U9VA 1QOLA 2AS8A 1FH0A 3LFYA
chains in the Genus database with same CATH superfamily
4CDEB 3WXEA 4CDCB 4QRXA 3N4CA 3BPFA 1M6DA 4YYVA 1NLJA 2GHUA 4RNAA 3QT4A 4CZWA 3IEJA 4X6IA 1NB3A 1Q6KA 2AYOA 4RF1A 4WA6A 2YJ8A 4QH6A 4R3DA 3KWBX 1SNKA 4YYUA 1NPZA 1ME4A 5CHTA 1MEGA 1ATKA 3N3KA 1CS8A 2GFOA 3MJ5A 1KHPA 3V6EA 2FE8A 2AVWA 8PCHA 3HHAA 1PPNA 3IHPA 1KFUL 4GUAA 1STFE 4BOUA 2Y5BA 2UZJA 1PIPA 2YJCA 1F2AA 3DF0A 3TRKA 3H8BA 4OELA 4Q8GA 1CV8A 3HHIA 1QDQA 2E02A 4D8EA 1DKIA 5K16A 3BC3A 1NQCA 2DC6A 2DJFB 3D6SA 1Y08A 3MTNA 2CB5A 3LXSA 2DC7A 3MTVA 2B1MA 4BS5A 4BOSA 3CBKA 3PHUA 3WXGA 4IP3A 2JTCA 4W5CA 1VSNA 3B21A 3F5VA 2DCCA 3O65A 4OW0A 3OF9A 6PADA 2BTWA 4YYWA 1BGOA 4W4UA 1MDWA 4P6GA 4K7CA 2PADA 2JQGR 3KWZA 3H8CA 3QJ3A 2NQGA 4N79A 2JRIA 2CIOA 2FTDA 1POPA 1S4VA 2IPPB 1EWOA 3IFUA 1A6RA 2E00A 2FUDA 2XU3A 1F2CA 4FJCA 1CPJA 4YV8A 2Z84A 2FRAA 1TLOA 5E6JA 1BQIA 3MHHA 3PBHA 3P5VA 3OVXA 1ITOA 3C9EA 1CSBB 4X6HA 1KXRA 3C0RA 1YVBA 3AI8A 3GCBA 4N8WA 2B1NA 2DJGB 3RVXA 3H7DA 3BCNA 4BQVA 2FYEA 5EZSA 4ZUXU 3TMPA 1PPPA 4OVZA 1NL6A 2FQ9A 4ZTBA 3K8UA 1YT7A 3S3RA 3HD3A 3E9SA 1DF0A 1MHWA 4D8IA 2F7DA 2BDZA 1EWPA 2HHNA 2BTWB 3P5XA 3CH3X 3N3GA 5FPWA 3PW3A 1EF7A 1PE6A 3K9MA 3PDFA 5JZEA 1THEA 1AIMA 2PNSA 5F02A 5JH3A 1EWMA 3F75A 2DOSA 5PADA 4YVAA 1NB5A 2DC8A 1PXVA 1IWDA 2VHSA 2R9NA 2G8JA 2E01A 1KHQA 2DCBA 1DEUA 3K24A 4I04A 4BOQA 1AU2A 4WURA 4RY2A 2P86A 1SP4B 1ME3A 2G8EA 7PCKA 1O0EA 2BU3A 2C0YA 4BPVA 1AYUA 3HWNA 1Y4HA 4XUIA 1PPOA 1CQDA 1GLOA 5EGWA 2XU1A 1ZIVA 4OVZB 4W5BA 2PREA 4REZA 3U8EA 2ARYA 3MHSA 1AECA 3PHXA 2YJBA 2O6XA 4IUMA 1YZBA 2YJ9A 3BY4A 2JQFR 2HH5A 2R6NA 4FK5A 2DC9A 2FT2A 2DZYA 4MSXA 3O0UA 1HUCB 1U5IA 2FRQA 2IBIA 3H89A 1GCBA 3IMAA 2R9OA 3TNXA 4AXMA 3MP2A 3OF8A 3E1ZB 2J7QC 9PAPA 1AYWA 4I07A 1YK8A 2FO5A 2WBFX 3QSDA 4BOZA 3M99A 3O1GA 4G54A 2AUXA 4KLBA 1PCIA 4FIPA 2DCAA 3KSEA 2HD5A 2AIMA 4RF0A 3BB7A 4CDFB 3PNRA 1YK7A 3RVWA 2AGAA 5EF4A 4QBBA 3NHEA 3WXFA 2R9FA 1X9YA 3PHWA 4QRVA 3KW9A 1F29A 4AXLA 2XU4A 4D8BA 1JQPA 3KX1A 4A5UA 2DCDA 3PSEA 1ZCMA 4MI7A 1CB5A 2HXZA 3P5WA 4P16A 2ACTA 3PRPA 4X6JA 2AU1A 4HXDB 1AU0A 3I3TA 1U9XA 5CHVA 3KFQA 1QMYA 2H7JA 5EZQA 3MORA 3RVVA 