1SP4B

Crystal structure of ns-134 in complex with bovine cathepsin b: a two headed epoxysuccinyl inhibitor extends along the whole active site cleft
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
b'RVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCNKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMPCT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Crystal structure of NS-134 in complex with bovine cathepsin B: a two-headed epoxysuccinyl inhibitor extends along the entire active-site cleft.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 205
sequence length 205
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2004-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1sp4B00
4PP2E 8PCHA 4AXMA 1O0EA 2BDLA 1DF0A 2OZ2A 2R9OA 2FUDA 3MHSA 2DC6A 3TNXA 5EGWA 1EWOA 1KHPA 3HHAA 1K3BB 2AVWA 4I07A 2G6DA 2DC9A 4CZWA 2DCAA 1QXPA 1ME3A 2DC8A 3IMAA 1U9QX 3ERVA 3U8EA 2DC7A 1U9WA 5K16A 5EF4A 1AECA 2E03A 4MZOA 5CHTA 2F7DA 4I05A 4BSQA 1CPJA 3H8CA 2FT2A 1NB5A 2CIOA 2GHUA 4OEMA 1IWDA 4PADA 2XU5A 1ZCMA 1PCIA 3P5XA 4P6GA 4ZUXU 3CBKA 4N8WA 1NLJA 1QDQA 3BPMA 3QT4A 4CDCB 1PBHA 4I04A 3IEJA 3PW3A 4MSXA 2IPPB 1M6DA 2E02A 1MDWA 5CVNB 2YJ8A 3IOQA 2NQDB 3WXEA 1STFE 1BP4A 4X6JA 3QSDA 1QMYA 2R9NA 4QRXA 3BPFA 4YYUA 4QRGA 2OP3A 3HWNA 1YVBA 1S4VA 3NHEA 1HUCB 4DMXA 3GCBA 1NL6A 3V6EA 1ICFA 1CJLA 2Y6EA 5FPWA 3AI8A 1U5IA 3MTNA 2P0RA 4PI3A 1YK7A 1AYUA 1TLOA 2FYEA 1F2BA 2HXZA 1XKGA 3M99A 4DMYA 2E01A 1AU4A 3D6SA 2YJ2A 1YT7A 1SP4B 2ACTA 3BWKA 1EWPA 4XR7A 3QJ3A 1AIMA 4MZSA 3KWZA 2E00A 2R9CA 1PPDA 2FRAA 4YYSA 3K24A 5J94A 4YYWA 3OVZA 2AU1A 3RVWA 3CBJA 1ZIVA 1YK8A 1X9YA 2WBFX 1POPA 3IUTA 4W4UA 1CTEA 3F75A 4CDFB 2PADA 1PE6A 2B1MA 2OULA 3LFYA 1VJVA 3O0UA 2YJCA 1CB5A 3KX1A 2C0YA 2DJGB 4OELA 1TL9A 2Y5BA 3PNRA 2DZZA 3PBHA 1Y4HA 5JA7A 4FJCA 1CVZA 5CHVA 3S3QA 1KHQA 5CVMA 2JQGR 3MHHA 1THEA 2PNSA 1EWMA 2AYNA 1DEUA 1AYVA 1GMYA 2FO5A 4BS5A 2ARYA 1U9VA 2NQGA 2HHNA 2P86A 3F5VA 3OISA 2XU1A 4YYQA 4N4ZA 3KW9A 3DF0A 2R9FA 4QBBA 3IV2A 3KWBX 1A6RA 1MHWA 2DCCA 4X6HA 2DCDA 2GFOA 1MIRA 1NB3A 3H6SA 1ME4A 2H7JA 4YYRA 4BQVA 1YALA 1NPZA 3B79A 2HH5A 4W5BA 1EF7A 4Q8HA 1AU2A 4CDEB 2R9MA 2O6XA 2IBIA 1U9XA 4W5CA 1CQDA 1JQPA 3O1GA 3H7DA 2AYOA 3S3RA 4YVAA 4HWYA 7PCKA 2G8EA 2ATOA 2VHFA 3KSEA 1F2AA 4YYVA 1NQCA 3N3GA 6PADA 2AUXA 1PPNA 4CDDB 3BOWA 2DJFB 4PP1A 2XU3A 3V6CA 4K7CA 3CH3X 4YV8A 4FIPA 1MS6A 4N79A 1KXRA 4FK5A 5JH3A 2AUZA 2R6NA 2FQ9A 3HHIA 2JQFR 1PPOA 3N3KA 1CV8A 1ATKA 3KKUA 1PIPA 3WXGA 3PDFA 3OF8A 4QRVA 2VHSA 3USVA 1CS8A 