3OQCA 3P5UA 5CVNB 2R9MA 2AUZA 3PT2A 4XR7A 3W31A 4BS6A 4PI3A 2G7YA 1BP4A 5JA7A 1F2BA 3IUTA 4MM3B 4DMXA 1XKGA 2BDLA 4YYRA 4YYSA 4PADA 1AYVA 1ICFA 3BWKA 1U9QX 4MZOA 1U9WA 5CVMA 5CVOB 2OP3A 3PRMA 1BY8A 4MZSA 5A24A 1PPDA 4PP1A 2Y6EA 2F1GA 3IOQA 2NQDB 2E03A 3KKUA 3I06A 4RKXA 2DZZA 1PADA 3CBJA 4CDDB 3OISA 1PVJA 4I05A 3RNVA 1CTEA 1YALA 3USVA 2ATOA 2NQIA 3BOWA 3BPMA 4QRGA 1MEMA 2OULA 2OZ2A 2HWKA 2VHFA 1K3BB 1MS6A 1PBHA 2G6DA 4M0WA 4YYQA 2P7UA 3ZNHA 3IV2A 4OEMA 1AU3A 2NQAA 4N4ZA 1QXPA 2AYNA 3H6SA 2YJ2A 4BOPA 4Q8HA 3CH2X 4BSQA 1KFXL 4HWYA 1CJLA 1CVZA 3S3QA 2R9CA 2P0RA 1UKFA 3OVZA 3V6CA 1GECE 4P6EA 3ERVA 5J94A 1VJVA 3B79A 5KO3A 2PBHA 1TU6A 3ZUAA 2J7QA 4PP2E 1AU4A 4DMYA 1GMYA 1MIRA 1TL9A 2XU5A 1EWLA 1U9VA 1QOLA 3BBAA 2AS8A 4PT5A 1FH0A 4XZXA 3LFYA 3W30A
chains in the Genus database with same CATH topology
4CDEB 3WXEA 4CDCB 4QRXA 3N4CA 3BPFA 1M6DA 4YYVA 1NLJA 2GHUA 3QT4A 4CZWA 4GUZA 1W5RA 2BSZA 3IEJA 4X6IA 1NB3A 1Q6KA 2AYOA 4WA6A 2YJ8A 4QH6A 3KWBX 1SNKA 4YYUA 1NPZA 1ME4A 5CHTA 1MEGA 1ATKA 3N3KA 1CS8A 2GFOA 1KHPA 3V6EA 8PCHA 2AVWA 3HHAA 1PPNA 3IHPA 1KFUL 1STFE 2Y5BA 2YJCA 1PIPA 1F2AA 3DF0A 3LTWA 3H8BA 4OELA 4Q8GA 1CV8A 3HHIA 1QDQA 2E02A 5K16A 3BC3A 1NQCA 2DC6A 2DJFB 3D6SA 1Y08A 3MTNA 2CB5A 3LXSA 2DC7A 4BS5A 2B1MA 3CBKA 3WXGA 4W5CA 1VSNA 3F5VA 2DCCA 2VFBA 3OF9A 6PADA 4YYWA 1BGOA 4W4UA 1MDWA 4P6GA 4K7CA 2PADA 2JQGR 3KWZA 3H8CA 3QJ3A 2NQGA 4N79A 2CIOA 2FTDA 1POPA 1S4VA 2IPPB 1EWOA 1A6RA 2E00A 2FUDA 2XU3A 1F2CA 4FJCA 1CPJA 4YV8A 2FRAA 1TLOA 1BQIA 3MHHA 3PBHA 3P5VA 3OVXA 1ITOA 3C9EA 1CSBB 4NV8A 4X6HA 1KXRA 1YVBA 3AI8A 3GCBA 4N8WA 2B1NA 2DJGB 3RVXA 3H7DA 3BCNA 4BQVA 2FYEA 4ZUXU 1PPPA 1NL6A 2FQ9A 3K8UA 1YT7A 3S3RA 3HD3A 1DF0A 4B55A 1MHWA 2F7DA 2BDZA 4C5PA 1EWPA 2HHNA 3P5XA 3CH3X 3N3GA 5FPWA 3PW3A 1EF7A 1PE6A 3K9MA 3PDFA 1THEA 1AIMA 2PNSA 5F02A 5JH3A 1EWMA 3F75A 5PADA 4BGFA 4YVAA 1NB5A 2DC8A 1PXVA 1IWDA 2VHSA 2R9NA 2G8JA 2E01A 1KHQA 2DCBA 1DEUA 3K24A 4I04A 1AU2A 4RY2A 2P86A 1SP4B 1ME3A 2G8EA 7PCKA 1W4TA 1O0EA 2C0YA 4BPVA 1AYUA 3HWNA 1Y4HA 4XUIA 1PPOA 1CQDA 1GLOA 5EGWA 2XU1A 1ZIVA 4W5BA 2PREA 3U8EA 2ARYA 3MHSA 1AECA 2YJBA 2O6XA 2YJ9A 2JQFR 2HH5A 2R6NA 4FK5A 4NV7A 2DC9A 2FT2A 2DZYA 4MSXA 3O0UA 1HUCB 1U5IA 2FRQA 2IBIA 3H89A 1GCBA 3IMAA 2R9OA 3TNXA 4AXMA 3OF8A 3E1ZB 9PAPA 1AYWA 4I07A 1YK8A 2FO5A 2WBFX 1E2TA 3QSDA 3M99A 3O1GA 4G54A 2AUXA 4KLBA 1PCIA 4FIPA 2DCAA 3KSEA 2HD5A 2AIMA 4CDFB 3PNRA 1YK7A 3RVWA 5EF4A 1GX3A 4QBBA 3NHEA 3WXFA 2R9FA 1X9YA 4QRVA 3KW9A 1F29A 4AXLA 2XU4A 1JQPA 3KX1A 2DCDA 1ZCMA 1CB5A 2HXZA 3P5WA 2ACTA 4X6JA 2AU1A 1AU0A 3I3TA 1U9XA 5CHVA 3KFQA 1QMYA 2H7JA 3MORA 3RVVA 3P5UA 5CVNB 2R9MA 2AUZA 4XR7A 4BS6A 4PI3A 2G7YA 1BP4A 5JA7A 1F2BA 3IUTA 4DMXA 1XKGA 2BDLA 4YYRA 4YYSA 4PADA 1AYVA 1ICFA 3BWKA 1U9QX 4MZOA 1U9WA 5CVMA 5CVOB 2OP3A 1BY8A 4MZSA 5A24A 1PPDA 4PP1A 2Y6EA 2F1GA 3IOQA 2NQDB 2E03A 3KKUA 3I06A 2VFCA 2DZZA 3D9WA 1PADA 3CBJA 4CDDB 3OISA 4I05A 1CTEA 1YALA 3USVA 2ATOA 2NQIA 3BOWA 3BPMA 4QRGA 1MEMA 2OULA 2OZ2A 2VHFA 1K3BB 1MS6A 1PBHA 2G6DA 4YYQA 2P7UA 3IV2A 4OEMA 1AU3A 2NQAA 4N4ZA 1QXPA 2AYNA 3H6SA 2YJ2A 4Q8HA 3CH2X 4BSQA 1KFXL 4HWYA 1CJLA 1CVZA 3S3QA 2R9CA 2P0RA 3OVZA 3V6CA 1GECE 4P6EA 3ERVA 5J94A 1VJVA 3B79A 2PBHA 1TU6A 3ZUAA 1W6FA 4PP2E 1AU4A 4DMYA 1GMYA 1MIRA 1TL9A 2XU5A 1EWLA 1U9VA 1QOLA 2AS8A 1FH0A 3LFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDE B;  3WXE A;  4CDC B;  4QRX A;  3N4C A;  3BPF A;  1M6D A;  4YYV A;  1NLJ A;  2GHU A;  3QT4 A;  4CZW A;  3IEJ A;  4X6I A;  1NB3 A;  1Q6K A;  2AYO A;  4WA6 A;  2YJ8 A;  4QH6 A;  3KWB X;  1SNK A;  4YYU A;  1NPZ A;  1ME4 A;  5CHT A;  1MEG A;  1ATK A;  3N3K A;  1CS8 A;  2GFO A;  1KHP A;  3V6E A;  8PCH A;  2AVW A;  3HHA A;  1PPN A;  3IHP A;  1KFU L;  1STF E;  2Y5B A;  2YJC A;  1PIP A;  1F2A A;  3DF0 A;  3H8B A;  4OEL A;  4Q8G A;  1CV8 A;  3HHI A;  1QDQ A;  2E02 A;  5K16 A;  3BC3 A;  1NQC A;  2DC6 A;  2DJF B;  3D6S A;  1Y08 A;  3MTN A;  2CB5 A;  3LXS A;  2DC7 A;  4BS5 A;  2B1M A;  3CBK A;  3WXG A;  4W5C A;  1VSN A;  3F5V A;  2DCC A;  3OF9 A;  6PAD A;  4YYW A;  1BGO A;  4W4U A;  1MDW A;  4P6G A;  4K7C A;  2PAD A;  2JQG R;  3KWZ A;  3H8C A;  3QJ3 A;  2NQG A;  4N79 A;  2CIO A;  2FTD A;  1POP A;  1S4V A;  2IPP B;  1EWO A;  1A6R A;  2E00 A;  2FUD A;  2XU3 A;  1F2C A;  4FJC A;  1CPJ A;  4YV8 