1GCBA 3H8BA 1VSNA 2NQIA 3P5VA 1BQIA 4XUIA 4AXLA 2XU4A 3I3TA 4KLBA 1KFUL 2G7YA 3OVXA 4QH6A 2YJ9A 1BGOA 1GLOA 2DCBA 9PAPA 1F29A 3OF9A 2BDZA 4P6EA 3BC3A 5PADA 3H89A 1AU0A 3P5WA 1ITOA 4G54A 1Y08A 3WXFA 2DZYA 2P7UA 3K9MA 1FH0A 4Q8GA 3MORA 2FRQA 2AS8A 1SNKA 3BCNA 2HD5A 3RVVA 1PXVA 3IHPA 1KFXL 3N4CA 2G8JA 1PPPA 1QOLA 5CVOB 3I06A 4X6IA 2FTDA 2NQAA 1Q6KA 1MEMA 1EWLA 2B1NA 5F02A 4BS6A 4WA6A 1MEGA 4BPVA 3LXSA 1CSBB 1AYWA 1BY8A 1TU6A 3CH2X 3E1ZB 3P5UA 3KFQA 5A24A 3RVXA 1F2CA 1GECE 3K8UA 4RY2A 2F1GA 2YJBA 2CB5A 1AU3A 3C9EA 2AIMA 3ZUAA 2PREA 3HD3A 1PADA 2PBHA
chains in the Genus database with same CATH superfamily
4PP2E 8PCHA 4AXMA 4BOUA 1O0EA 2BDLA 1DF0A 2OZ2A 2R9OA 3PRPA 3MJ5A 2FUDA 3MHSA 2DC6A 3TNXA 5EGWA 4BOQA 1EWOA 1KHPA 2HWKA 3HHAA 1K3BB 2AVWA 4I07A 5EZQA 2G6DA 4BOZA 2DC9A 2DOSA 3RNVA 4MI7A 4CZWA 2DCAA 1QXPA 1ME3A 2DC8A 3IMAA 3W30A 1U9QX 4OW0A 3ERVA 2JRIA 3U8EA 2DC7A 1U9WA 5K16A 5EF4A 4GUAA 1AECA 2E03A 4MZOA 5CHTA 2F7DA 4I05A 4BSQA 1CPJA 3H8CA 2FT2A 1NB5A 4RF1A 2CIOA 2GHUA 4OEMA 1IWDA 4PADA 2XU5A 1ZCMA 1PCIA 2FE8A 3PHUA 3P5XA 4P6GA 4ZUXU 3CBKA 3C0RA 4A5UA 3MTVA 4N8WA 1NLJA 1QDQA 4HXDB 3BPMA 3QT4A 4CDCB 1PBHA 4I04A 3IEJA 3PW3A 4MSXA 2IPPB 1M6DA 2E02A 1MDWA 5CVNB 2YJ8A 5JZEA 4RF0A 3IOQA 2NQDB 3BBAA 3WXEA 1STFE 1BP4A 3TMPA 4X6JA 1PVJA 3QSDA 1QMYA 2R9NA 4QRXA 3BPFA 4IUMA 4QRGA 4YYUA 2OP3A 3HWNA 1YVBA 1S4VA 3NHEA 4WURA 1HUCB 4DMXA 3GCBA 4RKXA 1NL6A 3V6EA 1ICFA 1CJLA 2Y6EA 5FPWA 3AI8A 1U5IA 3MTNA 2P0RA 4PI3A 2J7QC 1YK7A 1AYUA 1TLOA 3W31A 2FYEA 2J7QA 2BTWB 1F2BA 2HXZA 1XKGA 3M99A 4D8IA 4DMYA 2E01A 1AU4A 5EZSA 3D6SA 2YJ2A 1YT7A 4IP3A 1SP4B 4MM3B 2ACTA 3ZNHA 5E6JA 3BWKA 1EWPA 4XR7A 3QJ3A 1AIMA 4MZSA 3KWZA 2E00A 2R9CA 1PPDA 2FRAA 4REZA 4YYSA 3K24A 5J94A 4YYWA 3OVZA 2AU1A 3RVWA 3CBJA 1ZIVA 1UKFA 1YK8A 4BOPA 1X9YA 3PHWA 4ZTBA 4D8EA 2WBFX 1POPA 3IUTA 4W4UA 1CTEA 3F75A 3PSEA 4CDFB 2PADA 1PE6A 2B1MA 2OULA 3LFYA 1VJVA 3O0UA 2YJCA 1CB5A 3KX1A 2C0YA 2DJGB 1TL9A 4OELA 2Y5BA 3PNRA 2DZZA 3PBHA 1Y4HA 5JA7A 4FJCA 1CVZA 2JTCA 5CHVA 3S3QA 1KHQA 4D8BA 5CVMA 2AGAA 2JQGR 1THEA 3MHHA 2PNSA 1EWMA 2AYNA 1DEUA 1AYVA 1GMYA 2FO5A 4BS5A 2ARYA 2UZJA 1U9VA 2NQGA 2HHNA 2P86A 3F5VA 3OISA 4PT5A 2XU1A 4YYQA 4N4ZA 3O65A 3MP2A 2BTWA 3DF0A 2R9FA 3KW9A 4QBBA 3IV2A 1DKIA 2BU3A 3KWBX 1A6RA 1MHWA 2DCCA 4X6HA 2DCDA 2GFOA 1MIRA 1NB3A 3H6SA 1ME4A 3PHXA 2H7JA 4YYRA 3TRKA 4BQVA 1YALA 1NPZA 3B79A 2HH5A 4W5BA 1EF7A 2Z84A 4Q8HA 1AU2A 4CDEB 2R9MA 2O6XA 2IBIA 1U9XA 4W5CA 1CQDA 1JQPA 3O1GA 4M0WA 3H7DA 2AYOA 3S3RA 4P16A 4YVAA 4HWYA 3B21A 7PCKA 