A;  2FRA A;  1TLO A;  1BQI A;  3MHH A;  3PBH A;  3P5V A;  3OVX A;  1ITO A;  3C9E A;  1CSB B;  4X6H A;  1KXR A;  1YVB A;  3AI8 A;  3GCB A;  4N8W A;  2B1N A;  2DJG B;  3RVX A;  3H7D A;  3BCN A;  4BQV A;  2FYE A;  4ZUX U;  1PPP A;  1NL6 A;  2FQ9 A;  3K8U A;  1YT7 A;  3S3R A;  3HD3 A;  1DF0 A;  1MHW A;  2F7D A;  2BDZ A;  1EWP A;  2HHN A;  3P5X A;  3CH3 X;  3N3G A;  5FPW A;  3PW3 A;  1EF7 A;  1PE6 A;  3K9M A;  3PDF A;  1THE A;  1AIM A;  2PNS A;  5F02 A;  5JH3 A;  1EWM A;  3F75 A;  5PAD A;  4YVA A;  1NB5 A;  2DC8 A;  1PXV A;  1IWD A;  2VHS A;  2R9N A;  2G8J A;  2E01 A;  1KHQ A;  2DCB A;  1DEU A;  3K24 A;  4I04 A;  1AU2 A;  4RY2 A;  2P86 A;  1SP4 B;  1ME3 A;  2G8E A;  7PCK A;  1O0E A;  2C0Y A;  4BPV A;  1AYU A;  3HWN A;  1Y4H A;  4XUI A;  1PPO A;  1CQD A;  1GLO A;  5EGW A;  2XU1 A;  1ZIV A;  4W5B A;  2PRE A;  3U8E A;  2ARY A;  3MHS A;  1AEC A;  2YJB A;  2O6X A;  2YJ9 A;  2JQF R;  2HH5 A;  2R6N A;  4FK5 A;  2DC9 A;  2FT2 A;  2DZY A;  4MSX A;  3O0U A;  1HUC B;  1U5I A;  2FRQ A;  2IBI A;  3H89 A;  1GCB A;  3IMA A;  2R9O A;  3TNX A;  4AXM A;  3OF8 A;  3E1Z B;  9PAP A;  1AYW A;  4I07 A;  1YK8 A;  2FO5 A;  2WBF X;  3QSD A;  3M99 A;  3O1G A;  4G54 A;  2AUX A;  4KLB A;  1PCI A;  4FIP A;  2DCA A;  3KSE A;  2HD5 A;  2AIM A;  4CDF B;  3PNR A;  1YK7 A;  3RVW A;  5EF4 A;  4QBB A;  3NHE A;  3WXF A;  2R9F A;  1X9Y A;  4QRV A;  3KW9 A;  1F29 A;  4AXL A;  2XU4 A;  1JQP A;  3KX1 A;  2DCD A;  1ZCM A;  1CB5 A;  2HXZ A;  3P5W A;  2ACT A;  4X6J A;  2AU1 A;  1AU0 A;  3I3T A;  1U9X A;  5CHV A;  3KFQ A;  1QMY A;  2H7J A;  3MOR A;  3RVV A;  3P5U A;  5CVN B;  2R9M A;  2AUZ A;  4XR7 A;  4BS6 A;  4PI3 A;  2G7Y A;  1BP4 A;  5JA7 A;  1F2B A;  3IUT A;  4DMX A;  1XKG A;  2BDL A;  4YYR A;  4YYS A;  4PAD A;  1AYV A;  1ICF A;  3BWK A;  1U9Q X;  4MZO A;  1U9W A;  5CVM A;  5CVO B;  2OP3 A;  1BY8 A;  4MZS A;  5A24 A;  1PPD A;  4PP1 A;  2Y6E A;  2F1G A;  3IOQ A;  2NQD B;  2E03 A;  3KKU A;  3I06 A;  2DZZ A;  1PAD A;  3CBJ A;  4CDD B;  3OIS A;  4I05 A;  1CTE A;  1YAL A;  3USV A;  2ATO A;  2NQI A;  3BOW A;  3BPM A;  4QRG A;  1MEM A;  2OUL A;  2OZ2 A;  2VHF A;  1K3B B;  1MS6 A;  1PBH A;  2G6D A;  4YYQ A;  2P7U A;  3IV2 A;  4OEM A;  1AU3 A;  2NQA A;  4N4Z A;  1QXP A;  2AYN A;  3H6S A;  2YJ2 A;  4Q8H A;  3CH2 X;  4BSQ A;  1KFX L;  4HWY A;  1CJL A;  1CVZ A;  3S3Q A;  2R9C A;  2P0R A;  3OVZ A;  3V6C A;  1GEC E;  4P6E A;  3ERV A;  5J94 A;  1VJV A;  3B79 A;  2PBH A;  1TU6 A;  3ZUA A;  4PP2 E;  1AU4 A;  4DMY A;  1GMY A;  1MIR A;  1TL9 A;  2XU5 A;  1EWL A;  1U9V A;  1QOL A;  2AS8 A;  1FH0 A;  3LFY A; 
#chains in the Genus database with same CATH topology
 4CDE B;  3WXE A;  4CDC B;  4QRX A;  3N4C A;  3BPF A;  1M6D A;  4YYV A;  1NLJ A;  2GHU A;  4RNA A;  3QT4 A;  4CZW A;  3IEJ A;  4X6I A;  1NB3 A;  1Q6K A;  2AYO A;  4RF1 A;  4WA6 A;  2YJ8 A;  4QH6 A;  4R3D A;  3KWB X;  1SNK A;  4YYU A;  1NPZ A;  1ME4 A;  5CHT A;  1MEG A;  1ATK A;  3N3K A;  1CS8 A;  2GFO A;  3MJ5 A;  1KHP A;  3V6E A;  2FE8 A;  2AVW A;  8PCH A;  3HHA A;  1PPN A;  3IHP A;  1KFU L;  4GUA A;  1STF E;  4BOU A;  2Y5B A;  2UZJ A;  1PIP A;  2YJC A;  1F2A A;  3DF0 A;  3TRK A;  3H8B A;  4OEL A;  4Q8G A;  1CV8 A;  3HHI A;  1QDQ A;  2E02 A;  4D8E A;  1DKI A;  5K16 A;  3BC3 A;  1NQC A;  2DC6 A;  2DJF B;  3D6S A;  1Y08 A;  3MTN A;  2CB5 A;  3LXS A;  2DC7 A;  3MTV A;  2B1M A;  4BS5 A;  4BOS A;  3CBK A;  3PHU A;  3WXG A;  4IP3 A;  2JTC A;  4W5C A;  1VSN A;  3B21 A;  3F5V A;  2DCC A;  3O65 A;  4OW0 A;  3OF9 A;  6PAD A;  2BTW A;  4YYW A;  1BGO A;  4W4U A;  1MDW A;  4P6G A;  4K7C A;  2PAD A;  2JQG R;  3KWZ A;  3H8C A;  3QJ3 A;  2NQG A;  4N79 A;  2JRI A;  2CIO A;  2FTD A;  1POP A;  1S4V A;  2IPP B;  1EWO A;  3IFU A;  1A6R A;  2E00 A;  2FUD A;  2XU3 A;  1F2C A;  4FJC A;  1CPJ A;  4YV8 A;  2Z84 A;  2FRA A;  1TLO A;  5E6J A;  1BQI A;  3MHH A;  3PBH A;  3P5V A;  3OVX A;  1ITO A;  3C9E A;  1CSB B;  4X6H A;  1KXR A;  3C0R A;  1YVB A;  3AI8 A;  3GCB A;  4N8W A;  2B1N A;  2DJG B;  3RVX A;  3H7D A;  3BCN A;  4BQV A;  2FYE A;  5EZS A;  4ZUX U;  3TMP A;  1PPP A;  4OVZ A;  1NL6 A;  2FQ9 A;  4ZTB A;  3K8U A;  1YT7 A;  3S3R A;  3HD3 A;  3E9S A;  1DF0 A;  1MHW A;  4D8I A;  2F7D A;  2BDZ A;  1EWP A;  2HHN A;  2BTW B;  3P5X A;  3CH3 X;  3N3G A;  5FPW A;  