2G8EA 2ATOA 2VHFA 3KSEA 1F2AA 4YYVA 1NQCA 3PRMA 3N3GA 6PADA 2AUXA 1PPNA 4CDDB 3BOWA 2DJFB 4PP1A 2XU3A 3V6CA 4K7CA 3CH3X 4YV8A 4FIPA 1MS6A 4XZXA 4N79A 1KXRA 4FK5A 5JH3A 2AUZA 2R6NA 4BOSA 2FQ9A 4OVZA 3HHIA 2JQFR 1PPOA 3N3KA 1CV8A 1ATKA 3KKUA 1PIPA 3WXGA 3PDFA 3OF8A 4QRVA 1YZBA 2VHSA 3USVA 1CS8A 1GCBA 3H8BA 1VSNA 2NQIA 3P5VA 1BQIA 4XUIA 4AXLA 2XU4A 4OVZB 3I3TA 4RNAA 4KLBA 1KFUL 2G7YA 3OVXA 4QH6A 2YJ9A 1BGOA 1GLOA 3E9SA 2DCBA 9PAPA 1F29A 3OF9A 2BDZA 4P6EA 3BC3A 5PADA 3H89A 1AU0A 3P5WA 1ITOA 5KO3A 4R3DA 4G54A 1Y08A 3PT2A 3WXFA 2DZYA 2P7UA 3K9MA 1FH0A 4Q8GA 3MORA 2FRQA 2AS8A 1SNKA 3BCNA 2HD5A 3RVVA 1PXVA 3IHPA 1KFXL 3N4CA 2G8JA 1PPPA 1QOLA 5CVOB 3I06A 4X6IA 3BY4A 2FTDA 2NQAA 1Q6KA 1MEMA 1EWLA 2B1NA 5F02A 3OQCA 4BS6A 4WA6A 1MEGA 4BPVA 3LXSA 1CSBB 1AYWA 1BY8A 3IFUA 1TU6A 3CH2X 3BB7A 3E1ZB 3P5UA 3KFQA 5A24A 3RVXA 1F2CA 1GECE 3K8UA 4RY2A 2F1GA 2YJBA 2CB5A 1AU3A 3C9EA 2AIMA 3ZUAA 2PREA 3HD3A 1PADA 2PBHA
chains in the Genus database with same CATH topology
4PP2E 8PCHA 4AXMA 1O0EA 2BDLA 1DF0A 2OZ2A 3D9WA 2R9OA 2FUDA 3MHSA 2DC6A 3TNXA 5EGWA 1EWOA 1KHPA 3HHAA 1K3BB 2AVWA 4I07A 2G6DA 2DC9A 4CZWA 2DCAA 1QXPA 1ME3A 2DC8A 3IMAA 1U9QX 3ERVA 3U8EA 2DC7A 1U9WA 5K16A 5EF4A 1AECA 2E03A 4MZOA 5CHTA 2F7DA 4I05A 4BSQA 1CPJA 3H8CA 2FT2A 1NB5A 2CIOA 2GHUA 4OEMA 1IWDA 4PADA 2XU5A 1ZCMA 1PCIA 2VFCA 3P5XA 4P6GA 4ZUXU 3CBKA 4N8WA 1NLJA 1QDQA 3BPMA 3QT4A 4CDCB 1PBHA 4I04A 3IEJA 3PW3A 4MSXA 2IPPB 1M6DA 2E02A 1MDWA 5CVNB 2YJ8A 3IOQA 2NQDB 3WXEA 1STFE 1BP4A 4X6JA 3QSDA 1QMYA 2R9NA 4QRXA 3BPFA 4YYUA 4QRGA 3LTWA 2OP3A 3HWNA 1YVBA 1S4VA 3NHEA 1HUCB 4DMXA 3GCBA 1NL6A 3V6EA 1ICFA 1CJLA 2Y6EA 5FPWA 3AI8A 1U5IA 3MTNA 2P0RA 4PI3A 1YK7A 1AYUA 1TLOA 2FYEA 1F2BA 2HXZA 1XKGA 3M99A 4DMYA 2E01A 1AU4A 3D6SA 2YJ2A 1YT7A 1SP4B 2ACTA 1W4TA 3BWKA 1EWPA 1W6FA 4XR7A 3QJ3A 1AIMA 4MZSA 2VFBA 3KWZA 2E00A 2R9CA 1PPDA 2FRAA 4YYSA 3K24A 5J94A 4YYWA 3OVZA 2AU1A 3RVWA 3CBJA 1ZIVA 1YK8A 1X9YA 2WBFX 1POPA 3IUTA 4W4UA 1CTEA 3F75A 4CDFB 2PADA 1PE6A 2B1MA 2OULA 3LFYA 1VJVA 3O0UA 2YJCA 1CB5A 3KX1A 2C0YA 2DJGB 1TL9A 4OELA 2Y5BA 3PNRA 2DZZA 3PBHA 1Y4HA 5JA7A 4FJCA 1CVZA 5CHVA 3S3QA 1KHQA 5CVMA 2JQGR 3MHHA 1THEA 2PNSA 1EWMA 2AYNA 1DEUA 1AYVA 1GMYA 2FO5A 4BS5A 2ARYA 1U9VA 2NQGA 2HHNA 2P86A 3F5VA 3OISA 4NV8A 2XU1A 4YYQA 4N4ZA 3KW9A 3DF0A 2R9FA 4NV7A 4QBBA 3IV2A 4GUZA 3KWBX 1A6RA 1MHWA 2DCCA 4X6HA 2DCDA 2GFOA 1MIRA 1NB3A 3H6SA 1ME4A 2H7JA 4YYRA 4BQVA 1YALA 1NPZA 3B79A 2HH5A 4W5BA 1EF7A 4Q8HA 1AU2A 4CDEB 2R9MA 2O6XA 2IBIA 1U9XA 4W5CA 1CQDA 1JQPA 3O1GA 