3PW3 A;  1EF7 A;  1PE6 A;  3K9M A;  3PDF A;  5JZE A;  1THE A;  1AIM A;  2PNS A;  5F02 A;  5JH3 A;  1EWM A;  3F75 A;  2DOS A;  5PAD A;  4YVA A;  1NB5 A;  2DC8 A;  1PXV A;  1IWD A;  2VHS A;  2R9N A;  2G8J A;  2E01 A;  1KHQ A;  2DCB A;  1DEU A;  3K24 A;  4I04 A;  4BOQ A;  1AU2 A;  4WUR A;  4RY2 A;  2P86 A;  1SP4 B;  1ME3 A;  2G8E A;  7PCK A;  1O0E A;  2BU3 A;  2C0Y A;  4BPV A;  1AYU A;  3HWN A;  1Y4H A;  4XUI A;  1PPO A;  1CQD A;  1GLO A;  5EGW A;  2XU1 A;  1ZIV A;  4OVZ B;  4W5B A;  2PRE A;  4REZ A;  3U8E A;  2ARY A;  3MHS A;  1AEC A;  3PHX A;  2YJB A;  2O6X A;  4IUM A;  1YZB A;  2YJ9 A;  3BY4 A;  2JQF R;  2HH5 A;  2R6N A;  4FK5 A;  2DC9 A;  2FT2 A;  2DZY A;  4MSX A;  3O0U A;  1HUC B;  1U5I A;  2FRQ A;  2IBI A;  3H89 A;  1GCB A;  3IMA A;  2R9O A;  3TNX A;  4AXM A;  3MP2 A;  3OF8 A;  3E1Z B;  2J7Q C;  9PAP A;  1AYW A;  4I07 A;  1YK8 A;  2FO5 A;  2WBF X;  3QSD A;  4BOZ A;  3M99 A;  3O1G A;  4G54 A;  2AUX A;  4KLB A;  1PCI A;  4FIP A;  2DCA A;  3KSE A;  2HD5 A;  2AIM A;  4RF0 A;  3BB7 A;  4CDF B;  3PNR A;  1YK7 A;  3RVW A;  2AGA A;  5EF4 A;  4QBB A;  3NHE A;  3WXF A;  2R9F A;  1X9Y A;  3PHW A;  4QRV A;  3KW9 A;  1F29 A;  4AXL A;  2XU4 A;  4D8B A;  1JQP A;  3KX1 A;  4A5U A;  2DCD A;  3PSE A;  1ZCM A;  4MI7 A;  1CB5 A;  2HXZ A;  3P5W A;  4P16 A;  2ACT A;  3PRP A;  4X6J A;  2AU1 A;  4HXD B;  1AU0 A;  3I3T A;  1U9X A;  5CHV A;  3KFQ A;  1QMY A;  2H7J A;  5EZQ A;  3MOR A;  3RVV A;  3OQC A;  3P5U A;  5CVN B;  2R9M A;  2AUZ A;  3PT2 A;  4XR7 A;  3W31 A;  4BS6 A;  4PI3 A;  2G7Y A;  1BP4 A;  5JA7 A;  1F2B A;  3IUT A;  4MM3 B;  4DMX A;  1XKG A;  2BDL A;  4YYR A;  4YYS A;  4PAD A;  1AYV A;  1ICF A;  3BWK A;  1U9Q X;  4MZO A;  1U9W A;  5CVM A;  5CVO B;  2OP3 A;  3PRM A;  1BY8 A;  4MZS A;  5A24 A;  1PPD A;  4PP1 A;  2Y6E A;  2F1G A;  3IOQ A;  2NQD B;  2E03 A;  3KKU A;  3I06 A;  4RKX A;  2DZZ A;  1PAD A;  3CBJ A;  4CDD B;  3OIS A;  1PVJ A;  4I05 A;  3RNV A;  1CTE A;  1YAL A;  3USV A;  2ATO A;  2NQI A;  3BOW A;  3BPM A;  4QRG A;  1MEM A;  2OUL A;  2OZ2 A;  2HWK A;  2VHF A;  1K3B B;  1MS6 A;  1PBH A;  2G6D A;  4M0W A;  4YYQ A;  2P7U A;  3ZNH A;  3IV2 A;  4OEM A;  1AU3 A;  2NQA A;  4N4Z A;  1QXP A;  2AYN A;  3H6S A;  2YJ2 A;  4BOP A;  4Q8H A;  3CH2 X;  4BSQ A;  1KFX L;  4HWY A;  1CJL A;  1CVZ A;  3S3Q A;  2R9C A;  2P0R A;  1UKF A;  3OVZ A;  3V6C A;  1GEC E;  4P6E A;  3ERV A;  5J94 A;  1VJV A;  3B79 A;  5KO3 A;  2PBH A;  1TU6 A;  3ZUA A;  2J7Q A;  4PP2 E;  1AU4 A;  4DMY A;  1GMY A;  1MIR A;  1TL9 A;  2XU5 A;  1EWL A;  1U9V A;  1QOL A;  3BBA A;  2AS8 A;  4PT5 A;  1FH0 A;  4XZX A;  3LFY A;  3W30 A; 
#chains in the Genus database with same CATH homology
 4CDE B;  3WXE A;  4CDC B;  4QRX A;  3N4C A;  3BPF A;  1M6D A;  4YYV A;  1NLJ A;  2GHU A;  3QT4 A;  4CZW A;  4GUZ A;  1W5R A;  2BSZ A;  3IEJ A;  4X6I A;  1NB3 A;  1Q6K A;  2AYO A;  4WA6 A;  2YJ8 A;  4QH6 A;  3KWB X;  1SNK A;  4YYU A;  1NPZ A;  1ME4 A;  5CHT A;  1MEG A;  1ATK A;  3N3K A;  1CS8 A;  2GFO A;  1KHP A;  3V6E A;  8PCH A;  2AVW A;  3HHA A;  1PPN A;  3IHP A;  1KFU L;  1STF E;  2Y5B A;  2YJC A;  1PIP A;  1F2A A;  3DF0 A;  3LTW A;  3H8B A;  4OEL A;  4Q8G A;  1CV8 A;  3HHI A;  1QDQ A;  2E02 A;  5K16 A;  3BC3 A;  1NQC A;  2DC6 A;  2DJF B;  3D6S A;  1Y08 A;  3MTN A;  2CB5 A;  3LXS A;  2DC7 A;  4BS5 A;  2B1M A;  3CBK A;  3WXG A;  4W5C A;  1VSN A;  3F5V A;  2DCC A;  2VFB A;  3OF9 A;  6PAD A;  4YYW A;  1BGO A;  4W4U A;  1MDW A;  4P6G A;  4K7C A;  2PAD A;  2JQG R;  3KWZ A;  3H8C A;  3QJ3 A;  2NQG A;  4N79 A;  2CIO A;  2FTD A;  1POP A;  1S4V A;  2IPP B;  1EWO A;  1A6R A;  2E00 A;  2FUD A;  2XU3 A;  1F2C A;  4FJC A;  1CPJ A;  4YV8 A;  2FRA A;  1TLO A;  1BQI A;  3MHH A;  3PBH A;  3P5V A;  3OVX A;  1ITO A;  3C9E A;  1CSB B;  4NV8 A;  4X6H A;  1KXR A;  1YVB A;  3AI8 A;  3GCB A;  4N8W A;  2B1N A;  2DJG B;  3RVX A;  3H7D A;  3BCN A;  4BQV A;  2FYE A;  4ZUX U;  1PPP A;  1NL6 A;  2FQ9 A;  3K8U A;  1YT7 A;  3S3R A;  3HD3 A;  1DF0 A;  4B55 A;  1MHW A;  2F7D A;  2BDZ A;  4C5P A;  1EWP A;  2HHN A;  3P5X A;  3CH3 X;  3N3G A;  5FPW A;  3PW3 A;  1EF7 A;  1PE6 A;  3K9M A;  3PDF A;  1THE A;  1AIM A;  2PNS A;  5F02 A;  5JH3 A;  1EWM A;  3F75 A;  5PAD A;  4BGF A;  4YVA A;  1NB5 A;  2DC8 A;  1PXV A;  1IWD A;  2VHS A;  2R9N