3H7DA 2AYOA 3S3RA 4YVAA 4HWYA 7PCKA 2G8EA 2ATOA 2VHFA 3KSEA 1F2AA 4YYVA 1NQCA 3N3GA 6PADA 2AUXA 1PPNA 4CDDB 3BOWA 2DJFB 4PP1A 2XU3A 3V6CA 4K7CA 3CH3X 4YV8A 4FIPA 1MS6A 4N79A 1KXRA 4FK5A 5JH3A 2AUZA 2R6NA 2FQ9A 3HHIA 2JQFR 1PPOA 1GX3A 3N3KA 1CV8A 1ATKA 3KKUA 1PIPA 3WXGA 3PDFA 3OF8A 4QRVA 2VHSA 3USVA 1CS8A 1GCBA 3H8BA 1VSNA 2NQIA 3P5VA 1BQIA 4XUIA 4AXLA 2XU4A 2BSZA 3I3TA 4KLBA 1KFUL 2G7YA 3OVXA 4QH6A 2YJ9A 1BGOA 1GLOA 2DCBA 9PAPA 1F29A 3OF9A 2BDZA 4P6EA 3BC3A 5PADA 3H89A 1AU0A 4B55A 3P5WA 1ITOA 4G54A 1Y08A 3WXFA 2DZYA 2P7UA 3K9MA 1FH0A 4Q8GA 4BGFA 3MORA 2FRQA 2AS8A 1SNKA 3BCNA 2HD5A 3RVVA 1PXVA 3IHPA 1KFXL 3N4CA 2G8JA 1PPPA 1E2TA 1QOLA 5CVOB 3I06A 4X6IA 2FTDA 2NQAA 1Q6KA 1MEMA 1EWLA 2B1NA 5F02A 4BS6A 4WA6A 1MEGA 4BPVA 3LXSA 1CSBB 1AYWA 1BY8A 1TU6A 3CH2X 3E1ZB 3P5UA 3KFQA 5A24A 3RVXA 1F2CA 1GECE 3K8UA 4RY2A 2F1GA 2YJBA 2CB5A 1W5RA 1AU3A 3C9EA 2AIMA 3ZUAA 2PREA 4C5PA 3HD3A 1PADA 2PBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PP2 E;  8PCH A;  4AXM A;  1O0E A;  2BDL A;  1DF0 A;  2OZ2 A;  2R9O A;  2FUD A;  3MHS A;  2DC6 A;  3TNX A;  5EGW A;  1EWO A;  1KHP A;  3HHA A;  1K3B B;  2AVW A;  4I07 A;  2G6D A;  2DC9 A;  4CZW A;  2DCA A;  1QXP A;  1ME3 A;  2DC8 A;  3IMA A;  1U9Q X;  3ERV A;  3U8E A;  2DC7 A;  1U9W A;  5K16 A;  5EF4 A;  1AEC A;  2E03 A;  4MZO A;  5CHT A;  2F7D A;  4I05 A;  4BSQ A;  1CPJ A;  3H8C A;  2FT2 A;  1NB5 A;  2CIO A;  2GHU A;  4OEM A;  1IWD A;  4PAD A;  2XU5 A;  1ZCM A;  1PCI A;  3P5X A;  4P6G A;  4ZUX U;  3CBK A;  4N8W A;  1NLJ A;  1QDQ A;  3BPM A;  3QT4 A;  4CDC B;  1PBH A;  4I04 A;  3IEJ A;  3PW3 A;  4MSX A;  2IPP B;  1M6D A;  2E02 A;  1MDW A;  5CVN B;  2YJ8 A;  3IOQ A;  2NQD B;  3WXE A;  1STF E;  1BP4 A;  4X6J A;  3QSD A;  1QMY A;  2R9N A;  4QRX A;  3BPF A;  4YYU A;  4QRG A;  2OP3 A;  3HWN A;  1YVB A;  1S4V A;  3NHE A;  1HUC B;  4DMX A;  3GCB A;  1NL6 A;  3V6E A;  1ICF A;  1CJL A;  2Y6E A;  5FPW A;  3AI8 A;  1U5I A;  3MTN A;  2P0R A;  4PI3 A;  1YK7 A;  1AYU A;  1TLO A;  2FYE A;  1F2B A;  2HXZ A;  1XKG A;  3M99 A;  4DMY A;  2E01 A;  1AU4 A;  3D6S A;  2YJ2 A;  1YT7 A;  1SP4 B;  2ACT A;  3BWK A;  1EWP A;  4XR7 A;  3QJ3 A;  1AIM A;  4MZS A;  3KWZ A;  2E00 A;  2R9C A;  1PPD A;  2FRA A;  4YYS A;  3K24 A;  5J94 A;  4YYW A;  3OVZ A;  2AU1 A;  3RVW A;  3CBJ A;  1ZIV A;  1YK8 A;  1X9Y A;  2WBF X;  1POP A;  3IUT A;  4W4U A;  1CTE A;  3F75 A;  4CDF B;  2PAD A;  1PE6 A;  2B1M A;  2OUL A;  3LFY A;  1VJV A;  3O0U A;  2YJC A;  1CB5 A;  3KX1 A;  2C0Y A;  2DJG B;  4OEL A;  1TL9 A;  2Y5B A;  3PNR A;  2DZZ A;  3PBH A;  1Y4H A;  5JA7 A;  4FJC A;  1CVZ A;  5CHV A;  3S3Q A;  1KHQ A;  5CVM A;  2JQG R;  3MHH A;  1THE A;  2PNS A;  1EWM A;  2AYN A;  1DEU A;  1AYV A;  1GMY A;  2FO5 A;  4BS5 A;  2ARY A;  1U9V A;  2NQG A;  2HHN A;  2P86 A;  3F5V A;  3OIS A;  2XU1 A;  4YYQ A;  4N4Z A;  3KW9 A;  3DF0 A;  2R9F A;  4QBB A;  3IV2 A;  3KWB X;  1A6R A;  1MHW A;  2DCC A;  4X6H A;  2DCD A;  2GFO A;  1MIR A;  1NB3 A;  3H6S A;  1ME4 A;  2H7J A;  4YYR A;  4BQV A;  1YAL A;  1NPZ A;  3B79 A;  2HH5 A;  4W5B A;  1EF7 A;  4Q8H A;  1AU2 A;  4CDE B;  2R9M A;  2O6X A;  2IBI A;  1U9X A;  4W5C A;  1CQD A;  1JQP A;  3O1G A;  3H7D A;  2AYO A;  3S3R A;  4YVA A;  4HWY A;  7PCK A;  2G8E A;  2ATO A;  2VHF A;  3KSE A;  1F2A A;  4YYV A;  1NQC A;  3N3G A;  6PAD A;  2AUX A;  1PPN A;  4CDD B;  3BOW A;  2DJF B;  4PP1 A;  2XU3 A;  3V6C A;  4K7C A;  3CH3 X;  4YV8 A;  4FIP A;  1MS6 A;  4N79 A;  1KXR A;  4FK5 A;  5JH3 A;  2AUZ A;  2R6N A;  2FQ9 A;  3HHI A;  2JQF R;  1PPO A;  3N3K A;  1CV8 A;  1ATK A;  3KKU A;  1PIP A;  3WXG A;  3PDF A;  3OF8 A;  4QRV A;  2VHS A;  3USV A;  1CS8 A;  1GCB A;  3H8B A;  1VSN A;  2NQI A;  3P5V A;  1BQI A;  4XUI A;  4AXL A;  2XU4 A;  3I3T A;  4KLB A;  1KFU L;  2G7Y A;  3OVX A;  4QH6 A;  2YJ9 A;  1BGO A;  1GLO A;  2DCB A;  9PAP A;  1F29 A;  3OF9 A;  2BDZ A;  4P6E A;  3BC3 A;  5PAD A;  3H89 A;  1AU0 A;  3P5W A;  1ITO A;  4G54 A;  1Y08 A;  3WXF A;  2DZY A;  2P7U A;  3K9M A;  1FH0 A;  4Q8G A;  3MOR A;  2FRQ A;  2AS8 A;  1SNK A;  3BCN A;  2HD5 A;  3RVV A;  1PXV A;  3IHP A;  1KFX L;  3N4C A;  2G8J A;  1PPP A;  1QOL A;  5CVO B;  3I06 A;  4X6I A;  2FTD A;  2NQA A;  1Q6K A;  1MEM A;  1EWL A;  2B1N A;  5F02 A;  4BS6 A;  4WA6 A;  1MEG A;  4BPV A;  3LXS A;  1CSB B;  1AYW A;  1BY8 A;  1TU6 A;  3CH2 X;  3E1Z B;  3P5U A;  3KFQ A;  5A24 A;  3RVX A;  1F2C A;  1GEC E;  3K8U A;  4RY2 A;  2F1G A;  2YJB A;  2CB5 A;  1AU3 A;  3C9E A;  2AIM A;  3ZUA A;  2PRE A;  3HD3 A;  1PAD A;  2PBH A; 
#chains in the Genus database with same CATH topology
 4PP2 E;  8PCH A;  4AXM A;  4BOU A;  1O0E A;  2BDL A;  1DF0 A;  2OZ2 A;  2R9O A;  3PRP A;  3MJ5 A;  2FUD A;  3MHS A;  2DC6 A;  3TNX A;  5EGW A;  4BOQ A;  1EWO A;  1KHP A;  2HWK A;  3HHA A;  1K3B B;  2AVW A;  4I07 A;  5EZQ A;  2G6D A;  4BOZ A;  2DC9 A;  2DOS A;  3RNV A;  4MI7 A;  4CZW A;  2DCA A;  1QXP A;  1ME3 A;  2DC8 A;  3IMA A;  3W30 A;  1U9Q X;  4OW0 A;  3ERV A;  2JRI A;  3U8E A;  2DC7 A;  1U9W A;  5K16 A;  5EF4 A;  4GUA A;  1AEC A;  2E03 A;  4MZO