A;  2G8J A;  2E01 A;  1KHQ A;  2DCB A;  1DEU A;  3K24 A;  4I04 A;  1AU2 A;  4RY2 A;  2P86 A;  1SP4 B;  1ME3 A;  2G8E A;  7PCK A;  1W4T A;  1O0E A;  2C0Y A;  4BPV A;  1AYU A;  3HWN A;  1Y4H A;  4XUI A;  1PPO A;  1CQD A;  1GLO A;  5EGW A;  2XU1 A;  1ZIV A;  4W5B A;  2PRE A;  3U8E A;  2ARY A;  3MHS A;  1AEC A;  2YJB A;  2O6X A;  2YJ9 A;  2JQF R;  2HH5 A;  2R6N A;  4FK5 A;  4NV7 A;  2DC9 A;  2FT2 A;  2DZY A;  4MSX A;  3O0U A;  1HUC B;  1U5I A;  2FRQ A;  2IBI A;  3H89 A;  1GCB A;  3IMA A;  2R9O A;  3TNX A;  4AXM A;  3OF8 A;  3E1Z B;  9PAP A;  1AYW A;  4I07 A;  1YK8 A;  2FO5 A;  2WBF X;  1E2T A;  3QSD A;  3M99 A;  3O1G A;  4G54 A;  2AUX A;  4KLB A;  1PCI A;  4FIP A;  2DCA A;  3KSE A;  2HD5 A;  2AIM A;  4CDF B;  3PNR A;  1YK7 A;  3RVW A;  5EF4 A;  1GX3 A;  4QBB A;  3NHE A;  3WXF A;  2R9F A;  1X9Y A;  4QRV A;  3KW9 A;  1F29 A;  4AXL A;  2XU4 A;  1JQP A;  3KX1 A;  2DCD A;  1ZCM A;  1CB5 A;  2HXZ A;  3P5W A;  2ACT A;  4X6J A;  2AU1 A;  1AU0 A;  3I3T A;  1U9X A;  5CHV A;  3KFQ A;  1QMY A;  2H7J A;  3MOR A;  3RVV A;  3P5U A;  5CVN B;  2R9M A;  2AUZ A;  4XR7 A;  4BS6 A;  4PI3 A;  2G7Y A;  1BP4 A;  5JA7 A;  1F2B A;  3IUT A;  4DMX A;  1XKG A;  2BDL A;  4YYR A;  4YYS A;  4PAD A;  1AYV A;  1ICF A;  3BWK A;  1U9Q X;  4MZO A;  1U9W A;  5CVM A;  5CVO B;  2OP3 A;  1BY8 A;  4MZS A;  5A24 A;  1PPD A;  4PP1 A;  2Y6E A;  2F1G A;  3IOQ A;  2NQD B;  2E03 A;  3KKU A;  3I06 A;  2VFC A;  2DZZ A;  3D9W A;  1PAD A;  3CBJ A;  4CDD B;  3OIS A;  4I05 A;  1CTE A;  1YAL A;  3USV A;  2ATO A;  2NQI A;  3BOW A;  3BPM A;  4QRG A;  1MEM A;  2OUL A;  2OZ2 A;  2VHF A;  1K3B B;  1MS6 A;  1PBH A;  2G6D A;  4YYQ A;  2P7U A;  3IV2 A;  4OEM A;  1AU3 A;  2NQA A;  4N4Z A;  1QXP A;  2AYN A;  3H6S A;  2YJ2 A;  4Q8H A;  3CH2 X;  4BSQ A;  1KFX L;  4HWY A;  1CJL A;  1CVZ A;  3S3Q A;  2R9C A;  2P0R A;  3OVZ A;  3V6C A;  1GEC E;  4P6E A;  3ERV A;  5J94 A;  1VJV A;  3B79 A;  2PBH A;  1TU6 A;  3ZUA A;  1W6F A;  4PP2 E;  1AU4 A;  4DMY A;  1GMY A;  1MIR A;  1TL9 A;  2XU5 A;  1EWL A;  1U9V A;  1QOL A;  2AS8 A;  1FH0 A;  3LFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...