A;  5CHT A;  2F7D A;  4I05 A;  4BSQ A;  1CPJ A;  3H8C A;  2FT2 A;  1NB5 A;  4RF1 A;  2CIO A;  2GHU A;  4OEM A;  1IWD A;  4PAD A;  2XU5 A;  1ZCM A;  1PCI A;  2FE8 A;  3PHU A;  3P5X A;  4P6G A;  4ZUX U;  3CBK A;  3C0R A;  4A5U A;  3MTV A;  4N8W A;  1NLJ A;  1QDQ A;  4HXD B;  3BPM A;  3QT4 A;  4CDC B;  1PBH A;  4I04 A;  3IEJ A;  3PW3 A;  4MSX A;  2IPP B;  1M6D A;  2E02 A;  1MDW A;  5CVN B;  2YJ8 A;  5JZE A;  4RF0 A;  3IOQ A;  2NQD B;  3BBA A;  3WXE A;  1STF E;  1BP4 A;  3TMP A;  4X6J A;  1PVJ A;  3QSD A;  1QMY A;  2R9N A;  4QRX A;  3BPF A;  4IUM A;  4QRG A;  4YYU A;  2OP3 A;  3HWN A;  1YVB A;  1S4V A;  3NHE A;  4WUR A;  1HUC B;  4DMX A;  3GCB A;  4RKX A;  1NL6 A;  3V6E A;  1ICF A;  1CJL A;  2Y6E A;  5FPW A;  3AI8 A;  1U5I A;  3MTN A;  2P0R A;  4PI3 A;  2J7Q C;  1YK7 A;  1AYU A;  1TLO A;  3W31 A;  2FYE A;  2J7Q A;  2BTW B;  1F2B A;  2HXZ A;  1XKG A;  3M99 A;  4D8I A;  4DMY A;  2E01 A;  1AU4 A;  5EZS A;  3D6S A;  2YJ2 A;  1YT7 A;  4IP3 A;  1SP4 B;  4MM3 B;  2ACT A;  3ZNH A;  5E6J A;  3BWK A;  1EWP A;  4XR7 A;  3QJ3 A;  1AIM A;  4MZS A;  3KWZ A;  2E00 A;  2R9C A;  1PPD A;  2FRA A;  4REZ A;  4YYS A;  3K24 A;  5J94 A;  4YYW A;  3OVZ A;  2AU1 A;  3RVW A;  3CBJ A;  1ZIV A;  1UKF A;  1YK8 A;  4BOP A;  1X9Y A;  3PHW A;  4ZTB A;  4D8E A;  2WBF X;  1POP A;  3IUT A;  4W4U A;  1CTE A;  3F75 A;  3PSE A;  4CDF B;  2PAD A;  1PE6 A;  2B1M A;  2OUL A;  3LFY A;  1VJV A;  3O0U A;  2YJC A;  1CB5 A;  3KX1 A;  2C0Y A;  2DJG B;  1TL9 A;  4OEL A;  2Y5B A;  3PNR A;  2DZZ A;  3PBH A;  1Y4H A;  5JA7 A;  4FJC A;  1CVZ A;  2JTC A;  5CHV A;  3S3Q A;  1KHQ A;  4D8B A;  5CVM A;  2AGA A;  2JQG R;  1THE A;  3MHH A;  2PNS A;  1EWM A;  2AYN A;  1DEU A;  1AYV A;  1GMY A;  2FO5 A;  4BS5 A;  2ARY A;  2UZJ A;  1U9V A;  2NQG A;  2HHN A;  2P86 A;  3F5V A;  3OIS A;  4PT5 A;  2XU1 A;  4YYQ A;  4N4Z A;  3O65 A;  3MP2 A;  2BTW A;  3DF0 A;  2R9F A;  3KW9 A;  4QBB A;  3IV2 A;  1DKI A;  2BU3 A;  3KWB X;  1A6R A;  1MHW A;  2DCC A;  4X6H A;  2DCD A;  2GFO A;  1MIR A;  1NB3 A;  3H6S A;  1ME4 A;  3PHX A;  2H7J A;  4YYR A;  3TRK A;  4BQV A;  1YAL A;  1NPZ A;  3B79 A;  2HH5 A;  4W5B A;  1EF7 A;  2Z84 A;  4Q8H A;  1AU2 A;  4CDE B;  2R9M A;  2O6X A;  2IBI A;  1U9X A;  4W5C A;  1CQD A;  1JQP A;  3O1G A;  4M0W A;  3H7D A;  2AYO A;  3S3R A;  4P16 A;  4YVA A;  4HWY A;  3B21 A;  7PCK A;  2G8E A;  2ATO A;  2VHF A;  3KSE A;  1F2A A;  4YYV A;  1NQC A;  3PRM A;  3N3G A;  6PAD A;  2AUX A;  1PPN A;  4CDD B;  3BOW A;  2DJF B;  4PP1 A;  2XU3 A;  3V6C A;  4K7C A;  3CH3 X;  4YV8 A;  4FIP A;  1MS6 A;  4XZX A;  4N79 A;  1KXR A;  4FK5 A;  5JH3 A;  2AUZ A;  2R6N A;  4BOS A;  2FQ9 A;  4OVZ A;  3HHI A;  2JQF R;  1PPO A;  3N3K A;  1CV8 A;  1ATK A;  3KKU A;  1PIP A;  3WXG A;  3PDF A;  3OF8 A;  4QRV A;  1YZB A;  2VHS A;  3USV A;  1CS8 A;  1GCB A;  3H8B A;  1VSN A;  2NQI A;  3P5V A;  1BQI A;  4XUI A;  4AXL A;  2XU4 A;  4OVZ B;  3I3T A;  4RNA A;  4KLB A;  1KFU L;  2G7Y A;  3OVX A;  4QH6 A;  2YJ9 A;  1BGO A;  1GLO A;  3E9S A;  2DCB A;  9PAP A;  1F29 A;  3OF9 A;  2BDZ A;  4P6E A;  3BC3 A;  5PAD A;  3H89 A;  1AU0 A;  3P5W A;  1ITO A;  5KO3 A;  4R3D A;  4G54 A;  1Y08 A;  3PT2 A;  3WXF A;  2DZY A;  2P7U A;  3K9M A;  1FH0 A;  4Q8G A;  3MOR A;  2FRQ A;  2AS8 A;  1SNK A;  3BCN A;  2HD5 A;  3RVV A;  1PXV A;  3IHP A;  1KFX L;  3N4C A;  2G8J A;  1PPP A;  1QOL A;  5CVO B;  3I06 A;  4X6I A;  3BY4 A;  2FTD A;  2NQA A;  1Q6K A;  1MEM A;  1EWL A;  2B1N A;  5F02 A;  3OQC A;  4BS6 A;  4WA6 A;  1MEG A;  4BPV A;  3LXS A;  1CSB B;  1AYW A;  1BY8 A;  3IFU A;  1TU6 A;  3CH2 X;  3BB7 A;  3E1Z B;  3P5U A;  3KFQ A;  5A24 A;  3RVX A;  1F2C A;  1GEC E;  3K8U A;  4RY2 A;  2F1G A;  2YJB A;  2CB5 A;  1AU3 A;  3C9E A;  2AIM A;  3ZUA A;  2PRE A;  3HD3 A;  1PAD A;  2PBH A; 
#chains in the Genus database with same CATH homology
 4PP2 E;  8PCH A;  4AXM A;  1O0E A;  2BDL A;  1DF0 A;  2OZ2 A;  3D9W A;  2R9O A;  2FUD A;  3MHS A;  2DC6 A;  3TNX A;  5EGW A;  1EWO A;  1KHP A;  3HHA A;  1K3B B;  2AVW A;  4I07 A;  2G6D A;  2DC9 A;  4CZW A;  2DCA A;  1QXP A;  1ME3 A;  2DC8 A;  3IMA A;  1U9Q X;  3ERV A;  3U8E A;  2DC7 A;  1U9W A;  5K16 A;  5EF4 A;  1AEC A;  2E03 A;  4MZO A;  5CHT A;  2F7D A;  4I05 A;  4BSQ A;  1CPJ A;  3H8C A;  2FT2 A;  1NB5 A;  2CIO A;  2GHU A;  4OEM A;  1IWD A;  4PAD A;  2XU5 A;  1ZCM A;  1PCI A;  2VFC A;  3P5X A;  4P6G A;  4ZUX U;  3CBK A;  4N8W A;  1NLJ A;  1QDQ A;  3BPM A;  3QT4 A;  4CDC B;  1PBH A;  4I04 A;  3IEJ A;  3PW3 A;  4MSX A;  2IPP B;  1M6D A;  2E02 A;  1MDW A;  5CVN B;  2YJ8 A;  3IOQ A;  2NQD B;  3WXE A;  1STF E;  1BP4 A;  4X6J A;  3QSD A;  1QMY A;  2R9N A;  4QRX A;  3BPF A;  4YYU A;  4QRG A;  3LTW A;  2OP3 A;  3HWN A;  1YVB A;  1S4V A;  3NHE A;  1HUC B;  4DMX A;  3GCB A;  1NL6 A;  3V6E A;  1ICF A;  1CJL A;  2Y6E A;  5FPW A;  3AI8 A;  1U5I A;  3MTN A;  2P0R A;  4PI3 A;  1YK7 A;  1AYU A;  1TLO A;  2FYE A;  1F2B A;  2HXZ A;  1XKG A;  3M99 A;  4DMY A;  2E01 A;  1AU4 A;  3D6S A;  2YJ2 A;  1YT7 A;  1SP4 B;  2ACT A;  1W4T A;  3BWK A;  1EWP A;  1W6F A;  4XR7 A;  3QJ3 A;  1AIM A;  4MZS A;  2VFB A;  3KWZ A;  2E00 A;  2R9C A;  1PPD A;  2FRA A;  4YYS A;  3K24 A;  5J94 A;  4YYW A;  3OVZ A;  2AU1 A;  3RVW A;  3CBJ A;  1ZIV A;  1YK8 A;  1X9Y A;  2WBF X;  1POP A;  3IUT A;  4W4U A;  1CTE A;  3F75 A;  4CDF B;  2PAD A;  1PE6 A;  2B1M A;  2OUL A;  3LFY A;  1VJV A;  3O0U A;  2YJC A;  1CB5 A;  3KX1 A;  2C0Y A;  2DJG B;  1TL9 A;  4OEL A;  2Y5B A;  3PNR A;  2DZZ A;  3PBH A;  1Y4H A;  5JA7 A;  4FJC A;  1CVZ A;  5CHV A;  3S3Q A;  1KHQ A;  5CVM A;  2JQG R;  3MHH A;  1THE A;  2PNS A;  1EWM A;  2AYN A;  1DEU A;  1AYV A;  1GMY A;  2FO5 A;  4BS5 A;  2ARY A;  1U9V A;  2NQG A;  2HHN A;  2P86 A;  3F5V A;  3OIS A;  4NV8 A;  2XU1 A;  4YYQ A;  4N4Z A;  3KW9 A;  3DF0 A;  2R9F A;  4NV7 A;  4QBB A;  3IV2 A;  4GUZ A;  3KWB X;  1A6R A;  1MHW A;  2DCC A;  4X6H A;  2DCD A;  2GFO A;  1MIR A;  1NB3 A;  3H6S A;  1ME4 A;  2H7J A;  4YYR A;  4BQV A;  1YAL A;  1NPZ A;  3B79 A;  2HH5 A;  4W5B A;  1EF7 A;  4Q8H A;  1AU2 A;  4CDE B;  2R9M A;  2O6X A;  2IBI A;  1U9X A;  4W5C A;  1CQD A;  1JQP A;  3O1G A;  3H7D A;  2AYO A;  3S3R A;  4YVA A;  4HWY A;  7PCK A;  2G8E A;  2ATO A;  2VHF A;  3KSE A;  1F2A A;  4YYV A;  1NQC A;  3N3G A;  6PAD A;  2AUX A;  1PPN A;  4CDD B;  3BOW A;  2DJF B;  4PP1 A;  2XU3 A;  3V6C A;  4K7C A;  3CH3 X;  4YV8 A;  4FIP A;  1MS6 A;  4N79 A;  1KXR A;  4FK5 A;  5JH3 A;  2AUZ A;  2R6N A;  2FQ9 A;  3HHI A;  2JQF R;  1PPO A;  1GX3 A;  3N3K A;  1CV8 A;  1ATK A;  3KKU A;  1PIP A;  3WXG A;  3PDF A;  3OF8 A;  4QRV A;  2VHS A;  3USV A;  1CS8 A;  1GCB A;  3H8B A;  1VSN A;  2NQI A;  3P5V A;  1BQI A;  4XUI A;  4AXL A;  2XU4 A;  2BSZ A;  3I3T A;  4KLB A;  1KFU L;  2G7Y A;  3OVX A;  4QH6 A;  2YJ9 A;  1BGO A;  1GLO A;  2DCB A;  9PAP A;  1F29 A;  3OF9 A;  2BDZ A;  4P6E A;  3BC3 A;  5PAD A;  3H89 A;  1AU0 A;  4B55 A;  3P5W A;  1ITO A;  4G54 A;  1Y08 A;  3WXF A;  2DZY A;  2P7U A;  3K9M A;  1FH0 A;  4Q8G A;  4BGF A;  3MOR A;  2FRQ A;  2AS8 A;  1SNK A;  3BCN A;  2HD5 A;  3RVV A;  1PXV A;  3IHP A;  1KFX L;  3N4C A;  2G8J A;  1PPP A;  1E2T A;  1QOL A;  5CVO B;  3I06 A;  4X6I A;  2FTD A;  2NQA A;  1Q6K A;  1MEM A;  1EWL A;  2B1N A;  5F02 A;  4BS6 A;  4WA6 A;  1MEG A;  4BPV A;  3LXS A;  1CSB B;  1AYW A;  1BY8 A;  1TU6 A;  3CH2 X;  3E1Z B;  3P5U A;  3KFQ A;  5A24 A;  3RVX A;  1F2C A;  1GEC E;  3K8U A;  4RY2 A;  2F1G A;  2YJB A;  2CB5 A;  1W5R A;  1AU3 A;  3C9E A;  2AIM A;  3ZUA A;  2PRE A;  4C5P A;  3HD3 A;  1PAD A;  2PBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...